Query         gi|254780930|ref|YP_003065343.1| nodulation protein (outer membrane efflux protein) [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 452
No_of_seqs    237 out of 6667
Neff          9.6 
Searched_HMMs 39220
Date          Mon May 30 01:40:33 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780930.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK09837 copper/silver efflux  100.0       0       0  593.5  46.5  446    1-451     1-459 (460)
  2 PRK09915 putative outer membra 100.0       0       0  591.2  46.7  448    1-452     6-481 (488)
  3 TIGR01845 outer_NodT efflux tr 100.0       0       0  591.5  40.7  440   10-449     2-477 (477)
  4 PRK11459 multidrug resistance  100.0       0       0  565.9  46.1  446    1-451     1-477 (478)
  5 COG1538 TolC Outer membrane pr 100.0       0       0  485.7  41.1  431   13-452     2-448 (457)
  6 PRK09465 tolC outer membrane c 100.0       0       0  417.2  42.3  385   60-448    24-424 (446)
  7 TIGR01844 type_I_sec_TolC type 100.0       0       0  373.3  37.6  387   60-447     4-421 (437)
  8 pfam02321 OEP Outer membrane e  99.9 1.7E-23 4.3E-28  171.4  20.3  179  269-447     6-186 (186)
  9 pfam02321 OEP Outer membrane e  99.9 6.8E-21 1.7E-25  154.4  19.0  178   61-238     1-186 (186)
 10 PRK09465 tolC outer membrane c  99.8 5.6E-19 1.4E-23  141.8  20.2  185   60-244   230-429 (446)
 11 TIGR01844 type_I_sec_TolC type  99.8   1E-17 2.6E-22  133.6  20.1  180   60-239   224-422 (437)
 12 COG1538 TolC Outer membrane pr  99.8 3.5E-17 8.9E-22  130.1  19.5  183   61-243   257-448 (457)
 13 PRK09837 copper/silver efflux   99.8 7.5E-17 1.9E-21  127.9  20.7  176  272-447    71-247 (460)
 14 PRK09915 putative outer membra  99.7 5.3E-15 1.4E-19  115.8  20.8  295  137-445   160-467 (488)
 15 TIGR01845 outer_NodT efflux tr  99.7 5.8E-14 1.5E-18  109.0  19.5  170   69-238   297-475 (477)
 16 PRK11459 multidrug resistance   99.7 6.1E-14 1.6E-18  108.9  19.3   99  340-438   373-471 (478)
 17 PRK03598 hypothetical protein;  96.9   0.032 8.2E-07   32.3  13.1   14    1-14      1-14  (331)
 18 TIGR01843 type_I_hlyD type I s  96.5   0.059 1.5E-06   30.6  13.0  104  134-237   134-237 (434)
 19 PRK10476 multidrug resistance   96.2    0.08 2.1E-06   29.7  12.6   13  297-309   271-283 (348)
 20 PRK09859 multidrug efflux syst  95.7   0.082 2.1E-06   29.6   7.9   55  182-236   116-170 (385)
 21 PRK10476 multidrug resistance   95.5    0.16 4.1E-06   27.7  15.5   55  170-224   121-175 (348)
 22 TIGR01843 type_I_hlyD type I s  95.5    0.16 4.1E-06   27.7  15.4   28  209-236   252-279 (434)
 23 PRK11556 multidrug efflux syst  95.3    0.15 3.9E-06   27.9   8.2   58  179-236   139-196 (415)
 24 PRK12698 flgH flagellar basal   95.3   0.027 6.9E-07   32.8   4.2   21    4-24      2-22  (224)
 25 PRK09578 periplasmic multidrug  95.1    0.21 5.3E-06   27.0   8.4   54  183-236   119-172 (385)
 26 PRK12701 flgH flagellar basal   95.1   0.044 1.1E-06   31.4   4.8   21    1-21      1-22  (230)
 27 PRK10760 murein hydrolase B; P  94.3    0.21 5.3E-06   27.0   6.7   25    1-26      1-25  (357)
 28 PRK00249 flgH flagellar basal   94.0    0.11 2.9E-06   28.7   4.8   23    1-23      1-24  (231)
 29 PRK12696 flgH flagellar basal   93.7    0.13 3.2E-06   28.4   4.6   28    5-32      4-32  (238)
 30 PRK11023 hypothetical protein;  93.6   0.066 1.7E-06   30.2   3.0   64    1-76      1-65  (191)
 31 PRK00022 lolB outer membrane l  93.3   0.082 2.1E-06   29.6   3.2   22    2-23      2-23  (203)
 32 PRK13616 lipoprotein LpqB; Pro  92.4    0.33 8.5E-06   25.6   5.2   29    1-29      3-33  (590)
 33 PRK12700 flgH flagellar basal   92.1    0.22 5.7E-06   26.8   4.0   21    3-23      6-27  (230)
 34 TIGR03007 pepcterm_ChnLen poly  91.9    0.77   2E-05   23.3  20.2  218  167-406   163-392 (510)
 35 PRK11578 macrolide transporter  91.3     0.9 2.3E-05   22.8  12.6   65  171-235    89-153 (347)
 36 COG3417 FlgN Collagen-binding   91.1    0.31   8E-06   25.8   3.9   20    1-20      1-22  (200)
 37 PRK12788 flgH flagellar basal   90.9    0.43 1.1E-05   24.9   4.5   18    5-22      3-20  (231)
 38 pfam06474 MLTD_N MLTD_N.        90.5    0.42 1.1E-05   25.0   4.1   19    7-25      5-23  (93)
 39 COG3065 Slp Starvation-inducib  90.2     0.3 7.7E-06   25.9   3.2   25    1-25      5-30  (191)
 40 PRK12407 flgH flagellar basal   89.2    0.59 1.5E-05   24.0   4.0   17    6-22      4-20  (220)
 41 PRK12699 flgH flagellar basal   88.8    0.78   2E-05   23.2   4.4   21    3-23     18-38  (246)
 42 PRK12697 flgH flagellar basal   88.3    0.89 2.3E-05   22.8   4.4   19    5-23     11-29  (227)
 43 PRK10866 outer membrane protei  88.3    0.53 1.4E-05   24.3   3.3   21    1-21      1-23  (243)
 44 pfam07901 DUF1672 Protein of u  87.7    0.43 1.1E-05   24.9   2.5   24    1-24      1-24  (304)
 45 PRK11443 hypothetical protein;  87.7    0.48 1.2E-05   24.6   2.7   26    4-29      2-27  (120)
 46 COG4764 Uncharacterized protei  86.9    0.47 1.2E-05   24.7   2.3   20    3-22      5-24  (197)
 47 PRK11138 outer membrane protei  86.8    0.94 2.4E-05   22.7   3.8   21    1-21      1-23  (394)
 48 PRK11627 hypothetical protein;  86.5    0.56 1.4E-05   24.1   2.6   19    5-23      4-23  (192)
 49 PRK10796 LPS-assembly lipoprot  86.3     1.3 3.2E-05   21.9   4.3   21    1-21      1-22  (196)
 50 PRK10802 peptidoglycan-associa  86.1     1.7 4.4E-05   21.0   4.9   21    4-24      7-28  (173)
 51 COG1566 EmrA Multidrug resista  85.6     2.2 5.5E-05   20.3  14.1   60  164-223   111-171 (352)
 52 PRK09967 putative outer membra  85.6    0.59 1.5E-05   24.0   2.3   22    1-22      2-23  (160)
 53 pfam06572 DUF1131 Protein of u  85.5    0.91 2.3E-05   22.8   3.2   71    1-77      1-72  (192)
 54 TIGR03352 VI_chp_3 type VI sec  85.1    0.52 1.3E-05   24.4   1.8   24    5-28      3-26  (146)
 55 PRK10718 hypothetical protein;  84.7    0.73 1.9E-05   23.4   2.4   71    1-77      1-72  (191)
 56 COG3317 NlpB Uncharacterized l  84.4    0.89 2.3E-05   22.9   2.7   30    1-30      1-32  (342)
 57 PRK10781 rcsF outer membrane l  83.7     1.6 4.1E-05   21.2   3.8   17    5-21      3-19  (133)
 58 pfam03304 Mlp Mlp lipoprotein   83.5    0.63 1.6E-05   23.8   1.7   20    1-20      1-20  (150)
 59 TIGR00752 slp outer membrane l  82.0     1.5 3.7E-05   21.4   3.1   36    2-37      1-38  (190)
 60 TIGR02747 TraV type IV conjuga  81.1    0.98 2.5E-05   22.6   1.9   20    1-20      1-22  (174)
 61 PRK10783 mltD membrane-bound l  80.9     3.3 8.4E-05   19.1  11.1   26    1-28      1-26  (449)
 62 PRK11372 lysozyme inhibitor; P  80.8     1.6   4E-05   21.2   2.9   21    1-21      1-21  (109)
 63 PRK13613 lipoprotein LpqB; Pro  80.5     2.3 5.8E-05   20.2   3.6   24    6-29      5-28  (603)
 64 TIGR03017 EpsF chain length de  80.2     3.5 8.9E-05   19.0  24.0   63  170-234   176-239 (444)
 65 COG4259 Uncharacterized protei  80.1     1.6 4.2E-05   21.1   2.8   23    1-23      1-27  (121)
 66 TIGR02971 heterocyst_DevB ABC   79.8     3.6 9.1E-05   18.9  10.8   83  155-237    97-183 (363)
 67 PRK10397 hypothetical protein;  79.2     1.9 4.8E-05   20.7   2.9   40    5-44      3-46  (137)
 68 TIGR02722 lp_ uncharacterized   78.9     2.5 6.3E-05   20.0   3.4   24    7-30      7-32  (215)
 69 pfam05590 DUF769 Xylella fasti  78.6     1.7 4.4E-05   21.0   2.5   24    1-24      1-27  (279)
 70 COG3056 Uncharacterized lipopr  78.6     1.9 4.8E-05   20.7   2.7   20    4-23     16-36  (204)
 71 PRK11548 hypothetical protein;  77.8     1.6   4E-05   21.3   2.1   21    1-21      1-23  (113)
 72 COG3017 LolB Outer membrane li  76.1     2.7   7E-05   19.7   3.0   20    1-20      4-24  (206)
 73 pfam07273 DUF1439 Protein of u  75.5     2.1 5.5E-05   20.4   2.3   19    1-19      1-19  (177)
 74 TIGR02448 TIGR02448 conserverd  74.0     2.5 6.4E-05   19.9   2.3   27   59-85     76-103 (107)
 75 pfam06085 Rz1 Lipoprotein Rz1   74.0     4.3 0.00011   18.4   3.5   24    1-24      1-26  (59)
 76 PRK02944 OxaA-like protein pre  73.2     4.4 0.00011   18.3   3.4   19    1-19      1-22  (255)
 77 PRK10449 heat-inducible protei  73.0     3.4 8.6E-05   19.1   2.8   21    1-22      1-21  (140)
 78 PRK10477 outer membrane lipopr  72.9     4.5 0.00012   18.2   3.4   20    1-20      1-21  (177)
 79 TIGR00999 8a0102 Membrane Fusi  72.4     5.6 0.00014   17.6   5.0   73  162-234    24-96  (284)
 80 PRK13883 conjugal transfer pro  72.3     2.9 7.3E-05   19.5   2.3   18    5-22      3-22  (156)
 81 PRK11189 lipoprotein NlpI; Pro  72.1     4.5 0.00011   18.3   3.2   20    1-20      2-22  (297)
 82 TIGR02521 type_IV_pilW type IV  71.3     3.5 8.9E-05   19.0   2.5   26   63-88     58-83  (247)
 83 TIGR03302 OM_YfiO outer membra  71.1     4.9 0.00013   18.0   3.3   19    4-22      2-21  (235)
 84 COG5633 Predicted periplasmic   70.7     2.9 7.5E-05   19.5   2.0   22    1-23      1-22  (123)
 85 PRK11917 bifunctional adhesin/  70.2     3.5   9E-05   18.9   2.4   26    1-26      1-26  (259)
 86 PRK01622 OxaA-like protein pre  70.0     5.5 0.00014   17.7   3.3   20    1-20      2-25  (266)
 87 pfam11153 DUF2931 Protein of u  69.8     4.3 0.00011   18.4   2.7   17    4-20      2-18  (202)
 88 PRK10461 thiamine biosynthesis  69.3     5.8 0.00015   17.5   3.3   25    2-26      4-28  (351)
 89 COG3521 Predicted component of  69.2     5.2 0.00013   17.8   3.1   28    1-28      1-30  (159)
 90 PRK11679 lipoprotein; Provisio  69.2     4.4 0.00011   18.4   2.7   22    5-26     12-33  (345)
 91 TIGR02887 spore_ger_x_C germin  67.7     3.2 8.1E-05   19.2   1.7   17    3-19      2-19  (400)
 92 PRK10838 spr putative outer me  67.6     4.6 0.00012   18.2   2.5   22    3-24     10-32  (188)
 93 PRK10510 putative outer membra  66.6     6.2 0.00016   17.3   3.0   22    1-22      1-25  (219)
 94 pfam05643 DUF799 Putative bact  65.9     5.6 0.00014   17.6   2.7   20    1-22      1-21  (215)
 95 PRK11669 pbpG D-alanyl-D-alani  65.8     6.6 0.00017   17.2   3.0   27    1-28      1-27  (308)
 96 PRK10672 rare lipoprotein A; P  65.7     7.7  0.0002   16.7   3.5   22    1-22      1-22  (369)
 97 PRK10871 nlpD lipoprotein NlpD  65.4     4.9 0.00012   18.0   2.3   26    3-28     10-36  (374)
 98 pfam06291 Lambda_Bor Bor prote  64.6       5 0.00013   18.0   2.2   19    1-20      1-19  (97)
 99 PRK12450 foldase protein PrsA;  64.2     6.7 0.00017   17.1   2.8   21    1-21      1-26  (309)
100 pfam10368 YkyA Putative cell-w  63.1     3.4 8.6E-05   19.1   1.1   13    9-21      2-14  (205)
101 PRK13614 lipoprotein LpqB; Pro  62.8     8.7 0.00022   16.4   5.6   19    7-25     13-31  (573)
102 PRK10598 hypothetical protein;  61.4     6.5 0.00017   17.2   2.3   20    1-20      1-21  (186)
103 PRK13731 conjugal transfer sur  60.4     5.4 0.00014   17.8   1.8   21    1-21      1-24  (243)
104 COG2980 RlpB Rare lipoprotein   59.8     9.8 0.00025   16.0   4.7   20    1-20      1-21  (178)
105 TIGR03516 ppisom_GldI peptidyl  59.3     8.6 0.00022   16.4   2.6   18    1-19      1-18  (177)
106 PRK10957 iron-enterobactin tra  59.2       8  0.0002   16.6   2.5   23    5-27      8-30  (319)
107 PRK10722 hypothetical protein;  59.0      10 0.00026   15.9   9.7   16    7-22     20-35  (248)
108 PRK10531 putative pectinestera  58.9     6.4 0.00016   17.2   1.9   34    1-34      1-38  (427)
109 PRK10759 hypothetical protein;  58.8     4.6 0.00012   18.2   1.2   16    4-19      1-16  (106)
110 pfam08139 LPAM_1 Prokaryotic m  58.3     8.1 0.00021   16.6   2.4   18    5-22      3-21  (26)
111 pfam12262 Lipase_bact_N Bacter  57.7     6.5 0.00017   17.2   1.8   20    1-20      1-21  (269)
112 PRK10533 putative lipoprotein;  57.6     7.4 0.00019   16.8   2.1   24    1-24      1-26  (171)
113 PRK09973 putative outer membra  57.4     6.6 0.00017   17.2   1.8   20    1-20      1-22  (85)
114 COG4669 EscJ Type III secretor  56.2     8.2 0.00021   16.6   2.1   19    1-19      1-21  (246)
115 pfam04741 InvH InvH outer memb  54.3     9.9 0.00025   16.0   2.3   21    1-23      1-21  (147)
116 PRK02463 OxaA-like protein pre  53.9      12 0.00031   15.4   3.3   11   10-20     16-26  (307)
117 PRK10559 p-hydroxybenzoic acid  52.3      13 0.00033   15.2   8.8   39  198-236   117-155 (310)
118 TIGR02544 III_secr_YscJ type I  52.2     9.2 0.00023   16.2   1.8   16    5-20      4-19  (203)
119 COG4851 CamS Protein involved   52.0      11 0.00028   15.7   2.2   21    1-21      1-22  (382)
120 COG5461 Type IV pili component  51.0      14 0.00035   15.1   3.1   21    5-25     10-30  (224)
121 pfam07269 consensus             50.9      13 0.00032   15.3   2.4   17    6-22      3-19  (55)
122 pfam02999 Borrelia_orfD Borrel  50.6      14 0.00035   15.1   3.3   21    3-23      1-21  (117)
123 COG3009 Uncharacterized protei  49.2      14 0.00036   15.0   2.4   19    5-23      3-22  (190)
124 TIGR03300 assembly_YfgL outer   48.9      15 0.00037   14.9   3.2   15    6-20      4-18  (377)
125 COG5510 Predicted small secret  48.3      13 0.00034   15.2   2.2   14    6-19     10-23  (44)
126 PRK06481 fumarate reductase fl  48.2      15 0.00038   14.8   4.3   15    9-23     12-26  (506)
127 PRK11616 hypothetical protein;  47.9      15 0.00039   14.8   2.4   30    5-34      7-36  (109)
128 COG4785 NlpI Lipoprotein NlpI,  47.7      15 0.00039   14.8   3.0   21    1-21      1-22  (297)
129 PRK09810 entericidin A; Provis  47.1      12  0.0003   15.5   1.7   21    1-21      2-22  (41)
130 PRK13733 conjugal transfer pro  46.6       2 5.1E-05   20.6  -2.3   19    1-19      1-20  (171)
131 TIGR02898 spore_YhcN_YlaJ spor  46.3      13 0.00032   15.4   1.8   18    6-23      3-22  (185)
132 cd07618 BAR_Rich1 The Bin/Amph  46.2      16 0.00041   14.6   9.8   54  388-444   167-220 (246)
133 PRK10568 periplasmic protein;   46.0     5.7 0.00015   17.6  -0.0   29   54-82     54-82  (203)
134 TIGR01010 BexC_CtrB_KpsE polys  45.9      16 0.00041   14.6  14.5  140  170-368   169-313 (364)
135 PRK11162 mltA murein transglyc  45.8      16 0.00042   14.6   9.2   80    3-90      3-85  (362)
136 pfam11873 DUF3393 Domain of un  45.6      16  0.0004   14.7   2.2   16    7-22      5-20  (200)
137 COG5645 Predicted periplasmic   45.3      13 0.00033   15.3   1.7   20    1-21      1-20  (80)
138 COG5468 Predicted secreted (pe  44.9      17 0.00043   14.5   2.2   25    5-29      7-31  (172)
139 PRK11530 hypothetical protein;  44.3      11 0.00029   15.6   1.3   16    4-19      3-18  (176)
140 PRK00178 tolB translocation pr  44.2      17 0.00044   14.4   4.2   19    1-19      1-20  (433)
141 PRK04517 hypothetical protein;  43.9      16  0.0004   14.7   2.0   21    1-21      1-21  (216)
142 TIGR03502 lipase_Pla1_cef extr  43.4      16  0.0004   14.7   1.9   19    1-19      1-20  (792)
143 PRK01904 hypothetical protein;  43.4      16 0.00042   14.6   2.0   27    1-27      1-27  (217)
144 COG3218 ABC-type uncharacteriz  42.9      18 0.00046   14.3   2.5   11    9-19     17-27  (205)
145 TIGR01004 PulS_OutS lipoprotei  42.8      18 0.00046   14.3   4.7   15    6-20     12-26  (136)
146 TIGR00998 8a0101 efflux pump m  42.3      18 0.00047   14.2  11.7   68  159-226   121-191 (379)
147 TIGR03042 PS_II_psbQ_bact phot  41.9      19 0.00048   14.2   3.2   12    8-19      9-20  (142)
148 pfam10671 TcpQ Toxin co-regula  41.0      14 0.00035   15.1   1.3   21    1-21      1-21  (178)
149 pfam08085 Entericidin Enterici  40.9      19 0.00049   14.1   2.1   20    1-20      1-23  (42)
150 pfam11353 DUF3153 Protein of u  40.0      18 0.00045   14.4   1.7   13    7-19      3-15  (210)
151 TIGR02269 TIGR02269 Myxococcus  40.0      20 0.00051   14.0   2.6   19    7-25      3-21  (228)
152 PRK03002 prsA peptidylprolyl i  39.9      20 0.00051   14.0   2.4   20    1-20      1-23  (285)
153 PRK03095 prsA peptidylprolyl i  38.8      21 0.00053   13.9   2.3   20    1-20      1-21  (287)
154 TIGR01781 Trep_dent_lipo Trepo  38.8      20 0.00051   14.0   1.8   18    3-20      5-23  (463)
155 PRK09558 ushA bifunctional UDP  37.9      22 0.00055   13.8   3.0   22    1-22      2-24  (551)
156 COG2143 Thioredoxin-related pr  37.7      22 0.00055   13.8   2.5   21    1-21      2-22  (182)
157 COG4380 Uncharacterized protei  37.0      22 0.00057   13.7   1.9   13    9-21      8-20  (216)
158 PRK10564 maltose regulon perip  36.2      23 0.00058   13.6   2.1   27  352-378   254-282 (303)
159 TIGR02522 pilus_cpaD pilus (Ca  35.8      23 0.00059   13.6   2.7   16    7-22      3-18  (211)
160 pfam09619 YscW Type III secret  35.8      17 0.00043   14.5   1.1   17   10-26      3-19  (124)
161 PRK04405 prsA peptidylprolyl i  35.6      23  0.0006   13.6   2.2   10   11-20     17-26  (298)
162 PRK12473 hypothetical protein;  34.5      24 0.00062   13.5   2.2   22    8-29     10-31  (193)
163 PRK11087 hypothetical protein;  34.0      15 0.00038   14.8   0.6   33    1-34      1-33  (238)
164 cd07595 BAR_RhoGAP_Rich-like T  33.8      25 0.00064   13.4  12.8   53  390-445   167-219 (244)
165 PRK02998 prsA peptidylprolyl i  33.8      25 0.00064   13.4   2.4   19    1-19      1-23  (283)
166 COG4238 Murein lipoprotein [Ce  33.6      25 0.00064   13.4   1.9   12    9-20     12-23  (78)
167 TIGR02917 PEP_TPR_lipo putativ  33.6      25 0.00064   13.4   9.1   16   68-83     55-70  (924)
168 PRK10175 hypothetical protein;  32.9      23 0.00059   13.6   1.4   21    7-27      5-25  (75)
169 pfam01298 Lipoprotein_5 Transf  32.8      26 0.00066   13.3   4.7   20    1-20      1-22  (589)
170 pfam02402 Lysis_col Lysis prot  31.9      23 0.00059   13.6   1.2   20    1-20      1-21  (46)
171 PRK04168 hypothetical protein;  31.7      13 0.00033   15.3  -0.1   52   60-111    46-97  (336)
172 PRK11397 dacD D-alanyl-D-alani  31.5      27 0.00069   13.2   3.7   34    1-34      1-38  (390)
173 pfam06316 Ail_Lom Enterobacter  31.0      28 0.00071   13.1   2.5   20    1-20      1-20  (199)
174 PRK10653 D-ribose transporter   29.6      29 0.00074   12.9   1.8   21    1-21      1-21  (295)
175 pfam12563 Hemolysin_N Hemolyti  29.6      29 0.00075   12.9   2.6   16  227-242    93-108 (187)
176 PRK13835 conjugal transfer pro  29.4      29 0.00075   12.9   2.3   16    8-23      7-22  (144)
177 PRK01326 prsA foldase protein   29.4      29 0.00075   12.9   2.3   21    1-21      1-24  (310)
178 TIGR03530 GldJ_short gliding m  28.6      30 0.00077   12.8   2.6   26    4-29      2-28  (402)
179 COG4314 NosL Predicted lipopro  28.4      31 0.00078   12.8   2.8   21    1-21      1-21  (176)
180 PRK13528 outer membrane recept  28.2      31 0.00079   12.8   2.3   16    1-16      3-18  (727)
181 TIGR01433 CyoA ubiquinol oxida  27.7      31 0.00078   12.8   1.3   10   10-19      5-14  (228)
182 PHA00407 phage lambda Rz1-like  27.4      32 0.00081   12.7   3.0   14    7-20     38-51  (84)
183 PRK10803 hypothetical protein;  27.1      32 0.00082   12.7   7.2   34  203-236    68-101 (262)
184 cd07593 BAR_MUG137_fungi The B  26.7      33 0.00084   12.6   8.7   54  393-446   147-204 (215)
185 TIGR02567 YscW type III secret  26.4      32 0.00083   12.7   1.2   12    9-20      2-13  (131)
186 PRK11281 potassium efflux prot  25.6      34 0.00088   12.5  26.3   27   63-89     61-87  (1107)
187 pfam09676 TraV Type IV conjuga  25.4      26 0.00067   13.3   0.6   11   10-20      2-12  (134)
188 PRK09534 btuF corrinoid ABC tr  25.2      35 0.00089   12.4   4.1   10    1-10      1-10  (364)
189 COG1464 NlpA ABC-type metal io  25.2      35 0.00089   12.4   3.4   20    1-20      1-22  (268)
190 TIGR02117 chp_urease_rgn conse  24.9      35  0.0009   12.4   2.7   20    8-27      2-21  (212)
191 COG4808 Uncharacterized protei  24.6      36 0.00091   12.4   2.0   19    1-19      1-24  (152)
192 PRK11251 DNA-binding transcrip  24.6      36 0.00091   12.4   2.2   17    5-21      4-21  (109)
193 COG5567 Predicted small peripl  23.1      38 0.00098   12.2   3.7   33    1-33      1-36  (58)
194 pfam07365 Toxin_8 Alpha conoto  23.0      38 0.00098   12.2   1.7   14    1-14      3-16  (66)
195 KOG1026 consensus               22.5      19 0.00049   14.1  -0.5   25  315-340   680-704 (774)
196 COG3126 Uncharacterized protei  21.8      41   0.001   12.0   2.7   20    1-20      1-21  (158)
197 pfam09580 Spore_YhcN_YlaJ Spor  21.6      36 0.00093   12.3   0.7   12   11-22      2-13  (169)
198 COG1732 OpuBC Periplasmic glyc  21.1      42  0.0011   11.9   3.7   17   60-77     47-63  (300)
199 PRK06760 hypothetical protein;  20.6      43  0.0011   11.9   2.6   21    1-21      1-24  (223)
200 PRK03642 hypothetical protein;  20.5      43  0.0011   11.8   2.4   14    6-19      3-16  (432)
201 PRK11186 carboxy-terminal prot  20.1      44  0.0011   11.8   2.7   32    1-32      1-35  (673)

