BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780926|ref|YP_003065339.1| hypothetical protein CLIBASIA_04125 [Candidatus Liberibacter asiaticus str. psy62] (49 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780926|ref|YP_003065339.1| hypothetical protein CLIBASIA_04125 [Candidatus Liberibacter asiaticus str. psy62] Length = 49 Score = 98.6 bits (244), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 49/49 (100%), Positives = 49/49 (100%) Query: 1 MKIGSNQDDNDDFACGRKKIDAQEERKIRLASMLRKNLHRRKGQARLKN 49 MKIGSNQDDNDDFACGRKKIDAQEERKIRLASMLRKNLHRRKGQARLKN Sbjct: 1 MKIGSNQDDNDDFACGRKKIDAQEERKIRLASMLRKNLHRRKGQARLKN 49 >gi|254781176|ref|YP_003065589.1| cell division protein FtsZ [Candidatus Liberibacter asiaticus str. psy62] Length = 502 Score = 21.2 bits (43), Expect = 3.7, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 17/34 (50%) Query: 6 NQDDNDDFACGRKKIDAQEERKIRLASMLRKNLH 39 +++ DDF K EE K+ + + LR+ H Sbjct: 469 SEESIDDFCVQSKPTVKCEEDKLEIPAFLRRQSH 502 >gi|254780752|ref|YP_003065165.1| penicillin binding peptidoglycan synthetase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 817 Score = 21.2 bits (43), Expect = 3.8, Method: Composition-based stats. Identities = 11/28 (39%), Positives = 16/28 (57%) Query: 6 NQDDNDDFACGRKKIDAQEERKIRLASM 33 N D ND F K+ID +++ LAS+ Sbjct: 319 NYDQNDGFRGPIKRIDLKKDWGNTLASI 346 >gi|254780797|ref|YP_003065210.1| hypothetical protein CLIBASIA_03440 [Candidatus Liberibacter asiaticus str. psy62] Length = 231 Score = 20.8 bits (42), Expect = 4.4, Method: Compositional matrix adjust. Identities = 10/24 (41%), Positives = 14/24 (58%) Query: 26 RKIRLASMLRKNLHRRKGQARLKN 49 ++IR+AS NL + G A KN Sbjct: 5 QRIRIASWNINNLSEKSGVALFKN 28 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.318 0.133 0.370 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,702 Number of Sequences: 1233 Number of extensions: 730 Number of successful extensions: 4 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 49 length of database: 328,796 effective HSP length: 22 effective length of query: 27 effective length of database: 301,670 effective search space: 8145090 effective search space used: 8145090 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits) S2: 31 (16.5 bits)