HHsearch results for GI: 254780927 and protein with PDBid: 2yvw_A

>2yvw_A UDP-N-acetylglucosamine 1- carboxyvinyltransferase; peptidoglycan, structural genomics, NPPSFA; HET: EPU; 1.81A {Aquifex aeolicus VF5}
Probab=99.72  E-value=1.6e-15  Score=119.18  Aligned_cols=144  Identities=19%  Similarity=0.241  Sum_probs=54.6

Q ss_pred             HHHHHHHCCCCEEEECCCEEEEECCCCCCEEEEECCCCCCCCCCC--HHHHHHHHHCCCCCEEEEEECCH-HHHHHHHHH
Q ss_conf             468897526743674451267532676431576215356664210--13466763135664167320465-675667889
Q gi|254780927|r  274 VFKVMRQTGVDIDIIDEGIRVRWNGEKLRPVDVITAPFPGFPTDL--QAQFMAMMCCAAGISHITETIFE-NRFMHVQEL  350 (430)
Q Consensus       274 ~l~iL~~mGa~i~~~~~~i~V~~~~~~l~~~di~~~~~pg~~~D~--~p~la~laa~A~G~s~I~e~i~e-~R~~~~~eL  350 (430)
                      .++.|++||+++++.++.+.+.++ ..+.+.+..--+      |+  ..++.++|+...|...+.+.... .| ....-+
T Consensus       202 t~~~l~~~g~~v~~~~~~i~i~g~-~~~~~~~~~V~~------D~ssAa~~~~aa~l~~g~~~i~~~~~~~~~-~~~~~l  273 (425)
T 2yvw_A          202 LIEVLKKMGAHVKVEGRSAYVKGS-ENLKGFTHSVIP------DRIEAGTFMVGAVLTDGEILLENARINHLR-AVVEKL  273 (425)
T ss_dssp             HHHHHHHTTCEEEEETTEEEEECC-SSCCCCEEECCB------CHHHHHHHHHHHHHTTCEEEEESCCGGGCH-HHHHHH
T ss_pred             HHHHHHHCCCCEEECCEEEEEECC-CCCCCCEEEECC------CCHHHHHHHHHHHCCCCCEEEECCCCCCCH-HHHHHH
T ss_conf             999998579631301204897167-214795389578------836777788886426984699367665312-344689


Q ss_pred             HHCCCEEEEECCEEEEECCCCCEEEEEEEC-----CHHHHHHHHHHHHHCCCEEEEECCCEECCCCCCHHHHHHHCCCEE
Q ss_conf             748858999789699988898510156608-----189999999999854981999243301177848788998669789
Q gi|254780927|r  351 VRLGARISLSGQTARVEGVQGLRGAPVMAT-----DLRASVSLVIAALAAQGETEISRVYHLDRGFECLEKKLSRCGALI  425 (430)
Q Consensus       351 ~klG~~v~~~~d~l~I~G~~~l~g~~v~~~-----DHRiaMa~~ia~L~a~g~~~I~~~~~i~ksyp~f~~~L~~LGa~I  425 (430)
                      .++|+++..+.+...+.+...+++..+...     .-=.+..|+.++..++|.+++.+.|+=+..  .+.+.|+++|++|
T Consensus       274 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~a~~a~G~~~lr~KEsdRi~--~~~~~L~klG~~v  351 (425)
T 2yvw_A          274 KLIGGEVVEENGNLRVFRKESLRACDIETQVYPGFPTDMQAQFMALLSVAKGKSRIKENIFEHRF--HHAQELNRLGANI  351 (425)
T ss_dssp             HHHTEEEEEETTEEEEEECSCCBCCCEEBCSTTSBCHHHHHHHHHHHTTSBSEEEEECSSCTTCC--HHHHHHHTTTCCE
T ss_pred             HHHCCEEEEECCCEEEEECCCCCCCCCCCCCCCCCCHHCCHHHHHHEEEECCCEEEEEECCHHHH--HHHHHHHHCCCEE
T ss_conf             87276589604632675224435555677768775111001321220482461899962023688--9999999789979


Q ss_pred             EE
Q ss_conf             99
Q gi|254780927|r  426 QR  427 (430)
Q Consensus       426 e~  427 (430)
                      |.
T Consensus       352 ~~  353 (425)
T 2yvw_A          352 TV  353 (425)
T ss_dssp             EE
T ss_pred             EE
T ss_conf             99