No 1  
>PRK09837 copper/silver efflux system outer membrane protein CusC; Provisional
Probab=100.00  E-value=0  Score=593.48  Aligned_cols=446  Identities=24%  Similarity=0.383  Sum_probs=400.3

Q ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCHHHHHHHCCHHHHHHHHHHHHHCHHHHH
Q ss_conf             93069999999999975026899999995647501024677---666676862343660998799999999970899899
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNS---KNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQ   77 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~~p~~~~p~~~~~~~~~~~~~~---~~~~~~~~~~ww~~~~d~~L~~~i~~Al~~np~l~~   77 (452)
                      |+..|++.++++++|+||+++|+|.+|+.+ +|..|.....   ..........||+.|+||+|+++|+.|+.|||||++
T Consensus         1 ~~~~rll~l~~~l~L~gC~~~P~y~~P~~~-~p~~~~~~~~~~~~~~~~~~~~~Ww~~f~Dp~L~~LI~~Al~~N~dl~~   79 (460)
T PRK09837          1 MSPCKLLPFCVALALTGCSLAPDYQRPAMP-VPQQFSLSQNGLVNAADNYQNAGWRTFFVDNQVKTLISEALVNNRDLRM   79 (460)
T ss_pred             CCHHHHHHHHHHHHHCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCHHHHCCCHHHHHHHHHHHHCCHHHHH
T ss_conf             975789999999998247789999996999-8642355666667888764440199867998799999999965987999


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCC------CCCCCCCCCCCCCCCCHHHHHHH-HHHHHHHHHHHHHHHH
Q ss_conf             9999999999999875420530111011245665------55444443211101100123457-7888877765556799
Q gi|254780930|r   78 ATERINAAKENILSVRADLFPSSYASISHRFIPN------LKTNSTGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVD  150 (452)
Q Consensus        78 a~~~i~~a~~~~~~a~a~~~P~~~~~~~~~~~~~------~~~~~~~~~~~s~~ldl~G~~~~-~~~a~~~~~~~~~~~~  150 (452)
                      +..++++|++.+..+++.++|++++++++++..+      ....++.++++||++|+|||.++ ++++.+.+.+++++++
T Consensus        80 A~~rv~~A~a~~~~a~a~~~P~~~~~~~~~~~~~~~~~~~~~~~~~~gl~~swelDl~Gr~r~~~~aa~~~~~a~~~~~~  159 (460)
T PRK09837         80 ATLKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGDSATTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQR  159 (460)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCEEECEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999876008831220000005778899886531000204788740322048999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999876666777889999999999999999878765543234567776532223557989999998568888
Q gi|254780930|r  151 IAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV  230 (452)
Q Consensus       151 ~~~~~l~~~v~~aY~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~~~~~~~l~~~~~~~~~a~  230 (452)
                      .+++.++.+|+++||++...++++.+.+++++..++.+++++.||+.|.++..|+.+++.++...+.++...+.++..++
T Consensus       160 ~~~l~l~a~Va~~Y~~l~~~~~~l~~~~~~l~~~~~~l~l~~~r~~~G~~s~ldv~qa~~~l~~~~a~l~~~~~~~~~~~  239 (460)
T PRK09837        160 AVHILLVSNVAQSYFNQQLAYAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN  239 (460)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999999999999999985898677899999999999987999999999999


Q ss_pred             HHHHHHCCCCHHHHCCCCCCCCCCCCCCHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCCC
Q ss_conf             76877639992130001234554433100122104887899730234556555899996430101122221001122221
Q gi|254780930|r  231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIA  310 (452)
Q Consensus       231 ~~L~~l~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~RPdi~~a~~~~~~a~~~i~~a~a~~~P~i~l~~~~~  310 (452)
                      +.|..|+|.++..+...    .....+..+.+++.++|+++|.+||||++++.+++++.+++++++++|||+|+|+|++|
T Consensus       240 ~~La~LlG~~~~~~~~~----~~~~~~~~~~~~p~~lpa~lL~~RPDI~aAe~~l~aa~a~i~vA~A~~~P~isL~~~~g  315 (460)
T PRK09837        240 NALQLLLGSYGKLPQAQ----TVNSDSLQSVKLPAGLSSQILLQRPDIMEAEHALMAANANIGAARAAFFPSISLTSGIS  315 (460)
T ss_pred             HHHHHHHCCCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCC
T ss_conf             99999819998897423----45755567777899981999884900999999999998658899984089069851555


