HHsearch alignment for GI: 254780928 and conserved domain: PTZ00326

>PTZ00326 phenylalanyl-tRNA synthetase; Provisional.
Probab=98.07  E-value=2.6e-05  Score=53.66  Aligned_cols=132  Identities=21%  Similarity=0.350  Sum_probs=74.1

Q ss_pred             HHHHHHHHHHHHHHHHCCCEEEECCC-HH--H--HHHHHCCCCCCCCCCCC---EEEEECCC------------------
Q ss_conf             99999999999999985984801652-02--2--88752026755433322---16898699------------------
Q gi|254780928|r   24 RIRNRILDSIRNIYENYGFDPIETPL-LE--Y--SDSLGKFLPDEDRPNKG---VFSLQDDD------------------   77 (496)
Q Consensus        24 ~~~~~i~~~l~~~f~~~G~~~I~tP~-lE--~--~~~~~~~~~~~~~~~k~---~y~f~D~~------------------   77 (496)
T Consensus       242 hp~~~~~~~~r~if~~mGF~E~~~~~~ves~fwNfDaL---f~Pq~HPARd~~DTF~l~~p~~~~~~~~~~~~~Vk~vHe  318 (505)
T PTZ00326        242 HPLLKVRQEFREIFMEMGFEEMPTNRWVESSFWNFDAL---FIPQQHPARDLQDTFFLSKPETSKFLDAEYVERVKAVHS  318 (505)
T ss_pred             CHHHHHHHHHHHHHHHCCCEECCCCCEEEECCCCCHHH---CCCCCCCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHC
T ss_conf             88999999999999977976766897133132131110---489899866523347744754245687899998888850


Q ss_pred             -----------------CCEEEECCCCHHHHHHHHHH---HHH--HCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCHHH
Q ss_conf             -----------------98899988883899999995---112--05541123310133302587644421111100012
Q gi|254780928|r   78 -----------------GQWISLRYDLTAPLARYVAE---NFD--TIVFPCRTYRIGPVFRNEKHGPGRFRQFIQCDVDN  135 (496)
Q Consensus        78 -----------------g~~l~LRpDlT~~~aR~~~~---~~~--~~~~p~k~yy~g~vfR~e~p~~Gr~REf~Q~g~ei  135 (496)
T Consensus       319 ~G~~gs~Gw~y~W~~~~a~~~~LRthTt~vs~r~l~~~~~~~~~~~~~~P~k~fsi~rv~R~e~~d~th~~~f~Q~eg~~  398 (505)
T PTZ00326        319 GGGYGSIGWQYNWKLEEARKNVLRTHTTAVSARMLYKLAQQYQKGKGFKPKKYFSIDRVFRNETLDATHLAEFHQVEGVV  398 (505)
T ss_pred             CCCCCCCCCCCCCCHHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCEEEECCCEEECCCCCCCCCCEEEEEEEEE
T ss_conf             68878887677879778752063657753769999987540465568898147523726415777765340455435789


Q ss_pred             HHCCCHHHHHHHHHHHHHHHHHCCC
Q ss_conf             1000024578899999999975188
Q gi|254780928|r  136 VGSSAETADAEMCMMMADTLEAVGI  160 (496)
Q Consensus       136 iG~~~~~~DaEii~l~~~~l~~lgl  160 (496)
T Consensus       399 ~~~~~~~~--~l~~~l~~f~~~~g~  421 (505)
T PTZ00326        399 IDRNLSLG--DLMGTLREFFRRIGI  421 (505)
T ss_pred             ECCCCCHH--HHHHHHHHHHHHHCC
T ss_conf             64888899--999999999998498