RPSBLAST alignment for GI: 254780928 and conserved domain: pfam03129

>gnl|CDD|145985 pfam03129, HGTP_anticodon, Anticodon binding domain. This domain is found in histidyl, glycyl, threonyl and prolyl tRNA synthetases it is probably the anticodon binding domain. Length = 93
 Score = 47.6 bits (114), Expect = 7e-06
 Identities = 23/111 (20%), Positives = 46/111 (41%), Gaps = 19/111 (17%)

Query: 378 VLITTMDHDSDSLSKYQMYTQMLRTAGIRAEMFLGSSKNFGNQLKYADRRNCPLAIIQGT 437
           V++  +    +     Q   + LR AGIR E+    +++ G + + AD    P  ++ G 
Sbjct: 2   VVVIPLGEKDELEDYAQKLAEELREAGIRVELDD-RNESLGKKFRDADLIGIPFRLVVGE 60

Query: 438 GERSRGMLQIKDLAKGKELSREIKNNESWREARVAQITIPISELVSTVKKI 488
            E   G + ++D   G+                  + T+ + ELV  +K++
Sbjct: 61  KELENGTVTVRDRDTGE------------------KETVSLEELVEKLKEL 93