Q ss_pred             CCCC---CCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             1223---4454454104431122345101245665677999999999999999999999999999999999999999999
Q gi|254780930|r  311 LTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQ  387 (452)
Q Consensus       311 ~~~~---~~~~~~~~~~~~g~~l~~Pif~gg~~~a~i~~a~~~~~~a~~~~~~~~~~a~~ev~~a~~~~~~~~~~~~~~~  387 (452)
                      +...   +.|+.....|++|++++|||||||+++++++.++++++++..+|+++++++++||++++..++...+++...+
T Consensus       316 ~~~~~~~~l~~~~~~~~~~~~~l~~PiFdgG~~~a~~~~a~a~~~~a~~~Y~~tvl~A~~EVe~al~~~~~~~~~~~~~~  395 (460)
T PRK09837        316 TASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIAEIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQ  395 (460)
T ss_pred             CCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             34343665157762023120343134310304699999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             9999999999999999871883289999999999999999999999999999999998499999
Q gi|254780930|r  388 HAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN  451 (452)
Q Consensus       388 ~~~~~a~~~~~~~~~~y~~G~~~~~dll~a~~~~~~a~~~~~~a~~~~~~a~~~L~~AlGGg~~  451 (452)
                      +.++.+++.++.++.+|+.|..+++|||++|+++++++.++++++++.+.+.++||+||||||+
T Consensus       396 ~~~~~a~~~~~~a~~rY~~G~~~~l~vL~Aq~~l~~a~~~l~~a~~~~~~~~v~Ly~ALGGGWq  459 (460)
T PRK09837        396 RYLASLQITLQRARALYQHGAVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGWQ  459 (460)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             9999999999999999977761599999999999999999999999999999999997088989


No 2  
>PRK09915 putative outer membrane efflux protein MdtP; Provisional
Probab=100.00  E-value=0  Score=591.15  Aligned_cols=448  Identities=19%  Similarity=0.299  Sum_probs=399.7

Q ss_pred             CCCHHHHHHH-HHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCHHHHHHHCCHHHHHHHHHHHHHCHHHHH
Q ss_conf             9306999999-999997502689999999564750102467766--6676862343660998799999999970899899
Q gi|254780930|r    1 MNILRAIFSL-FIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKN--LINIDTLKWWESFNDTSLNKLVKIALQQNLTILQ   77 (452)
Q Consensus         1 M~~~~~~~~l-~~~~l~gC~~~p~~~~p~~~~~~~~~~~~~~~~--~~~~~~~~ww~~~~d~~L~~~i~~Al~~np~l~~   77 (452)
                      ||.+..+.++ ++++|+||+++|++.+|..+..|..+.......  ....+..+||+.|+||+|+++|+.|+.|||||++
T Consensus         6 ~~r~~~~~~l~~~~lLagC~~~p~~~~p~~~~~p~~~~~~~~~~~~~~~~~~~~WW~~F~Dp~L~~LI~~AL~~N~dL~~   85 (488)
T PRK09915          6 LSRLLLCSILGSTTLISGCALVRKDSAPHQQLKPEQIKLADDIHLASSGWPQAQWWKQLNDPQLDALIQRTLSGSHTLAE   85 (488)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCHHHHHHHHHHHHCCHHHHH
T ss_conf             76999999999999975266899999999888964334466656677788726699867998799999999965986999


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCC---------------------CCCCCCCCCCCCCCCCHHHHHHH-H
Q ss_conf             9999999999999875420530111011245665---------------------55444443211101100123457-7
Q gi|254780930|r   78 ATERINAAKENILSVRADLFPSSYASISHRFIPN---------------------LKTNSTGQLDSDWKIDLFGQRRH-I  135 (452)
Q Consensus        78 a~~~i~~a~~~~~~a~a~~~P~~~~~~~~~~~~~---------------------~~~~~~~~~~~s~~ldl~G~~~~-~  135 (452)
                      +..++++|++.+..+++.++|+++++++.++...                     ..+..+.++++||++|+|||.++ +
T Consensus        86 A~arv~~A~a~~~~a~a~~~p~v~~~~~~~r~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~gl~aswelDlwGr~r~~~  165 (488)
T PRK09915         86 AKLREEKAQSQADLLDAGSQLQVAALGMLNRQRVSANGFLSPYAMDAPALGMDGPYYTEATVGLFAGLDLDLWGVHRSAV  165 (488)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHH
T ss_conf             99999999999998731127861544431002257767677766777776778764100111320255331311657999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             88887776555679999999999999876666777889999999999999999878765543234567776532223557
Q gi|254780930|r  136 ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSI  215 (452)
Q Consensus       136 ~~a~~~~~~~~~~~~~~~~~l~~~v~~aY~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~~~~  215 (452)
                      +++.+..++++++++.+++.++.+|+++||++...++++.+.++.++..++.+++++.||+.|.++..|+.+++.++..+
T Consensus       166 ~aA~a~~~A~~a~~~~~~l~l~a~vA~~Y~~l~~~~~~l~l~~~~~~~~~~~l~l~~~r~~~G~~s~~dv~~a~~~l~~~  245 (488)
T PRK09915        166 AAAIGAHNAALAETAAVELSLTTGVAQLYYSMQASYQMLDLLEQTRDVIDYAVKAHQSKVAHGLEAQVPFHGARAQILAV  245 (488)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999999999999999999999999999999982765578999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCHHHHCCCCCCCCCCCCCCHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCH
Q ss_conf             98999999856888876877639992130001234554433100122104887899730234556555899996430101
Q gi|254780930|r  216 ESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIA  295 (452)
Q Consensus       216 ~~~l~~~~~~~~~a~~~L~~l~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~RPdi~~a~~~~~~a~~~i~~a  295 (452)
                      +.++..++.++...++.|..|+|.+|.+....    .....|..+..++.++|+++|.+||||+++++.++++.++|+++
T Consensus       246 ~a~l~~l~~~~~~~~~aLa~L~G~~~~~~~~~----~~~~~p~~~~~~P~~lps~LL~rRPDI~aAe~~l~Aa~a~ig~A  321 (488)
T PRK09915        246 DKQIAAVKGQITETRESLRALIGAGASDMPEI----KPVALPRVQTGIPATLSYELLARRPDLQAMRWYVQASLDQVDSA  321 (488)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC----CCCCCCCCCCCCCCCCHHHHHHCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999989999829995322235----76544667877898873989862911999999999999748899


Q ss_pred             HHHHHHHCCCCCCCCCCC---CCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             122221001122221122---34454454104431122345101245665677999999999999999999999999999
Q gi|254780930|r  296 KSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENA  372 (452)
Q Consensus       296 ~a~~~P~i~l~~~~~~~~---~~~~~~~~~~~~~g~~l~~Pif~gg~~~a~i~~a~~~~~~a~~~~~~~~~~a~~ev~~a  372 (452)
                      +++|||+|+|+|++|+.+   +++|++.+..|++|++++|||||||+++++++.++++++++...|+++++++++||+++
T Consensus       322 ~A~~~P~lsLsg~~G~~s~~~~~lf~~~~~~~~~~~~l~~PiFdgG~l~a~~~~a~a~~~~a~~~Y~~tvl~A~~eV~~a  401 (488)
T PRK09915        322 RALFYPSFDIKAFFGLDAIHLDTLFKKTSRQFNFIPGLKLPLFDGGRLNANLEGTRAASNMMIERYNQSVLNAVRDVAVN  401 (488)
T ss_pred             HHHHCCCCCEECCCCCCCCCHHHHCCCCCHHEEHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98448775110002645456665346851100010122045685537999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             99999999999999999999999999999998718832899999999999999999999999999999999984999998
Q gi|254780930|r  373 LTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP  452 (452)
Q Consensus       373 ~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~y~~G~~~~~dll~a~~~~~~a~~~~~~a~~~~~~a~~~L~~AlGGg~~~  452 (452)
                      +..++...++.......++.+++.++.++.+|+.|.+++++||++++++++++.++++++.+.+.+.+.||+||||||+.
T Consensus       402 l~~~~~~~~~~~~~~~a~~~a~~~~~la~~~Y~~G~~~~l~vL~Aqr~~l~a~~~l~~~~~~~l~~~v~Ly~ALGGGW~~  481 (488)
T PRK09915        402 GTRLQTLNDEREMQAERVEATRFTQRAAEAAYQRGLTSRLQATEARLPVLAEEMSLLMLDSRRVIQSIQLMKSLGGGYQA  481 (488)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             99999999999999999999999999999999765447999999999999999999999999999999999971789889


No 3  
>TIGR01845 outer_NodT efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family; InterPro: IPR010131   Members of group are outer membrane lipoproteins from the NodT family of the RND (Resistance-Nodulation-cell Division) type efflux systems. These proteins work with an inner membrane ABC transporter ATPase and an adapter called a membrane fusion protein. Most members of this family are likely to export primarily small molecules rather than proteins, but are related to the type I protein secretion outer membrane proteins TolC and PrtF.; GO: 0005215 transporter activity, 0008289 lipid binding, 0006810 transport, 0016020 membrane.
Probab=100.00  E-value=0  Score=591.47  Aligned_cols=440  Identities=30%  Similarity=0.518  Sum_probs=399.2

Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCC-----------CC----CCCCCCCCCCHHHHHHHCCHHHHHHHHHHHHHCHH
Q ss_conf             9999997502689999999564750102-----------46----77666676862343660998799999999970899
Q gi|254780930|r   10 LFIVLLAGCTVGPEYTKPHMPLLPTQFS-----------IG----NSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT   74 (452)
Q Consensus        10 l~~~~l~gC~~~p~~~~p~~~~~~~~~~-----------~~----~~~~~~~~~~~~ww~~~~d~~L~~~i~~Al~~np~   74 (452)
                      +++++|+||+++|+|.+|+.+..+....           .+    ........+...||+.|+||+|+.+|+.|+.+||+
T Consensus         2 ~~a~~LsGCa~~p~y~~p~a~~~~~~~~tPPa~ta~~~~~G~~q~~~~~~g~~p~~~WW~~F~DpqL~~Lve~al~~np~   81 (477)
T TIGR01845         2 VAALALSGCAVGPDYQRPEAPVAAGYLETPPAQTASDRTFGGQQQARLSEGVWPAVDWWEAFGDPQLNALVEEALADNPD   81 (477)
T ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCHHHHHHHHHHHHHCCC
T ss_conf             78899985206787887644332366778789888888889744444332133168999873228899999999873956


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCCC-----------------CCCCCCCCCCCCCCCHHHHHH-HHH
Q ss_conf             89999999999999998754205301110112456655-----------------544444321110110012345-778
Q gi|254780930|r   75 ILQATERINAAKENILSVRADLFPSSYASISHRFIPNL-----------------KTNSTGQLDSDWKIDLFGQRR-HIE  136 (452)
Q Consensus        75 l~~a~~~i~~a~~~~~~a~a~~~P~~~~~~~~~~~~~~-----------------~~~~~~~~~~s~~ldl~G~~~-~~~  136 (452)
                      |+.|.++++.|++.+..+++.+||++++++++++....                 .+..+..+++||+||||||.| .++
T Consensus        82 L~~A~A~~~~A~a~~~~a~A~~~P~~~~~~s~Tr~~~~~ttt~~~~~~~~~~~~~~~~~~~~L~~sy~lDlfG~~R~~~e  161 (477)
T TIGR01845        82 LQVAEARLRAARANLRAARADFFPSLSLSASATRSKLSRTTTAEDASGTTSGGSLSNTSTLTLDVSYELDLFGKVRAAVE  161 (477)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHCCHHCCCCHHHHHHCCCCCCCCCEEEEEEEEEEEEEEHHHHCHHHHHHH
T ss_conf             88999999999999987320236301210100000265202122213456776223325676665540001230588999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             88877765556799999999999998766667778899999999999999998787655432345677765322235579
Q gi|254780930|r  137 SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE  216 (452)
Q Consensus       137 ~a~~~~~~~~~~~~~~~~~l~~~v~~aY~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~~~~~  216 (452)
                      ++.++.++++.+.+.+++.+..+|++.|+++...+.+.++.++.+...++.+++++++|..|..+..|+.+++..+..++
T Consensus       162 sa~aq~~A~~~~~~~A~l~l~a~va~~Y~~la~~~~~~~~~~~~~a~~~~~~~lt~~~~~aG~~~~~dv~~A~~~~~~~~  241 (477)
T TIGR01845       162 SALAQLEAAEADSQAARLTLSASVANAYVQLAALRAQLDVAEAALASRQKTLELTQKRYAAGVAAASDVLQAEAAVASAE  241 (477)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
T ss_conf             88999999999999999999999999999999999999999999999999999999999813256888999999999998


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCHHHHCCCCCCCCCCCCCCHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCHH
Q ss_conf             89999998568888768776399921300012345544331001221048878997302345565558999964301011
Q gi|254780930|r  217 SDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK  296 (452)
Q Consensus       217 ~~l~~~~~~~~~a~~~L~~l~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~RPdi~~a~~~~~~a~~~i~~a~  296 (452)
                      .++..++..+...++.|..|+|.+|.+....+........+.....+|.++|+++|+|||||.+||++++++.++|++|+
T Consensus       242 A~l~~~~~~~~~~~~~La~L~G~~p~~~~~~i~~~~~~~~~~p~~~~P~~lP~dL~~~RPDi~aAE~~l~Aa~a~IgvA~  321 (477)
T TIGR01845       242 AELPSLEEQIALARNALAALLGKGPSDRGLAIARPLLSDQLPPLPDLPLSLPSDLLRRRPDILAAERRLAAANASIGVAK  321 (477)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             77799999999987347533278888766464223334457774225540132666228038999999987443099999


Q ss_pred             HHHHHHCCCCCCCCCCC---CCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             22221001122221122---344544541044311223451012456656779999999999999999999999999999
Q gi|254780930|r  297 SDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENAL  373 (452)
Q Consensus       297 a~~~P~i~l~~~~~~~~---~~~~~~~~~~~~~g~~l~~Pif~gg~~~a~i~~a~~~~~~a~~~~~~~~~~a~~ev~~a~  373 (452)
                      +.|||+|+|+|++|...   +.++.+.+..|+||+.|.+|||+||++++++..|++.++.+.++|++++++++.||++.+
T Consensus       322 A~~fPs~tLsA~~G~~a~~~~~L~~~g~~~W~~gP~l~lPiF~GG~L~A~~~~A~A~yd~avA~Y~~~vl~A~~~VaD~l  401 (477)
T TIGR01845       322 AAFFPSITLSASIGLSASTLSKLFDSGSRFWSIGPALALPIFDGGSLRAALDSAKAAYDAAVAQYRQTVLTAFQEVADAL  401 (477)
T ss_pred             HHHCCCEEHHHHHHHHHHHHCCCCCCCCCCCEECCCCCCCCHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             87468700457888652000024566642211021000430020100553217899999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             9999999999999999999999999999998718832899999999999999999999999999999999984999
Q gi|254780930|r  374 TSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG  449 (452)
Q Consensus       374 ~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~y~~G~~~~~dll~a~~~~~~a~~~~~~a~~~~~~a~~~L~~AlGGg  449 (452)
                      ..++...++++..+..++.+++.+.+++.+|+.|..++++||+||+++++++..+++++.+.+.+.+.||+|||||
T Consensus       402 ~A~~~~~~~~~~~~~Av~~A~~~~~la~~rY~aG~~~yL~vl~A~~~~~~a~~~l~~l~~~~l~~~~~L~~ALGGG  477 (477)
T TIGR01845       402 AALQALARRLDAQRDAVEAAEEALQLAQNRYRAGLISYLTVLEAQRSLLTAQRSLATLQAQRLSASVALYKALGGG  477 (477)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             9979999999999999999999999998652543644898999999999999999999999999999999842799


No 4  
>PRK11459 multidrug resistance outer membrane protein MdtQ; Provisional
Probab=100.00  E-value=0  Score=565.89  Aligned_cols=446  Identities=18%  Similarity=0.254  Sum_probs=395.4

