HHsearch alignment for GI: 254780930 and conserved domain: PRK09837

>PRK09837 copper/silver efflux system outer membrane protein CusC; Provisional.
Probab=100.00  E-value=0  Score=593.48  Aligned_cols=446  Identities=24%  Similarity=0.383  Sum_probs=400.3

Q ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCHHHHHHHCCHHHHHHHHHHHHHCHHHHH
Q ss_conf             93069999999999975026899999995647501024677---666676862343660998799999999970899899
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNS---KNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQ   77 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~~p~~~~p~~~~~~~~~~~~~~---~~~~~~~~~~ww~~~~d~~L~~~i~~Al~~np~l~~   77 (452)
T Consensus         1 ~~~~rll~l~~~l~L~gC~~~P~y~~P~~~-~p~~~~~~~~~~~~~~~~~~~~~Ww~~f~Dp~L~~LI~~Al~~N~dl~~   79 (460)
T PRK09837          1 MSPCKLLPFCVALALTGCSLAPDYQRPAMP-VPQQFSLSQNGLVNAADNYQNAGWRTFFVDNQVKTLISEALVNNRDLRM   79 (460)
T ss_pred             CCHHHHHHHHHHHHHCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCHHHHCCCHHHHHHHHHHHHCCHHHHH
T ss_conf             975789999999998247789999996999-8642355666667888764440199867998799999999965987999


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCC------CCCCCCCCCCCCCCCCHHHHHHH-HHHHHHHHHHHHHHHH
Q ss_conf             9999999999999875420530111011245665------55444443211101100123457-7888877765556799
Q gi|254780930|r   78 ATERINAAKENILSVRADLFPSSYASISHRFIPN------LKTNSTGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVD  150 (452)
Q Consensus        78 a~~~i~~a~~~~~~a~a~~~P~~~~~~~~~~~~~------~~~~~~~~~~~s~~ldl~G~~~~-~~~a~~~~~~~~~~~~  150 (452)
T Consensus        80 A~~rv~~A~a~~~~a~a~~~P~~~~~~~~~~~~~~~~~~~~~~~~~~gl~~swelDl~Gr~r~~~~aa~~~~~a~~~~~~  159 (460)
T PRK09837         80 ATLKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGDSATTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQR  159 (460)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCEEECEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999876008831220000005778899886531000204788740322048999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999876666777889999999999999999878765543234567776532223557989999998568888
Q gi|254780930|r  151 IAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV  230 (452)
Q Consensus       151 ~~~~~l~~~v~~aY~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~~~~~~~l~~~~~~~~~a~  230 (452)
T Consensus       160 ~~~l~l~a~Va~~Y~~l~~~~~~l~~~~~~l~~~~~~l~l~~~r~~~G~~s~ldv~qa~~~l~~~~a~l~~~~~~~~~~~  239 (460)
T PRK09837        160 AVHILLVSNVAQSYFNQQLAYAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN  239 (460)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999999999999999985898677899999999999987999999999999


Q ss_pred             HHHHHHCCCCHHHHCCCCCCCCCCCCCCHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCCC
Q ss_conf             76877639992130001234554433100122104887899730234556555899996430101122221001122221
Q gi|254780930|r  231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIA  310 (452)
Q Consensus       231 ~~L~~l~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~RPdi~~a~~~~~~a~~~i~~a~a~~~P~i~l~~~~~  310 (452)
T Consensus       240 ~~La~LlG~~~~~~~~~----~~~~~~~~~~~~p~~lpa~lL~~RPDI~aAe~~l~aa~a~i~vA~A~~~P~isL~~~~g  315 (460)
T PRK09837        240 NALQLLLGSYGKLPQAQ----TVNSDSLQSVKLPAGLSSQILLQRPDIMEAEHALMAANANIGAARAAFFPSISLTSGIS  315 (460)
T ss_pred             HHHHHHHCCCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCC
T ss_conf             99999819998897423----45755567777899981999884900999999999998658899984089069851555


Q ss_pred             CCCC---CCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             1223---4454454104431122345101245665677999999999999999999999999999999999999999999
Q gi|254780930|r  311 LTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQ  387 (452)
Q Consensus       311 ~~~~---~~~~~~~~~~~~g~~l~~Pif~gg~~~a~i~~a~~~~~~a~~~~~~~~~~a~~ev~~a~~~~~~~~~~~~~~~  387 (452)
T Consensus       316 ~~~~~~~~l~~~~~~~~~~~~~l~~PiFdgG~~~a~~~~a~a~~~~a~~~Y~~tvl~A~~EVe~al~~~~~~~~~~~~~~  395 (460)
T PRK09837        316 TASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIAEIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQ  395 (460)
T ss_pred             CCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             34343665157762023120343134310304699999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9999999999999999871883289999999999999999999999999999999998499999
Q gi|254780930|r  388 HAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN  451 (452)
Q Consensus       388 ~~~~~a~~~~~~~~~~y~~G~~~~~dll~a~~~~~~a~~~~~~a~~~~~~a~~~L~~AlGGg~~  451 (452)
T Consensus       396 ~~~~~a~~~~~~a~~rY~~G~~~~l~vL~Aq~~l~~a~~~l~~a~~~~~~~~v~Ly~ALGGGWq  459 (460)
T PRK09837        396 RYLASLQITLQRARALYQHGAVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGWQ  459 (460)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             9999999999999999977761599999999999999999999999999999999997088989