Q ss_pred             CCCHHH---HHHH-HHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCHHHHHHHCCHHHHHHHHHHHHHCHH
Q ss_conf             930699---9999-99999750268999999956475010246776--66676862343660998799999999970899
Q gi|254780930|r    1 MNILRA---IFSL-FIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK--NLINIDTLKWWESFNDTSLNKLVKIALQQNLT   74 (452)
Q Consensus         1 M~~~~~---~~~l-~~~~l~gC~~~p~~~~p~~~~~~~~~~~~~~~--~~~~~~~~~ww~~~~d~~L~~~i~~Al~~np~   74 (452)
                      ||..++   ...+ ++++|+||+++|++.+|..+..|..+......  .....+..+||+.|+||+|+++|+.|+.||||
T Consensus         1 ~~~~~f~~~~a~l~~~llLaGCa~~~~~~~p~~~~~pa~~~~~~~~~~~~~~~p~~~WW~~F~Dp~L~~Li~~Al~~N~d   80 (478)
T PRK11459          1 MNRDSFYAATASLPLFILLAGCAPMHETRQSLTQQTPASHVDTSLPAALKNGWPDSQWWKAYHDAQLDSLIDNALQHAPD   80 (478)
T ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCHHHHHHHHHHHHCCHH
T ss_conf             99740588899999999983788999999999888985422257876555688706699865998799999999864960


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCC---------------C------CCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             899999999999999987542053011101124566---------------5------5544444321110110012345
Q gi|254780930|r   75 ILQATERINAAKENILSVRADLFPSSYASISHRFIP---------------N------LKTNSTGQLDSDWKIDLFGQRR  133 (452)
Q Consensus        75 l~~a~~~i~~a~~~~~~a~a~~~P~~~~~~~~~~~~---------------~------~~~~~~~~~~~s~~ldl~G~~~  133 (452)
                      |+++..++++|++.+..+++.++|+++++++.++..               .      ..++.+.++++||++|+|||.+
T Consensus        81 L~~A~arv~~A~a~~~~a~a~~~P~v~~~~~~~r~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~gl~aswElDlwGr~r  160 (478)
T PRK11459         81 MQVAEQRIQLAEAQAKAVAAQDGPQLDFSADIERQKMSAEGLMGPFALNDPAAGTTGPWYTNGTFGLTAGWDLDLWGKNR  160 (478)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEHHHHHH
T ss_conf             99999999999999999865308823256324420037655567644578666777765323321413477521401467


Q ss_pred             H-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             7-788887776555679999999999999876666777889999999999999999878765543234567776532223
Q gi|254780930|r  134 H-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEI  212 (452)
Q Consensus       134 ~-~~~a~~~~~~~~~~~~~~~~~l~~~v~~aY~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~  212 (452)
                      + ++++.+..++++++++.+++.++.+|+++||++....++..+.++..+..++.+.+.+.+++.|..+..|+.+++..+
T Consensus       161 ~~~~Aa~a~~~A~~a~~~~~~l~l~a~VA~~Y~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~~~~~~~~a~~~~  240 (478)
T PRK11459        161 AEVTARIGTVKARAAEREQTRQLLAGSVARLYWEWQTQAALNTVLQQIEKEQNNIIATDRQLYQNGITSSVEGVETDINA  240 (478)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHH
T ss_conf             89999999999999999999999999999999999999999999999999999999999999981530055899999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHCCCCCCCCCCCCCCHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             55798999999856888876877639992130001234554433100122104887899730234556555899996430
Q gi|254780930|r  213 KSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI  292 (452)
Q Consensus       213 ~~~~~~l~~~~~~~~~a~~~L~~l~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~RPdi~~a~~~~~~a~~~i  292 (452)
                      .+++.++...+..+...++.|..|+|.++.....     .+...|..+..++.++|+++|.+||||+++++++.++.++|
T Consensus       241 ~~~~a~l~~~~~~~~~~~~~l~~L~g~~~~~~~~-----~~~~lp~~~~~lP~~lP~~LL~rRPDI~aAe~~l~aA~a~i  315 (478)
T PRK11459        241 SKTRQQLNDVAGKMKIIEARLSALTNTQTKSLKL-----KPVALPKVASQLPDELGYSLLARRADLQAAHWYIESSLSTI  315 (478)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC-----CCCCCCCCCCCCCCCCHHHHHCCCCHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999999999870899633468-----97656666767898763888705822999999999998878


Q ss_pred             CCHHHHHHHHCCCCCCCCCCC---CCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             101122221001122221122---34454454104431122345101245665677999999999999999999999999
Q gi|254780930|r  293 GIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEV  369 (452)
Q Consensus       293 ~~a~a~~~P~i~l~~~~~~~~---~~~~~~~~~~~~~g~~l~~Pif~gg~~~a~i~~a~~~~~~a~~~~~~~~~~a~~ev  369 (452)
                      ++|+++|||+|+|+|++|+.+   +++|++....|++|+++++||||||+++++++.++++.+++..+|+++++++++||
T Consensus       316 g~A~A~~yP~isLsa~~G~~s~~~~~lf~~~~~~~~~~~~l~~PiFd~G~l~a~~~~a~A~~~~A~~~Y~~tvl~A~~eV  395 (478)
T PRK11459        316 DAAKAAFYPDINLMAFLQQDALHLSDLFRHSAQQMGVTAGLTLPIFDSGRLNANLDIAKAQSNLSIASYNKAVVDAVNDV  395 (478)
T ss_pred             HHHHHHHCCCEEEECCCCCCCCCHHHHCCCCHHHHHHCHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             89999509935883136755444676436750333002111246576568999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             99999999999999999999999999999999998718832899999999999999999999999999999999984999
Q gi|254780930|r  370 ENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG  449 (452)
Q Consensus       370 ~~a~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~y~~G~~~~~dll~a~~~~~~a~~~~~~a~~~~~~a~~~L~~AlGGg  449 (452)
                      ++++..+....++.....+.+..+++.+++++.+|+.|.+++++||++++++++++.++++++.+.+.+.++||+|||||
T Consensus       396 e~Al~~~~~~~~~~~~~~~~~~~a~~a~~la~~ry~~G~~~~l~vL~Aq~~~~~a~~~l~~~~~~~l~~~v~Ly~ALGGG  475 (478)
T PRK11459        396 ARAASQVETLAEKNQHQQQIERDALRVVGLAQARFNAGIIAGSRVSEAKIPALRERANGLLLQGQWLDASIQLTGALGGG  475 (478)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             99999999999999999999999999999999999753357999999999999999999999999999999999971887


Q ss_pred             CC
Q ss_conf             99
Q gi|254780930|r  450 YN  451 (452)
Q Consensus       450 ~~  451 (452)
                      |+
T Consensus       476 Wq  477 (478)
T PRK11459        476 YH  477 (478)
T ss_pred             CC
T ss_conf             69


No 5  
>COG1538 TolC Outer membrane protein [Cell envelope biogenesis, outer membrane / Intracellular trafficking and secretion]
Probab=100.00  E-value=0  Score=485.72  Aligned_cols=431  Identities=29%  Similarity=0.517  Sum_probs=380.2

Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99975026899999995647501024677666676862343660998799999999970899899999999999999987
Q gi|254780930|r   13 VLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSV   92 (452)
Q Consensus        13 ~~l~gC~~~p~~~~p~~~~~~~~~~~~~~~~~~~~~~~~ww~~~~d~~L~~~i~~Al~~np~l~~a~~~i~~a~~~~~~a   92 (452)
                      ++++||++.|++..|..  .|..+..........   ..||+.|+|++|+++|+.++.+||+++.+..+++.+++.++.+
T Consensus         2 ~~l~~c~~~~~~~~~~~--~~~~~~~~~~~~~~~---~~w~~~~~~~~l~~li~~aL~~~~~l~~a~~~~~~a~a~~~~a   76 (457)
T COG1538           2 LLLAGCALLPPYLAPAA--VPAALAAAAAAAAAA---ATWWEAFNDAQLNQLVNLALAANPDLRVAAAEVEAARAQLRIA   76 (457)
T ss_pred             CCCHHHHCCCCCCCCCC--CHHHHHHHHHHCCCC---CCHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHH
T ss_conf             44026442863224422--426665442210242---3288886416578998999870956799999999999889998


Q ss_pred             HHHHCCCHHHCCCCCCCC-C-----------CCCCCCCCCCCCCCCCHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             542053011101124566-5-----------55444443211101100123-4577888877765556799999999999
Q gi|254780930|r   93 RADLFPSSYASISHRFIP-N-----------LKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISK  159 (452)
Q Consensus        93 ~a~~~P~~~~~~~~~~~~-~-----------~~~~~~~~~~~s~~ldl~G~-~~~~~~a~~~~~~~~~~~~~~~~~l~~~  159 (452)
                      ++.++|++++++++.+.. .           ........+ .+|++|+||+ ++.++++....++++.+++.++++++.+
T Consensus        77 ~a~~~P~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~ldl~gr~~~~~~aA~a~~~aa~~~~~~~~~~l~~~  155 (457)
T COG1538          77 RAALLPQLSASASYTRQTLAGGPLSSTGTDRNSYGYGLSL-ASWLLDLFGRVRANVRAAEAAAKAARAQLEAARLSLAAE  155 (457)
T ss_pred             HHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             7420798051023000445567766667665421254446-778668443677999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             99876666777889999999999999999878765543234567776532223557989999998568888768776399
Q gi|254780930|r  160 LIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGY  239 (452)
Q Consensus       160 v~~aY~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~~~~~~~l~~~~~~~~~a~~~L~~l~G~  239 (452)
                      |+++||++..+++++++.++.++..++.++.++.|++.|.++..|+.+++..+..++.++..++.++..+++.|..|+|.
T Consensus       156 va~aY~~~~~~~~~~~~a~~~~~~~~~~~~~~~~r~~~G~~~~~dv~qa~a~~~~a~~~l~~~~~~~~~a~~~L~~L~G~  235 (457)
T COG1538         156 VATAYFDLLAAQEQLALAEETLAAAEEQLELAEKRYDAGLATRLDVLQAEAQLASARAQLAAAQAQLAQARNALARLLGL  235 (457)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999999999999999999999999999999999976997187999999999999999999999999999999998596


Q ss_pred             CHHHHCCCCCCCCCCCCCCHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCCCCCCCCC---
Q ss_conf             92130001234554433100122104887899730234556555899996430101122221001122221122344---
Q gi|254780930|r  240 PATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---  316 (452)
Q Consensus       240 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~RPdi~~a~~~~~~a~~~i~~a~a~~~P~i~l~~~~~~~~~~~---  316 (452)
                      +|........+..   .+..+...+.++|++++.+||||++++++++++.++|+.+++.|||+|+|+|++++...+.   
T Consensus       236 ~~~~~~~~~~~~~---~~~~~~~~p~~~~~~~l~~rpdi~aA~~~l~aA~a~i~~a~a~~~P~lsL~a~~~~~~~~~~~~  312 (457)
T COG1538         236 EPGELLDAPEPEA---LPALPPVLPDGLPSEALARRPDILAAEAQLAAANANIGAARAAFLPTLSLTASYGRSSTNLSGL  312 (457)
T ss_pred             CCCCCCCCCCCCC---CCCCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCC
T ss_conf             9653323346322---2225667723349999982988999999999999889999744268545751002135666534


Q ss_pred             CCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             54454104431122345101245665677999999999999999999999999999999999999999999999999999
Q gi|254780930|r  317 FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKS  396 (452)
Q Consensus       317 ~~~~~~~~~~g~~l~~Pif~gg~~~a~i~~a~~~~~~a~~~~~~~~~~a~~ev~~a~~~~~~~~~~~~~~~~~~~~a~~~  396 (452)
                      +.+....|++|++++||||+||+++++++.++++++++..+|++++++++.||++++..+....+++..++..+..+++.
T Consensus       313 ~~~~~~~~~~g~~lslPif~gG~~~a~v~~A~a~~~~a~~~~~~~~~~a~~ev~~a~~~~~~~~~~~~a~~~~v~~a~~~  392 (457)
T COG1538         313 FGSSSRSWSVGPGLSLPIFDGGRLRARVRQAEAQYDAALAQYEQTVLTARQEVADALAALEAALEQLQALRQAVEAAQEA  392 (457)
T ss_pred             CCCCCCCEEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             46765414774578986368853168999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             99999998718832899999999999999999999999999999999984999998
Q gi|254780930|r  397 MSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP  452 (452)
Q Consensus       397 ~~~~~~~y~~G~~~~~dll~a~~~~~~a~~~~~~a~~~~~~a~~~L~~AlGGg~~~  452 (452)
                      ++.++.+|+.|.++++|||++++++++++..+++++++++.+.++|++++||||++
T Consensus       393 ~~~~~~~y~~G~~t~ldvL~Aq~~l~~a~~~~~~a~~~~~~a~~~L~~alG~~~~~  448 (457)
T COG1538         393 LELARERYQAGVRTLLDVLDAQRTLLQARQALLQARYDYLVALVNLYKALGGGWDE  448 (457)
T ss_pred             HHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             99999999758617999999999999999999999999999999999985688501


No 6  
>PRK09465 tolC outer membrane channel protein; Reviewed
Probab=100.00  E-value=0  Score=417.19  Aligned_cols=385  Identities=14%  Similarity=0.186  Sum_probs=339.2

Q ss_pred             HHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCC-------CCCCCCCCCCCCCCCCHHHHH
Q ss_conf             7999999999708998999999999999999875420530111011245665-------554444432111011001234
Q gi|254780930|r   60 SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN-------LKTNSTGQLDSDWKIDLFGQR  132 (452)
Q Consensus        60 ~L~~~i~~Al~~np~l~~a~~~i~~a~~~~~~a~a~~~P~~~~~~~~~~~~~-------~~~~~~~~~~~s~~ldl~G~~  132 (452)
                      +|.+|++.|++|||+|+.++.+++++++.+.++++.++|++++++++++..+       ..+..+++++++|.|.-||+.
T Consensus        24 tL~eal~~Al~~Np~l~~a~~~~~aa~~~~~~A~a~~lP~ls~s~~~~~~~~~~~~~~~~~~~~~~~l~l~q~lfd~~~~  103 (446)
T PRK09465         24 DLLQVYQQARLSDPELLKAAADRDAAFEKINEARSPLLPQLGLGAGYTYSNGDRDANGIDSNGLSASLQLTQTIFDMSKW  103 (446)
T ss_pred             CHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEEEEECCCCCCCCCCCCCEEEEEEEEEEECCHHH
T ss_conf             09999999997099999999999999988999886318858999766453257777777777612689999888665767


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             57788887776555679999999999999876666777889999999999999999878765543234567776532223
Q gi|254780930|r  133 RHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEI  212 (452)
Q Consensus       133 ~~~~~a~~~~~~~~~~~~~~~~~l~~~v~~aY~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~  212 (452)
                      ..++.+......+...+..++.+++.+|+++||+++.+++.+++.+++++..++.++.++.|++.|.++..|+++++.++
T Consensus       104 ~~~~~a~~~~~~a~~~~~~~~q~l~~~v~~aY~~vl~a~~~l~la~~~~~~~~~~l~~~~~r~~~G~~~~~Dv~~a~~~l  183 (446)
T PRK09465        104 RALTLAEKAAGQADVTYQTAQQTLILRVATAYFNVLRAIDNLSFTQAEKRAIYRQLEQTKQRFNVGLVAITDVHNAQAQY  183 (446)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHH
T ss_conf             79999999999999999999999999999999999999999999999999999999999999977986312599999899


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHCCCCCCCCCCCCCCHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             55798999999856888876877639992130001234554433100122104887899730234556555899996430
Q gi|254780930|r  213 KSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI  292 (452)
Q Consensus       213 ~~~~~~l~~~~~~~~~a~~~L~~l~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~RPdi~~a~~~~~~a~~~i  292 (452)
                      +.++.++..+++++..++..|..++|.+|.............+.|.   +. ..+...++.+||||+.++..+++++..+
T Consensus       184 ~~a~~~~~~a~~~l~~a~~~L~~l~G~~~~~~~~l~~~~~~~~~~~---~~-~~~~~~A~~~~p~l~~a~~~~~~A~~~~  259 (446)
T PRK09465        184 DTVLANEVLARNNLDNAYEALREITGNYYPELAVLNTERFSTPKPQ---SV-NALLKEAEKRNLSLLTARLSQDIAREQI  259 (446)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCC---CH-HHHHHHHHHCCHHHHHHHHHHHHHHHHH
T ss_conf             9999899999999999999999986889852222574335788998---89-9999999866999999999999999999


Q ss_pred             CCHHHHHHHHCCCCCCCCCCCCCC---------CCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             101122221001122221122344---------54454104431122345101245665677999999999999999999
Q gi|254780930|r  293 GIAKSDLYPSLSLNGSIALTHDNS---------FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVL  363 (452)
Q Consensus       293 ~~a~a~~~P~i~l~~~~~~~~~~~---------~~~~~~~~~~g~~l~~Pif~gg~~~a~i~~a~~~~~~a~~~~~~~~~  363 (452)
                      +.+++.+||+|++.|+|++.....         ..+....|++|++++||||+||+++++++.++.+..++..+++++.+
T Consensus       260 ~~aka~~~P~l~l~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~gl~ls~Pif~Gg~~~a~v~~A~~~~~~a~~~l~~~~~  339 (446)
T PRK09465        260 RLAQAGHLPTLDLTASYNISDTSYSGSKTNSQYDDSDMGQNKVGLNLSLPLYSGGMVNSQVKQAQYNFVGASEQLESAHR  339 (446)
T ss_pred             HHHHHCCCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99972769859999764013555666556665666776754899999987337873358999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999998718832899999999999999999999999999999999
Q gi|254780930|r  364 NAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLY  443 (452)
Q Consensus       364 ~a~~ev~~a~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~y~~G~~~~~dll~a~~~~~~a~~~~~~a~~~~~~a~~~L~  443 (452)
                      ++..+|+++|.+++.+.+++...+..+..+++.++.++.+|+.|..+.+|||+||+.+++++.++++++|+++.+.+.|.
T Consensus       340 ~v~~~v~~a~~~~~~a~~~i~a~~~~v~~A~~~l~~~~~~y~~G~~t~ldvLdAq~~l~~A~~~l~~A~yd~~~a~~~L~  419 (446)
T PRK09465        340 SVVQTVRSSFNNINASISSINAYEQSVVSAQSALDATEAGFEVGTRTIVDVLDATRTLYDAKRQLSNARYNYIINQLNLK  419 (446)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999999999999779964999999999999999999999999999999999


Q ss_pred             HHHCC
Q ss_conf             98499
Q gi|254780930|r  444 IAIGS  448 (452)
Q Consensus       444 ~AlGG  448 (452)
                      +++|.
T Consensus       420 ~a~G~  424 (446)
T PRK09465        420 QALGT  424 (446)
T ss_pred             HHHCC
T ss_conf             98589


No 7  
>TIGR01844 type_I_sec_TolC type I secretion outer membrane protein, TolC family; InterPro: IPR010130   Members of group of are outer membrane proteins from the TolC family within the RND (Resistance-Nodulation-cell Division) efflux systems. These proteins, unlike the NodT family, appear not to be lipoproteins. All are believed to participate in type I protein secretion, an ABC transporter system for protein secretion without cleavage of a signal sequence, although they may, like TolC, participate also in the efflux of smaller molecules as well. This family includes the well-documented examples TolC (Escherichia coli), PrtF (Erwinia), and AprF (Pseudomonas aeruginosa).; GO: 0015031 protein transport, 0019867 outer membrane.
Probab=100.00  E-value=0  Score=373.26  Aligned_cols=387  Identities=17%  Similarity=0.238  Sum_probs=337.4

Q ss_pred             HHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCCCC---------------CCCCCCCCCCC
Q ss_conf             799999999970899899999999999999987542053011101124566555---------------44444321110
Q gi|254780930|r   60 SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK---------------TNSTGQLDSDW  124 (452)
Q Consensus        60 ~L~~~i~~Al~~np~l~~a~~~i~~a~~~~~~a~a~~~P~~~~~~~~~~~~~~~---------------~~~~~~~~~s~  124 (452)
                      +|.++|..|+.+||+|+.+...+.+.++.+.+++++|+|+|+++++.++.....               ++.+..+++++
T Consensus         4 ~L~~a~~~A~~~NP~l~~a~~~~~a~~e~~~~AraallP~l~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~l~l~Q   83 (437)
T TIGR01844         4 TLLDAVELALANNPELRAARAQRDAGEEKVAQARAALLPQLGLTANIGYSNTNVTETRRRADGKIKRDLNSRSSTLTLSQ   83 (437)
T ss_pred             CHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCEECCCEEEEEEEE
T ss_conf             78899999974396589999875777643444311687435533316643454554421057655540046158888764


Q ss_pred             CCCHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             11001234-57788887776555679999999999999876666777889999999999999999878765543234567
Q gi|254780930|r  125 KIDLFGQR-RHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKL  203 (452)
Q Consensus       125 ~ldl~G~~-~~~~~a~~~~~~~~~~~~~~~~~l~~~v~~aY~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~~  203 (452)
                      .|..|++. ..++++....++++..+.....+++.+++.+|++++.+++.+.+.++++..+++.++.++.|++.|.++..
T Consensus        84 ~lfdG~~~~~~~~~~~~~~~~~~~~l~~~~q~~~~~~~~aY~~v~~~q~~l~l~~~n~~a~~~ql~~~~~R~~~G~~~~t  163 (437)
T TIGR01844        84 PLFDGGSTFNDVRAAEAAALAARENLRATAQDLILRVAEAYVEVLRAQEILALAEANLAALKEQLDLARARFDVGEGTRT  163 (437)
T ss_pred             EHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHH
T ss_conf             01646999999999889999999999988879999999999999999999999999999999999999999854687503


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC--HHHHCCCCCCCCCCCCCCHHHHHCCCCHHHHHHHHHHHHHH
Q ss_conf             7765322235579899999985688887687763999--21300012345544331001221048878997302345565
Q gi|254780930|r  204 SLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP--ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQ  281 (452)
Q Consensus       204 d~~~a~~~~~~~~~~l~~~~~~~~~a~~~L~~l~G~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~RPdi~~a  281 (452)
                      ||.++|+++..+++++..+++++..++..|..++|.|  +.++.....+......|.....+. .+-..+..++|.|+++
T Consensus       164 DV~q~eAR~~~A~a~l~~a~~~l~~a~~~l~~l~G~pL~~~~l~~l~~~~~~~~~~~~~~~~~-~~~~~A~~~~P~llaa  242 (437)
T TIGR01844       164 DVLQAEARYASARAQLIQAQANLDDAKAQLRRLVGQPLEISELAPLAVPSLPAELPAPTSDLD-QLLEIAEASNPALLAA  242 (437)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHCCCCCCCHH-HHHHHHHHHHHHHHHH
T ss_conf             689999999999999999999899999999996589988357653676672010342248989-9999999854899999


Q ss_pred             HHHHHHHHHHHCCHHHHHHHHCCCCCCCCCCCCCCCC-------------CCCCEEEEECCCCCCCCHHHHHHHHHHHHH
Q ss_conf             5589999643010112222100112222112234454-------------454104431122345101245665677999
Q gi|254780930|r  282 EKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFP-------------GYNTHWSFGPKLYLPIFDKGKIKSNIRRAE  348 (452)
Q Consensus       282 ~~~~~~a~~~i~~a~a~~~P~i~l~~~~~~~~~~~~~-------------~~~~~~~~g~~l~~Pif~gg~~~a~i~~a~  348 (452)
                      +..++++.+.|+.+|+.|+|+|+|.|+.+...+....             ......++|+++++|||.||...++++.|+
T Consensus       243 ~~~~~~A~~~~~~~~A~~~PTl~l~As~~~~~~~~~~~~~~g~~~~~~~D~~~~~~s~~l~~~~PlY~GG~~~a~~rqA~  322 (437)
T TIGR01844       243 QAAVNAARYEVEQARAGHLPTLSLTASTGKSDTASGGSGNSGAATTQQYDDYSDTDSIGLNVSIPLYQGGATSAQVRQAK  322 (437)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEEEEECCCCHHHHHHHHH
T ss_conf             99999999999986167874132001024125543433121234433356401000356777520223766189999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999998718832899999999999999999
Q gi|254780930|r  349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDL  428 (452)
Q Consensus       349 ~~~~~a~~~~~~~~~~a~~ev~~a~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~y~~G~~~~~dll~a~~~~~~a~~~~  428 (452)
                      .+..++..+++.+.++++.+|+++|.++......+...+..+.+++++++.++..|+.|..+++|||++++++++++.++
T Consensus       323 ~~~~~s~~~~e~~~r~v~~~~~~a~~~~~~~~~~~~a~~~~v~sa~~~~~~~~~~~~vG~Rt~LDvLna~~eLy~A~~~l  402 (437)
T TIGR01844       323 HQLNQSRSTLESQKRTVRQQVRNAWSQLEAAAASVQAYEDQVASAQKALDAYRQEYQVGTRTLLDVLNAENELYQARQAL  402 (437)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             99999999998789999999999999998779999999999999999999999988347531004475589999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHC
Q ss_conf             9999999999999999849
Q gi|254780930|r  429 SIAKRQLAKSYVDLYIAIG  447 (452)
Q Consensus       429 ~~a~~~~~~a~~~L~~AlG  447 (452)
                      ++++|+++.+.+.|..|+|
T Consensus       403 ~~ary~~~~a~~~l~~A~G  421 (437)
T TIGR01844       403 VQARYDYLLAQLRLLSATG  421 (437)
T ss_pred             HHHHHHHHHHHHHHHHHHC
T ss_conf             8668999999999998716


No 8  
>pfam02321 OEP Outer membrane efflux protein. The OEP family (Outer membrane efflux protein) form trimeric channels that allow export of a variety of substrates in Gram negative bacteria. Each member of this family is composed of two repeats. The trimeric channel is composed of a 12 stranded all beta sheet barrel that spans the outer membrane, and a long all helical barrel that spans the periplasm.
Probab=99.93  E-value=1.7e-23  Score=171.38  Aligned_cols=179  Identities=26%  Similarity=0.364  Sum_probs=166.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCCCCCCCCCC--CCCCCEEEEECCCCCCCCHHHHHHHHHHH
Q ss_conf             8997302345565558999964301011222210011222211223445--44541044311223451012456656779
Q gi|254780930|r  269 ADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSF--PGYNTHWSFGPKLYLPIFDKGKIKSNIRR  346 (452)
Q Consensus       269 ~~~l~~RPdi~~a~~~~~~a~~~i~~a~a~~~P~i~l~~~~~~~~~~~~--~~~~~~~~~g~~l~~Pif~gg~~~a~i~~  346 (452)
                      ..++.|||||+.++..++++...++.+++.++|+|+++++++...+...  ......|++|++++||||+||+.+.+++.
T Consensus         6 ~~Al~nnp~l~~a~~~~~~a~~~~~~a~~~~~P~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~i~~~g~~~~~~~~   85 (186)
T pfam02321         6 ALALENNPDLKAAEAEIEAARANIKLAKSEFLPDLSLSGGYGYNGNNSNGGGDDPRNGSVGLGLSQPLFDGGKRRARVKA   85 (186)
T ss_pred             HHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCCCEEEEEEEEEECCCCHHHHHHHHH
T ss_conf             99998099999999999999999999861438865678631014566666667776504788998760343243379999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999987188328999999999999999
Q gi|254780930|r  347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEV  426 (452)
Q Consensus       347 a~~~~~~a~~~~~~~~~~a~~ev~~a~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~y~~G~~~~~dll~a~~~~~~a~~  426 (452)
                      ++...+.+..+++.+.+++..+|..+|..+....+.+...++.++.+++.++..+.+|+.|..+..||++++..+.+++.
T Consensus        86 ~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~G~~~~~dl~~a~~~~~~a~~  165 (186)
T pfam02321        86 AKAQLEAAEAQLEQARRQLRLEVAQAYLNLLAAKEQLELAKQALELAEEALELAEARYEAGLISLLDVLQAEVELLEARL  165 (186)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHH
T ss_conf             99999999998679999999999999999999999999999999999999999999997699758899999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHC
Q ss_conf             999999999999999999849
Q gi|254780930|r  427 DLSIAKRQLAKSYVDLYIAIG  447 (452)
Q Consensus       427 ~~~~a~~~~~~a~~~L~~AlG  447 (452)
                      ++++++.++..+...|+.++|
T Consensus       166 ~~~~a~~~~~~a~~~L~~~~G  186 (186)
T pfam02321       166 ELLEAEADLELARAQLEYLLG  186 (186)
T ss_pred             HHHHHHHHHHHHHHHHHHHCC
T ss_conf             999999999999999998549


No 9  
>pfam02321 OEP Outer membrane efflux protein. The OEP family (Outer membrane efflux protein) form trimeric channels that allow export of a variety of substrates in Gram negative bacteria. Each member of this family is composed of two repeats. The trimeric channel is composed of a 12 stranded all beta sheet barrel that spans the outer membrane, and a long all helical barrel that spans the periplasm.
Probab=99.89  E-value=6.8e-21  Score=154.35  Aligned_cols=178  Identities=24%  Similarity=0.352  Sum_probs=164.6

Q ss_pred             HHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCCCCC-------CCCCCCCCCCCCCHHHHHH
Q ss_conf             999999999708998999999999999999875420530111011245665554-------4444321110110012345
Q gi|254780930|r   61 LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKT-------NSTGQLDSDWKIDLFGQRR  133 (452)
Q Consensus        61 L~~~i~~Al~~np~l~~a~~~i~~a~~~~~~a~a~~~P~~~~~~~~~~~~~~~~-------~~~~~~~~s~~ldl~G~~~  133 (452)
                      |+++|+.|++|||+|+.+..+++.++.+++.+++.++|++++++++++......       ..+.+++++|+|+.||+..
T Consensus         1 l~~~i~~Al~nnp~l~~a~~~~~~a~~~~~~a~~~~~P~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~i~~~g~~~   80 (186)
T pfam02321         1 LDELLALALENNPDLKAAEAEIEAARANIKLAKSEFLPDLSLSGGYGYNGNNSNGGGDDPRNGSVGLGLSQPLFDGGKRR   80 (186)
T ss_pred             CHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCCCEEEEEEEEEECCCCHHHH
T ss_conf             98999999980999999999999999999998614388656786310145666666677765047889987603432433


Q ss_pred             -HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -7788887776555679999999999999876666777889999999999999999878765543234567776532223
Q gi|254780930|r  134 -HIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEI  212 (452)
Q Consensus       134 -~~~~a~~~~~~~~~~~~~~~~~l~~~v~~aY~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~  212 (452)
                       .++.+....+.+...++.++.++..++..+|+++...++.+++.++.++..++.++.++.+|+.|.++..|+++++.++
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~G~~~~~dl~~a~~~~  160 (186)
T pfam02321        81 ARVKAAKAQLEAAEAQLEQARRQLRLEVAQAYLNLLAAKEQLELAKQALELAEEALELAEARYEAGLISLLDVLQAEVEL  160 (186)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHH
T ss_conf             79999999999999986799999999999999999999999999999999999999999999976997588999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             55798999999856888876877639
Q gi|254780930|r  213 KSIESDIPTLEKSFRMNVHNISTLLG  238 (452)
Q Consensus       213 ~~~~~~l~~~~~~~~~a~~~L~~l~G  238 (452)
                      ..++.++.+++.++..++..|..++|
T Consensus       161 ~~a~~~~~~a~~~~~~a~~~L~~~~G  186 (186)
T pfam02321       161 LEARLELLEAEADLELARAQLEYLLG  186 (186)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999999999999999999998549


No 10 
>PRK09465 tolC outer membrane channel protein; Reviewed
Probab=99.85  E-value=5.6e-19  Score=141.84  Aligned_cols=185  Identities=17%  Similarity=0.176  Sum_probs=164.0

Q ss_pred             HHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCC--------------CCCCCCCCCCCCCC
Q ss_conf             7999999999708998999999999999999875420530111011245665--------------55444443211101
Q gi|254780930|r   60 SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN--------------LKTNSTGQLDSDWK  125 (452)
Q Consensus        60 ~L~~~i~~Al~~np~l~~a~~~i~~a~~~~~~a~a~~~P~~~~~~~~~~~~~--------------~~~~~~~~~~~s~~  125 (452)
                      .+++++..|+.+||+++.++..++.++..++.+++.++|++++.+++++...              ...+.+.+++++|+
T Consensus       230 ~~~~~~~~A~~~~p~l~~a~~~~~~A~~~~~~aka~~~P~l~l~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~gl~ls~P  309 (446)
T PRK09465        230 SVNALLKEAEKRNLSLLTARLSQDIAREQIRLAQAGHLPTLDLTASYNISDTSYSGSKTNSQYDDSDMGQNKVGLNLSLP  309 (446)
T ss_pred             CHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCEEEEEEEEEE
T ss_conf             89999999986699999999999999999999972769859999764013555666556665666776754899999987


Q ss_pred             CCHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             10012345-77888877765556799999999999998766667778899999999999999998787655432345677
Q gi|254780930|r  126 IDLFGQRR-HIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLS  204 (452)
Q Consensus       126 ldl~G~~~-~~~~a~~~~~~~~~~~~~~~~~l~~~v~~aY~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d  204 (452)
                      |.-+|+.+ .++.++.....++.+++.++.++..+|..+|.++..+.+++...++.++.+++.++.++.+|+.|..+.+|
T Consensus       310 if~Gg~~~a~v~~A~~~~~~a~~~l~~~~~~v~~~v~~a~~~~~~a~~~i~a~~~~v~~A~~~l~~~~~~y~~G~~t~ld  389 (446)
T PRK09465        310 LYSGGMVNSQVKQAQYNFVGASEQLESAHRSVVQTVRSSFNNINASISSINAYEQSVVSAQSALDATEAGFEVGTRTIVD  389 (446)
T ss_pred             EECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHH
T ss_conf             33787335899999999999999999999999999999999999999999999999999999999999999779964999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             7653222355798999999856888876877639992130
Q gi|254780930|r  205 LVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEF  244 (452)
Q Consensus       205 ~~~a~~~~~~~~~~l~~~~~~~~~a~~~L~~l~G~~~~~~  244 (452)
                      |+.++..+.+++.++.+++.++..+..+|...+|.-.++.
T Consensus       390 vLdAq~~l~~A~~~l~~A~yd~~~a~~~L~~a~G~L~~~~  429 (446)
T PRK09465        390 VLDATRTLYDAKRQLSNARYNYIINQLNLKQALGTLNEQD  429 (446)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHH
T ss_conf             9999999999999999999999999999999858999999


No 11 
>TIGR01844 type_I_sec_TolC type I secretion outer membrane protein, TolC family; InterPro: IPR010130   Members of group of are outer membrane proteins from the TolC family within the RND (Resistance-Nodulation-cell Division) efflux systems. These proteins, unlike the NodT family, appear not to be lipoproteins. All are believed to participate in type I protein secretion, an ABC transporter system for protein secretion without cleavage of a signal sequence, although they may, like TolC, participate also in the efflux of smaller molecules as well. This family includes the well-documented examples TolC (Escherichia coli), PrtF (Erwinia), and AprF (Pseudomonas aeruginosa).; GO: 0015031 protein transport, 0019867 outer membrane.
Probab=99.82  E-value=1e-17  Score=133.62  Aligned_cols=180  Identities=14%  Similarity=0.184  Sum_probs=161.0

Q ss_pred             HHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCCC------------------CCCCCCCCC
Q ss_conf             79999999997089989999999999999998754205301110112456655------------------544444321
Q gi|254780930|r   60 SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL------------------KTNSTGQLD  121 (452)
Q Consensus        60 ~L~~~i~~Al~~np~l~~a~~~i~~a~~~~~~a~a~~~P~~~~~~~~~~~~~~------------------~~~~~~~~~  121 (452)
                      .++++++.|..+||.|.+++..++.|+..+..++++++|+|++.++.++..+.                  ....+.++.
T Consensus       224 ~~~~~~~~A~~~~P~llaa~~~~~~A~~~~~~~~A~~~PTl~l~As~~~~~~~~~~~~~~g~~~~~~~D~~~~~~s~~l~  303 (437)
T TIGR01844       224 DLDQLLEIAEASNPALLAAQAAVNAARYEVEQARAGHLPTLSLTASTGKSDTASGGSGNSGAATTQQYDDYSDTDSIGLN  303 (437)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEE
T ss_conf             98999999998548999999999999999998616787413200102412554343312123443335640100035677


Q ss_pred             CCCCCCHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             110110012345-7788887776555679999999999999876666777889999999999999999878765543234
Q gi|254780930|r  122 SDWKIDLFGQRR-HIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGAT  200 (452)
Q Consensus       122 ~s~~ldl~G~~~-~~~~a~~~~~~~~~~~~~~~~~l~~~v~~aY~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~  200 (452)
                      ++++|.-.|... .++.|......++..++..+.++..+|..+|-++......+...+..+...+..++.++.-|+.|.-
T Consensus       304 ~~~PlY~GG~~~a~~rqA~~~~~~s~~~~e~~~r~v~~~~~~a~~~~~~~~~~~~a~~~~v~sa~~~~~~~~~~~~vG~R  383 (437)
T TIGR01844       304 VSIPLYQGGATSAQVRQAKHQLNQSRSTLESQKRTVRQQVRNAWSQLEAAAASVQAYEDQVASAQKALDAYRQEYQVGTR  383 (437)
T ss_pred             EEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             75202237661899999999999999999878999999999999999877999999999999999999999998834753


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             567776532223557989999998568888768776399
Q gi|254780930|r  201 SKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGY  239 (452)
Q Consensus       201 ~~~d~~~a~~~~~~~~~~l~~~~~~~~~a~~~L~~l~G~  239 (452)
                      +.+||+.++.++-+++.++.+++.++..+...|..-+|.
T Consensus       384 t~LDvLna~~eLy~A~~~l~~ary~~~~a~~~l~~A~G~  422 (437)
T TIGR01844       384 TLLDVLNAENELYQARQALVQARYDYLLAQLRLLSATGT  422 (437)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             100447558999999999986689999999999987166


No 12 
>COG1538 TolC Outer membrane protein [Cell envelope biogenesis, outer membrane / Intracellular trafficking and secretion]
Probab=99.80  E-value=3.5e-17  Score=130.08  Aligned_cols=183  Identities=18%  Similarity=0.176  Sum_probs=162.4

Q ss_pred             HHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCCCCC--------CCCCCCCCCCCCCHHHHH
Q ss_conf             999999999708998999999999999999875420530111011245665554--------444432111011001234
Q gi|254780930|r   61 LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKT--------NSTGQLDSDWKIDLFGQR  132 (452)
Q Consensus        61 L~~~i~~Al~~np~l~~a~~~i~~a~~~~~~a~a~~~P~~~~~~~~~~~~~~~~--------~~~~~~~~s~~ldl~G~~  132 (452)
                      ...++..++.++|||++++++++.+.+.++.+++.+||++++.++++.......        ..+.+++++++|..+|+.
T Consensus       257 p~~~~~~~l~~rpdi~aA~~~l~aA~a~i~~a~a~~~P~lsL~a~~~~~~~~~~~~~~~~~~~~~~g~~lslPif~gG~~  336 (457)
T COG1538         257 PDGLPSEALARRPDILAAEAQLAAANANIGAARAAFLPTLSLTASYGRSSTNLSGLFGSSSRSWSVGPGLSLPIFDGGRL  336 (457)
T ss_pred             CHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCCCCCCEEEEEEEEEEECCCCCH
T ss_conf             23349999982988999999999999889999744268545751002135666534467654147745789863688531


Q ss_pred             H-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             5-778888777655567999999999999987666677788999999999999999987876554323456777653222
Q gi|254780930|r  133 R-HIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAE  211 (452)
Q Consensus       133 ~-~~~~a~~~~~~~~~~~~~~~~~l~~~v~~aY~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~  211 (452)
                      + +++.+++..+.+...++.++.++..+|..+|.++....+++...++.++..++.++..+.+|+.|..+.+|++.++..
T Consensus       337 ~a~v~~A~a~~~~a~~~~~~~~~~a~~ev~~a~~~~~~~~~~~~a~~~~v~~a~~~~~~~~~~y~~G~~t~ldvL~Aq~~  416 (457)
T COG1538         337 RARVRQAEAQYDAALAQYEQTVLTARQEVADALAALEAALEQLQALRQAVEAAQEALELARERYQAGVRTLLDVLDAQRT  416 (457)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHH
T ss_conf             68999999999999999999999999999999999999999999999999999999999999997586179999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHH
Q ss_conf             35579899999985688887687763999213
Q gi|254780930|r  212 IKSIESDIPTLEKSFRMNVHNISTLLGYPATE  243 (452)
Q Consensus       212 ~~~~~~~l~~~~~~~~~a~~~L~~l~G~~~~~  243 (452)
                      +..++..+..++.++..+...|...+|.....
T Consensus       417 l~~a~~~~~~a~~~~~~a~~~L~~alG~~~~~  448 (457)
T COG1538         417 LLQARQALLQARYDYLVALVNLYKALGGGWDE  448 (457)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             99999999999999999999999985688501


No 13 
>PRK09837 copper/silver efflux system outer membrane protein CusC; Provisional
Probab=99.79  E-value=7.5e-17  Score=127.90  Aligned_cols=176  Identities=14%  Similarity=0.152  Sum_probs=68.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCCCCCCCC-CCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             73023455655589999643010112222100112222112234-45445410443112234510124566567799999
Q gi|254780930|r  272 IRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDN-SFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESS  350 (452)
Q Consensus       272 l~~RPdi~~a~~~~~~a~~~i~~a~a~~~P~i~l~~~~~~~~~~-~~~~~~~~~~~g~~l~~Pif~gg~~~a~i~~a~~~  350 (452)
                      +.++|||+.+..+++.+++.++.+++.+||+|+..++..+..+. ........|+.|++++|.|--||+++..++.+++.
T Consensus        71 l~~N~dl~~A~~rv~~A~a~~~~a~a~~~P~~~~~~~~~~~~~~~~~~~~~~~~~~gl~~swelDl~Gr~r~~~~aa~~~  150 (460)
T PRK09837         71 LVNNRDLRMATLKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGDSATTREFSTGLNASFDLDFFGRLKNMSEAERQN  150 (460)
T ss_pred             HHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCEEECEEEEEEEEHHHHHHHHHHHHHHH
T ss_conf             96598799999999999999999876008831220000005778899886531000204788740322048999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999871883289999999999999999999
Q gi|254780930|r  351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSI  430 (452)
Q Consensus       351 ~~~a~~~~~~~~~~a~~ev~~a~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~y~~G~~~~~dll~a~~~~~~a~~~~~~  430 (452)
                      +..+..+++.+.+.+..+|..+|.++....+++...++.++..++.+++++.+|+.|.++.+||..++..+..++.++..
T Consensus       151 ~~a~~~~~~~~~l~l~a~Va~~Y~~l~~~~~~l~~~~~~l~~~~~~l~l~~~r~~~G~~s~ldv~qa~~~l~~~~a~l~~  230 (460)
T PRK09837        151 YLATEEAQRAVHILLVSNVAQSYFNQQLAYAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAK  230 (460)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999999999999999999999999985898677899999999999987999


Q ss_pred             HHHHHHHHHHHHHHHHC
Q ss_conf             99999999999999849
Q gi|254780930|r  431 AKRQLAKSYVDLYIAIG  447 (452)
Q Consensus       431 a~~~~~~a~~~L~~AlG  447 (452)
                      .+.+...+...|-.-+|
T Consensus       231 ~~~~~~~~~~~La~LlG  247 (460)
T PRK09837        231 RQGELAQANNALQLLLG  247 (460)
T ss_pred             HHHHHHHHHHHHHHHHC
T ss_conf             99999999999999819


No 14 
>PRK09915 putative outer membrane efflux protein MdtP; Provisional
Probab=99.72  E-value=5.3e-15  Score=115.82  Aligned_cols=295  Identities=11%  Similarity=0.107  Sum_probs=194.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             88877765556799999999999998766667778899999999999999998787655432345677765322235579
Q gi|254780930|r  137 SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE  216 (452)
Q Consensus       137 ~a~~~~~~~~~~~~~~~~~l~~~v~~aY~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~~~~~  216 (452)
                      .-+...+++.+.+..+..+...--...--++...--.+.-..+.++..++.++..+..++.-..---.-...+..+.+++
T Consensus       160 r~r~~~~aA~a~~~A~~a~~~~~~l~l~a~vA~~Y~~l~~~~~~l~l~~~~~~~~~~~l~l~~~r~~~G~~s~~dv~~a~  239 (488)
T PRK09915        160 VHRSAVAAAIGAHNAALAETAAVELSLTTGVAQLYYSMQASYQMLDLLEQTRDVIDYAVKAHQSKVAHGLEAQVPFHGAR  239 (488)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHH
T ss_conf             65799999999999999999999999999999999999999999999999999999999999999982765578999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCHHHHCCCCCCCCCCCCCCHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCHH
Q ss_conf             89999998568888768776399921300012345544331001221048878997302345565558999964301011
Q gi|254780930|r  217 SDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK  296 (452)
Q Consensus       217 ~~l~~~~~~~~~a~~~L~~l~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~RPdi~~a~~~~~~a~~~i~~a~  296 (452)
                      .++..++.++...+..+....+.- .......+.......+.....++..+|..+   -.||..-+-.|.+++..+..+.
T Consensus       240 ~~l~~~~a~l~~l~~~~~~~~~aL-a~L~G~~~~~~~~~~~~~~p~~~~~~P~~l---ps~LL~rRPDI~aAe~~l~Aa~  315 (488)
T PRK09915        240 AQILAVDKQIAAVKGQITETRESL-RALIGAGASDMPEIKPVALPRVQTGIPATL---SYELLARRPDLQAMRWYVQASL  315 (488)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH-HHHHCCCCCCCCCCCCCCCCCCCCCCCCCC---HHHHHHCCHHHHHHHHHHHHHH
T ss_conf             999999999999999999999899-998299953222357654466787789887---3989862911999999999999


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCEEEEECC-CCC-CCCHHHHH--------HHHH---HHHHHHHHHHHHHHHHHHH
Q ss_conf             222210011222211223445445410443112-234-51012456--------6567---7999999999999999999
Q gi|254780930|r  297 SDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPK-LYL-PIFDKGKI--------KSNI---RRAESSAQEQYITWQETVL  363 (452)
Q Consensus       297 a~~~P~i~l~~~~~~~~~~~~~~~~~~~~~g~~-l~~-Pif~gg~~--------~a~i---~~a~~~~~~a~~~~~~~~~  363 (452)
                      +..          |...-+.|+.-+...++|.+ .++ .+|+++..        ...|   -.-+++.+.+..++++.+.
T Consensus       316 a~i----------g~A~A~~~P~lsLsg~~G~~s~~~~~lf~~~~~~~~~~~~l~~PiFdgG~l~a~~~~a~a~~~~a~~  385 (488)
T PRK09915        316 DQV----------DSARALFYPSFDIKAFFGLDAIHLDTLFKKTSRQFNFIPGLKLPLFDGGRLNANLEGTRAASNMMIE  385 (488)
T ss_pred             HHH----------HHHHHHHCCCCCEECCCCCCCCCHHHHCCCCCHHEEHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             748----------8999844877511000264545666534685110001012204568553799999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999998718832899999999999999999999999999999999
Q gi|254780930|r  364 NAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLY  443 (452)
Q Consensus       364 ~a~~ev~~a~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~y~~G~~~~~dll~a~~~~~~a~~~~~~a~~~~~~a~~~L~  443 (452)
                      +-.+-|-+++.....+...+....+......+.++.++..++....-+..=+....++++++..+..++.++..+..+..
T Consensus       386 ~Y~~tvl~A~~eV~~al~~~~~~~~~~~~~~~a~~~a~~~~~la~~~Y~~G~~~~l~vL~Aqr~~l~a~~~l~~~~~~~l  465 (488)
T PRK09915        386 RYNQSVLNAVRDVAVNGTRLQTLNDEREMQAERVEATRFTQRAAEAAYQRGLTSRLQATEARLPVLAEEMSLLMLDSRRV  465 (488)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999999999999999999976544799999999999999999999999999


Q ss_pred             HH
Q ss_conf             98
Q gi|254780930|r  444 IA  445 (452)
Q Consensus       444 ~A  445 (452)
                      .+
T Consensus       466 ~~  467 (488)
T PRK09915        466 IQ  467 (488)
T ss_pred             HH
T ss_conf             99


No 15 
>TIGR01845 outer_NodT efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family; InterPro: IPR010131   Members of group are outer membrane lipoproteins from the NodT family of the RND (Resistance-Nodulation-cell Division) type efflux systems. These proteins work with an inner membrane ABC transporter ATPase and an adapter called a membrane fusion protein. Most members of this family are likely to export primarily small molecules rather than proteins, but are related to the type I protein secretion outer membrane proteins TolC and PrtF.; GO: 0005215 transporter activity, 0008289 lipid binding, 0006810 transport, 0016020 membrane.
Probab=99.66  E-value=5.8e-14  Score=109.04  Aligned_cols=170  Identities=19%  Similarity=0.279  Sum_probs=75.9

Q ss_pred             HHHCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCC------CCCCCCCCCCCCCCCCHH--HHHH-HHHHHH
Q ss_conf             9708998999999999999999875420530111011245665------554444432111011001--2345-778888
Q gi|254780930|r   69 LQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN------LKTNSTGQLDSDWKIDLF--GQRR-HIESSL  139 (452)
Q Consensus        69 l~~np~l~~a~~~i~~a~~~~~~a~a~~~P~~~~~~~~~~~~~------~~~~~~~~~~~s~~ldl~--G~~~-~~~~a~  139 (452)
                      +++=|||.+|+.+++++.+++.+|++.|||+|+++++.+....      ...+..++++.+..+++|  |+.+ .++.|.
T Consensus       297 ~~~RPDi~aAE~~l~Aa~a~IgvA~A~~fPs~tLsA~~G~~a~~~~~L~~~g~~~W~~gP~l~lPiF~GG~L~A~~~~A~  376 (477)
T TIGR01845       297 LRRRPDILAAERRLAAANASIGVAKAAFFPSITLSASIGLSASTLSKLFDSGSRFWSIGPALALPIFDGGSLRAALDSAK  376 (477)
T ss_pred             HHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEHHHHHHHHHHHHCCCCCCCCCCCEECCCCCCCCHHCCCHHHHHHHHH
T ss_conf             62280389999999874430999998746870045788865200002456664221102100043002010055321789


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             77765556799999999999998766667778899999999999999998787655432345677765322235579899
Q gi|254780930|r  140 ANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDI  219 (452)
Q Consensus       140 ~~~~~~~~~~~~~~~~l~~~v~~aY~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~~~~~~~l  219 (452)
                      +.++.+-+.|+.+.++-..+|...-.-+....++++..++.++.+++.+.+++.||+.|+++-+||+.++..+.+.+..+
T Consensus       377 A~yd~avA~Y~~~vl~A~~~VaD~l~A~~~~~~~~~~~~~Av~~A~~~~~la~~rY~aG~~~yL~vl~A~~~~~~a~~~l  456 (477)
T TIGR01845       377 AAYDAAVAQYRQTVLTAFQEVADALAALQALARRLDAQRDAVEAAEEALQLAQNRYRAGLISYLTVLEAQRSLLTAQRSL  456 (477)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999979999999999999999999999998652543644898999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHCC
Q ss_conf             9999856888876877639
Q gi|254780930|r  220 PTLEKSFRMNVHNISTLLG  238 (452)
Q Consensus       220 ~~~~~~~~~a~~~L~~l~G  238 (452)
                      .+++.+.-.....|..-+|
T Consensus       457 ~~l~~~~l~~~~~L~~ALG  475 (477)
T TIGR01845       457 ATLQAQRLSASVALYKALG  475 (477)
T ss_pred             HHHHHHHHHHHHHHHHHCC
T ss_conf             9999999999999998427


No 16 
>PRK11459 multidrug resistance outer membrane protein MdtQ; Provisional
Probab=99.66  E-value=6.1e-14  Score=108.90  Aligned_cols=99  Identities=14%  Similarity=0.060  Sum_probs=52.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             66567799999999999999999999999999999999999999999999999999999999998718832899999999
Q gi|254780930|r  340 IKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIER  419 (452)
Q Consensus       340 ~~a~i~~a~~~~~~a~~~~~~~~~~a~~ev~~a~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~y~~G~~~~~dll~a~~  419 (452)
                      .+++.+.+-+.++++...-=+.+.+++..+......+....+.....++.+..++..|+.-...|..-......+++++.
T Consensus       373 a~A~~~~A~~~Y~~tvl~A~~eVe~Al~~~~~~~~~~~~~~~~~~~a~~a~~la~~ry~~G~~~~l~vL~Aq~~~~~a~~  452 (478)
T PRK11459        373 AKAQSNLSIASYNKAVVDAVNDVARAASQVETLAEKNQHQQQIERDALRVVGLAQARFNAGIIAGSRVSEAKIPALRERA  452 (478)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999999999999999999999999999997533579999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999
Q gi|254780930|r  420 ATAKVEVDLSIAKRQLAKS  438 (452)
Q Consensus       420 ~~~~a~~~~~~a~~~~~~a  438 (452)
                      .+.+++.+.+.+..+++.+
T Consensus       453 ~l~~~~~~~l~~~v~Ly~A  471 (478)
T PRK11459        453 NGLLLQGQWLDASIQLTGA  471 (478)
T ss_pred             HHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999997


No 17 
>PRK03598 hypothetical protein; Provisional
Probab=96.87  E-value=0.032  Score=32.27  Aligned_cols=14  Identities=21%  Similarity=0.040  Sum_probs=7.2

Q ss_pred             CCCHHHHHHHHHHH
Q ss_conf             93069999999999
Q gi|254780930|r    1 MNILRAIFSLFIVL   14 (452)
Q Consensus         1 M~~~~~~~~l~~~~   14 (452)
                      ||....++++++++
T Consensus         1 mkk~~~~~~~~~~~   14 (331)
T PRK03598          1 MKKPVVIGLAVVAL   14 (331)
T ss_pred             CCCHHHHHHHHHHH
T ss_conf             98338999999999


No 18 
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family; InterPro: IPR010129   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).    Type I secretion is an ABC transporter that exports proteins, without cleavage of any signal sequence, from the cytosol to extracellular medium across both inner and outer membranes. The secretion signal is found in the C terminus of the transported protein. This entry represents the adaptor protein between the ATP-binding cassette (ABC) protein of the inner membrane and the outer membrane protein, and is called the membrane fusion protein. This entry selects a group of sequences closely related to HlyD; it is defined narrowly and excludes, for example, colicin V secretion protein CvaA and multidrug efflux proteins.; GO: 0015031 protein transport, 0009276 1-2nm peptidoglycan-based cell wall, 0016021 integral to membrane.
Probab=96.49  E-value=0.059  Score=30.56  Aligned_cols=104  Identities=15%  Similarity=0.244  Sum_probs=95.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             77888877765556799999999999998766667778899999999999999998787655432345677765322235
Q gi|254780930|r  134 HIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIK  213 (452)
Q Consensus       134 ~~~~a~~~~~~~~~~~~~~~~~l~~~v~~aY~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~~  213 (452)
                      .++......+.....++.....+..++.+.=..+...+.++.-.++.++..++.++..+.+.+.|.+++.+++..+..+.
T Consensus       134 ~~~~~~~~f~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~L~~~g~~~~~~~L~~e~~~~  213 (434)
T TIGR01843       134 LVKGQQSLFESRKSALRAQLESILAQIKQLEAELEGLQAQLQALRQQLELISEELEALRKLKEKGLVSRLELLELERERA  213 (434)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
T ss_conf             99999999999999888999999999999999999999999878999999999999863066334321678999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             579899999985688887687763
Q gi|254780930|r  214 SIESDIPTLEKSFRMNVHNISTLL  237 (452)
Q Consensus       214 ~~~~~l~~~~~~~~~a~~~L~~l~  237 (452)
                      .++.++...+..+...+..+..+-
T Consensus       214 ~~~~~~~~~~~~~~~~~~~~~~~~  237 (434)
T TIGR01843       214 ELQGELARLEAELEVLKAQIDELQ  237 (434)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999987999999999999999


No 19 
>PRK10476 multidrug resistance protein MdtN; Provisional
Probab=96.25  E-value=0.08  Score=29.68  Aligned_cols=13  Identities=15%  Similarity=0.268  Sum_probs=7.9

Q ss_pred             HHHHHHCCCCCCC
Q ss_conf             2222100112222
Q gi|254780930|r  297 SDLYPSLSLNGSI  309 (452)
Q Consensus       297 a~~~P~i~l~~~~  309 (452)
                      .+.||.-.+.|..
T Consensus       271 ~Da~p~~~f~G~V  283 (348)
T PRK10476        271 SMIDRGRPIEGKV  283 (348)
T ss_pred             EECCCCCEEEEEE
T ss_conf             9768997899999


No 20 
>PRK09859 multidrug efflux system protein MdtE; Provisional
Probab=95.71  E-value=0.082  Score=29.63  Aligned_cols=55  Identities=5%  Similarity=0.054  Sum_probs=45.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999878765543234567776532223557989999998568888768776
Q gi|254780930|r  182 DLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL  236 (452)
Q Consensus       182 ~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~~~~~~~l~~~~~~~~~a~~~L~~l  236 (452)
                      +.++..++..+.+++.|.+++.|+.+++.++..+++++..++.+++.++..|...
T Consensus       116 ~~A~~~~~R~~~L~~~~~iS~~~~d~a~~~~~~A~A~~~~A~a~l~~a~~~l~~t  170 (385)
T PRK09859        116 SNARITFNRQASLLKTNYVSRQDYDTARTQLNEAEANVTVAKAAVEQATINLQYA  170 (385)
T ss_pred             HHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCE
T ss_conf             9999899999988765862354799899999999999999999998755321226


No 21 
>PRK10476 multidrug resistance protein MdtN; Provisional
Probab=95.54  E-value=0.16  Score=27.73  Aligned_cols=55  Identities=13%  Similarity=0.096  Sum_probs=23.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             7889999999999999999878765543234567776532223557989999998
Q gi|254780930|r  170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK  224 (452)
Q Consensus       170 ~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~~~~~~~l~~~~~  224 (452)
                      ++..+.-.+..++..+..++..+.+++.|.+++.++.+++..+..++..+..++.
T Consensus       121 a~a~~~~A~a~~~~a~~~~~R~~~L~~~g~vS~~~ld~a~~~~~~A~a~l~~a~~  175 (348)
T PRK10476        121 ANEQVERARANAKLATRTLERLEPLLAKGYVSAQQVDQARTAQRDAEVSLNQALL  175 (348)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999999999988766997999999999999999999999999


No 22 
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family; InterPro: IPR010129   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).    Type I secretion is an ABC transporter that exports proteins, without cleavage of any signal sequence, from the cytosol to extracellular medium across both inner and outer membranes. The secretion signal is found in the C terminus of the transported protein. This entry represents the adaptor protein between the ATP-binding cassette (ABC) protein of the inner membrane and the outer membrane protein, and is called the membrane fusion protein. This entry selects a group of sequences closely related to HlyD; it is defined narrowly and excludes, for example, colicin V secretion protein CvaA and multidrug efflux proteins.; GO: 0015031 protein transport, 0009276 1-2nm peptidoglycan-based cell wall, 0016021 integral to membrane.
Probab=95.53  E-value=0.16  Score=27.71  Aligned_cols=28  Identities=11%  Similarity=0.240  Sum_probs=12.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             2223557989999998568888768776
Q gi|254780930|r  209 EAEIKSIESDIPTLEKSFRMNVHNISTL  236 (452)
Q Consensus       209 ~~~~~~~~~~l~~~~~~~~~a~~~L~~l  236 (452)
                      ...+.+++.++..++..+..+..++...
T Consensus       252 ~~~l~~A~~~l~~~~~~l~~a~~~~~~~  279 (434)
T TIGR01843       252 LEELTEAQARLAELREELSKARDRLQRL  279 (434)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999999999875321


No 23 
>PRK11556 multidrug efflux system subunit MdtA; Provisional
Probab=95.34  E-value=0.15  Score=27.88  Aligned_cols=58  Identities=12%  Similarity=0.039  Sum_probs=47.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999878765543234567776532223557989999998568888768776
Q gi|254780930|r  179 QILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL  236 (452)
Q Consensus       179 ~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~~~~~~~l~~~~~~~~~a~~~L~~l  236 (452)
                      ..++.++..++..+.+++.|.+++.++..++..+..++..+..++..+..++.+|...
T Consensus       139 A~l~~A~~~~~R~~~L~~~~~iS~~~ld~~~a~~~~A~A~l~~a~a~l~~A~~~L~~t  196 (415)
T PRK11556        139 ATLANARRDLARYQQLAKTNLVSRQELDAQQALVSETEGTIKADEAAVASAQLQLDWS  196 (415)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             8999999999999998765995699999899999999999999999999998752488


No 24 
>PRK12698 flgH flagellar basal body L-ring protein; Reviewed
Probab=95.28  E-value=0.027  Score=32.78  Aligned_cols=21  Identities=38%  Similarity=0.661  Sum_probs=15.0

Q ss_pred             HHHHHHHHHHHHHHHCCCCCC
Q ss_conf             699999999999750268999
Q gi|254780930|r    4 LRAIFSLFIVLLAGCTVGPEY   24 (452)
Q Consensus         4 ~~~~~~l~~~~l~gC~~~p~~   24 (452)
                      +|.++++++++|+||+..|..
T Consensus         2 ~r~~l~~~~l~L~gCa~~~~~   22 (224)
T PRK12698          2 ARYILLALALLLAGCSSTPKK   22 (224)
T ss_pred             HHHHHHHHHHHHHCCCCCCCC
T ss_conf             779999999998365688988


No 25 
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed
Probab=95.13  E-value=0.21  Score=26.98  Aligned_cols=54  Identities=6%  Similarity=-0.016  Sum_probs=43.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999878765543234567776532223557989999998568888768776
Q gi|254780930|r  183 LYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL  236 (452)
Q Consensus       183 ~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~~~~~~~l~~~~~~~~~a~~~L~~l  236 (452)
                      .++..++..+.+++.|.+++.|+..++..+..++.++..++.++..++.+|...
T Consensus       119 ~A~~~~~R~~~L~~~~~is~~~~~~a~~~~~~a~a~l~~A~a~l~~A~~~l~~t  172 (385)
T PRK09578        119 AAADKRRRYDDLVRDRAVSERDHTEAVADERQAKAEVASAKAELARAQLQLDYA  172 (385)
T ss_pred             HHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             999999999998863663267899999999999999999999999888754103


No 26 
>PRK12701 flgH flagellar basal body L-ring protein; Reviewed
Probab=95.09  E-value=0.044  Score=31.41  Aligned_cols=21  Identities=38%  Similarity=0.464  Sum_probs=15.8

Q ss_pred             CCCHHHHH-HHHHHHHHHHCCC
Q ss_conf             93069999-9999999750268
Q gi|254780930|r    1 MNILRAIF-SLFIVLLAGCTVG   21 (452)
Q Consensus         1 M~~~~~~~-~l~~~~l~gC~~~   21 (452)
                      |+.|+.++ |+.+++|+||+..
T Consensus         1 m~r~~~~~~~la~~lL~GC~~~   22 (230)
T PRK12701          1 MNRLNIAVSCLATALLFGCEAL   22 (230)
T ss_pred             CCHHHHHHHHHHHHHHHCCCCC
T ss_conf             9258999999999997556688


No 27 
>PRK10760 murein hydrolase B; Provisional
Probab=94.29  E-value=0.21  Score=27.00  Aligned_cols=25  Identities=28%  Similarity=0.506  Sum_probs=13.9

Q ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             93069999999999975026899999
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTVGPEYTK   26 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~~p~~~~   26 (452)
                      |+.+-.+++ .+++|+||+..|....
T Consensus         1 ~r~~~~~~~-~~~~l~~css~p~~~~   25 (357)
T PRK10760          1 KRRYVTLLP-LFVLLAACSSKPKPTE   25 (357)
T ss_pred             CCCHHHHHH-HHHHHHHHCCCCCCCC
T ss_conf             940486899-9999998518999999


No 28 
>PRK00249 flgH flagellar basal body L-ring protein; Reviewed
Probab=94.01  E-value=0.11  Score=28.71  Aligned_cols=23  Identities=30%  Similarity=0.658  Sum_probs=16.0

Q ss_pred             CCCHHHHH-HHHHHHHHHHCCCCC
Q ss_conf             93069999-999999975026899
Q gi|254780930|r    1 MNILRAIF-SLFIVLLAGCTVGPE   23 (452)
Q Consensus         1 M~~~~~~~-~l~~~~l~gC~~~p~   23 (452)
                      |++++..+ ++++++|+||+..|.
T Consensus         1 ~~~~~~~~~~~~~~~LsgCa~~~~   24 (231)
T PRK00249          1 MAMMLIALALLLLLLLSGCASIPP   24 (231)
T ss_pred             CCCHHHHHHHHHHHHHHHCCCCCC
T ss_conf             933899999999999875348999


No 29 
>PRK12696 flgH flagellar basal body L-ring protein; Reviewed
Probab=93.70  E-value=0.13  Score=28.42  Aligned_cols=28  Identities=25%  Similarity=0.528  Sum_probs=14.7

Q ss_pred             HHHH-HHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             9999-999999975026899999995647
Q gi|254780930|r    5 RAIF-SLFIVLLAGCTVGPEYTKPHMPLL   32 (452)
Q Consensus         5 ~~~~-~l~~~~l~gC~~~p~~~~p~~~~~   32 (452)
                      |.++ .+++++|+||+..++...|..+..
T Consensus         4 ~~l~~~~~~~~L~GC~~~~~~~~~~~~~~   32 (238)
T PRK12696          4 KLLAASCAVLLLSGCNAARQQPSPLPPVT   32 (238)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             99999999999516568888888889988


No 30 
>PRK11023 hypothetical protein; Provisional
Probab=93.59  E-value=0.066  Score=30.23  Aligned_cols=64  Identities=22%  Similarity=0.271  Sum_probs=33.9

Q ss_pred             CCCHHHHHHHHH-HHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCHHHHHHHHHHHHHCHHHH
Q ss_conf             930699999999-9997502689999999564750102467766667686234366099879999999997089989
Q gi|254780930|r    1 MNILRAIFSLFI-VLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTIL   76 (452)
Q Consensus         1 M~~~~~~~~l~~-~~l~gC~~~p~~~~p~~~~~~~~~~~~~~~~~~~~~~~~ww~~~~d~~L~~~i~~Al~~np~l~   76 (452)
                      ||.++.++++++ ++|+||+.. -     ....... ..     ....+....-..++|..+.--|..++..+++++
T Consensus         1 mk~~~~l~~l~~~~~L~GC~~~-~-----i~g~a~~-~~-----~~a~d~Rs~g~~~dD~~I~~~i~~~l~~~~~~~   65 (191)
T PRK11023          1 MKALSPLAVLISALLLQGCVAA-A-----VVGTAAV-AT-----KVATDPRSVGTQVDDGTLEERVNNALSKDEQIK   65 (191)
T ss_pred             CCHHHHHHHHHHHHHHCCCHHH-E-----EECCCCE-EE-----EEEECCCCCCEEEECHHHHHHHHHHHHCCCCCC
T ss_conf             9448899999999997268233-1-----5124202-57-----775179860307742989999999974281001


No 31 
>PRK00022 lolB outer membrane lipoprotein LolB; Provisional
Probab=93.33  E-value=0.082  Score=29.61  Aligned_cols=22  Identities=36%  Similarity=0.522  Sum_probs=13.9

Q ss_pred             CCHHHHHHHHHHHHHHHCCCCC
Q ss_conf             3069999999999975026899
Q gi|254780930|r    2 NILRAIFSLFIVLLAGCTVGPE   23 (452)
Q Consensus         2 ~~~~~~~~l~~~~l~gC~~~p~   23 (452)
                      ..+..++++++++|+||++.|.
T Consensus         2 ~r~~~~l~~~~llLsgCat~p~   23 (203)
T PRK00022          2 FRLLRLLPLAALLLAGCASLPP   23 (203)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCC
T ss_conf             0638999999999866148999


No 32 
>PRK13616 lipoprotein LpqB; Provisional
Probab=92.44  E-value=0.33  Score=25.65  Aligned_cols=29  Identities=31%  Similarity=0.534  Sum_probs=18.7

Q ss_pred             CCCHHHHH--HHHHHHHHHHCCCCCCCCCCC
Q ss_conf             93069999--999999975026899999995
Q gi|254780930|r    1 MNILRAIF--SLFIVLLAGCTVGPEYTKPHM   29 (452)
Q Consensus         1 M~~~~~~~--~l~~~~l~gC~~~p~~~~p~~   29 (452)
                      |++||.+.  ++++++|+||+..|.-..|..
T Consensus         3 ~~~~~~~~~~~~~~~llaGCaslP~ss~pq~   33 (590)
T PRK13616          3 MTRLKALAALLAVALLVAGCASLPSSSAPQA   33 (590)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             8999999999999998612036899999723


No 33 
>PRK12700 flgH flagellar basal body L-ring protein; Reviewed
Probab=92.11  E-value=0.22  Score=26.78  Aligned_cols=21  Identities=33%  Similarity=0.567  Sum_probs=12.7

Q ss_pred             CHHHHHHHHH-HHHHHHCCCCC
Q ss_conf             0699999999-99975026899
Q gi|254780930|r    3 ILRAIFSLFI-VLLAGCTVGPE   23 (452)
Q Consensus         3 ~~~~~~~l~~-~~l~gC~~~p~   23 (452)
                      ++|+.+++++ ++|+||+..|+
T Consensus         6 ~~Rl~~~~~~~~ll~GCa~~~~   27 (230)
T PRK12700          6 VLRLPVCAALLALAAGCAMIPP   27 (230)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCC
T ss_conf             9999999999999744468999


No 34 
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily; InterPro: IPR014345   Members of this entry belong to the family of polysaccharide chain length determinant proteins. They are found in species that encode the PEP-CTERM/exosortase system and are predicted to act in protein sorting in a number of Gram-negative bacteria, they are also found near the epsH homologue that is the putative exosortase gene..
Probab=91.93  E-value=0.77  Score=23.25  Aligned_cols=218  Identities=12%  Similarity=0.100  Sum_probs=94.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH
Q ss_conf             677788999999999999999987876554323-----456777653222355798999999856888876877639992
Q gi|254780930|r  167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGA-----TSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPA  241 (452)
Q Consensus       167 ~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~-----~~~~d~~~a~~~~~~~~~~l~~~~~~~~~a~~~L~~l~G~~~  241 (452)
                      .-...+|++..++.++.+++.++.-+...-..+     .=..++..++.++..++..+..+++.++..+.+|.   |..|
T Consensus       163 ~rFi~~Qik~Y~~kL~~aE~~L~~FK~~~~~~lp~~~~~y~~~l~~~~~~L~~~~l~~~e~~~~Rd~l~rQL~---g~~P  239 (510)
T TIGR03007       163 QRFIDEQIKEYEKKLEAAENRLKAFKQENGGILPDQEGDYYSELSEAQEELEAARLELNEAKAQRDALKRQLA---GEEP  239 (510)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC---CCCC
T ss_conf             9999999999999999999999987687345377973789999999999999999999988876788751458---8661


Q ss_pred             HHHCCCCC-CCCCCCCCCHHHHH---CCC---CHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCCCCCCC
Q ss_conf             13000123-45544331001221---048---878997302345565558999964301011222210011222211223
Q gi|254780930|r  242 TEFLHYMQ-KQSNNFQPNLYIPI---NIG---IPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD  314 (452)
Q Consensus       242 ~~~~~~~~-~~~~~~~~~~~~~~---~~~---~~~~~l~~RPdi~~a~~~~~~a~~~i~~a~a~~~P~i~l~~~~~~~~~  314 (452)
                      --...... .......+....-+   ...   +-..-.++||||.+.+..++.-+.+...+-..+.-.     ..+....
T Consensus       240 v~~~~~g~~~~~s~~~~~~~~Ri~~L~~~Ld~L~l~YTd~HPdv~~~k~~Ia~L~~~~~~e~~~~~~Q-----~~~~~~~  314 (510)
T TIGR03007       240 VLLAGSGEKSASSVANSELDSRIEALEKQLDALRLRYTDKHPDVIATKREIAQLEEQKEEELESYRKQ-----NGEGGGS  314 (510)
T ss_pred             EEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH-----CCCCCCC
T ss_conf             56236888665312356256899999999998633630115589999999999999988999889873-----0345555


Q ss_pred             CCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             44544541044311223451012456656779999999999999999999999999999999999999999999999999
Q gi|254780930|r  315 NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHK  394 (452)
Q Consensus       315 ~~~~~~~~~~~~g~~l~~Pif~gg~~~a~i~~a~~~~~~a~~~~~~~~~~a~~ev~~a~~~~~~~~~~~~~~~~~~~~a~  394 (452)
                      ......           =|++.  ..+-.+..++++.........+- ..-..+-++....+-.-...+..+.+..+..+
T Consensus       315 ~~~~~~-----------nPvyQ--ql~~~l~~~eA~~asl~~r~~~~-~~~~~~l~~~~~~iP~veaEl~~L~rdy~~~k  380 (510)
T TIGR03007       315 EKGSIY-----------NPVYQ--QLQIELAEAEAEIASLEARVAEL-TARIERLESLLRTIPEVEAELTQLNRDYEVNK  380 (510)
T ss_pred             CCCCCC-----------CCHHH--HHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             566789-----------83137--78999999999999999999999-99999999997532799999999998875558


Q ss_pred             HHHHHHHHHHHC
Q ss_conf             999999999871
Q gi|254780930|r  395 KSMSLSMINYRQ  406 (452)
Q Consensus       395 ~~~~~~~~~y~~  406 (452)
                      ..|+.-..|++.
T Consensus       381 ~~Ye~Ll~R~e~  392 (510)
T TIGR03007       381 SNYEQLLARRES  392 (510)
T ss_pred             HHHHHHHHHHHH
T ss_conf             889999988985


No 35 
>PRK11578 macrolide transporter subunit MacA; Provisional
Probab=91.31  E-value=0.9  Score=22.83  Aligned_cols=65  Identities=17%  Similarity=0.171  Sum_probs=44.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             88999999999999999987876554323456777653222355798999999856888876877
Q gi|254780930|r  171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIST  235 (452)
Q Consensus       171 ~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~~~~~~~l~~~~~~~~~a~~~L~~  235 (452)
                      +..+.-.+..++..+..++..+.+++.|.+++.++.+++.++...+.++..++.++..++..|..
T Consensus        89 ~a~l~~a~~~~~~a~~~~~r~~~L~~~~~is~~~~d~a~~~~~~~~a~l~~~~a~~~~~~a~l~~  153 (347)
T PRK11578         89 NAQRQQAEAELKLARVTLSRQQRLAKTQAVSQQDLDTAATEMAVKQAQIGTIDAQIKRNQASLDT  153 (347)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999998999999999987576247889887879998764588999999999999999


No 36 
>COG3417 FlgN Collagen-binding surface adhesin SpaP (antigen I/II family) [General function prediction only]
Probab=91.09  E-value=0.31  Score=25.81  Aligned_cols=20  Identities=25%  Similarity=0.584  Sum_probs=13.8

Q ss_pred             CCCHHHHH--HHHHHHHHHHCC
Q ss_conf             93069999--999999975026
Q gi|254780930|r    1 MNILRAIF--SLFIVLLAGCTV   20 (452)
Q Consensus         1 M~~~~~~~--~l~~~~l~gC~~   20 (452)
                      |++++.+.  ++..++|+||+.
T Consensus         1 mtk~k~~~~il~~al~l~GCs~   22 (200)
T COG3417           1 MTKMKIYASILLLALFLSGCSS   22 (200)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCC
T ss_conf             9257999999999999841136


No 37 
>PRK12788 flgH flagellar basal body L-ring protein; Reviewed
Probab=90.94  E-value=0.43  Score=24.95  Aligned_cols=18  Identities=28%  Similarity=0.331  Sum_probs=11.8

Q ss_pred             HHHHHHHHHHHHHHCCCC
Q ss_conf             999999999997502689
Q gi|254780930|r    5 RAIFSLFIVLLAGCTVGP   22 (452)
Q Consensus         5 ~~~~~l~~~~l~gC~~~p   22 (452)
                      ..+.++++++|+||+..+
T Consensus         3 ~l~~~~a~l~LsGCa~~~   20 (231)
T PRK12788          3 LLVAILACLALAGCANNL   20 (231)
T ss_pred             HHHHHHHHHHHHHHCCCC
T ss_conf             899999999976403874


No 38 
>pfam06474 MLTD_N MLTD_N.
Probab=90.53  E-value=0.42  Score=24.99  Aligned_cols=19  Identities=21%  Similarity=0.335  Sum_probs=12.0

Q ss_pred             HHHHHHHHHHHHCCCCCCC
Q ss_conf             9999999997502689999
Q gi|254780930|r    7 IFSLFIVLLAGCTVGPEYT   25 (452)
Q Consensus         7 ~~~l~~~~l~gC~~~p~~~   25 (452)
                      .+++++++|+||.+.+...
T Consensus         5 ail~~alLLaGCQst~~~~   23 (93)
T pfam06474         5 AVLAAALLLVGCQSTQAVS   23 (93)
T ss_pred             HHHHHHHHHHHHCCCCCCC
T ss_conf             9999999999813799999


No 39 
>COG3065 Slp Starvation-inducible outer membrane lipoprotein [Cell envelope biogenesis, outer membrane]
Probab=90.23  E-value=0.3  Score=25.93  Aligned_cols=25  Identities=32%  Similarity=0.562  Sum_probs=15.9

Q ss_pred             CCCH-HHHHHHHHHHHHHHCCCCCCC
Q ss_conf             9306-999999999997502689999
Q gi|254780930|r    1 MNIL-RAIFSLFIVLLAGCTVGPEYT   25 (452)
Q Consensus         1 M~~~-~~~~~l~~~~l~gC~~~p~~~   25 (452)
                      |++. ..+++.++++|+||++.|+.-
T Consensus         5 m~~~~~~l~~~laflLsgC~tiPk~l   30 (191)
T COG3065           5 MNMKKGALIGTLAFLLSGCVTIPKAL   30 (191)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCHHH
T ss_conf             76479999999999976303578312


No 40 
>PRK12407 flgH flagellar basal body L-ring protein; Reviewed
Probab=89.16  E-value=0.59  Score=24.00  Aligned_cols=17  Identities=24%  Similarity=0.579  Sum_probs=11.5

Q ss_pred             HHHHHHHHHHHHHCCCC
Q ss_conf             99999999997502689
Q gi|254780930|r    6 AIFSLFIVLLAGCTVGP   22 (452)
Q Consensus         6 ~~~~l~~~~l~gC~~~p   22 (452)
                      +++.+++++|+||+..+
T Consensus         4 l~l~~~~l~LsGC~~~~   20 (220)
T PRK12407          4 LILTPMVLALCGCESPA   20 (220)
T ss_pred             HHHHHHHHHHHCCCCCC
T ss_conf             79999999973658888


No 41 
>PRK12699 flgH flagellar basal body L-ring protein; Reviewed
Probab=88.77  E-value=0.78  Score=23.23  Aligned_cols=21  Identities=19%  Similarity=0.657  Sum_probs=14.0

Q ss_pred             CHHHHHHHHHHHHHHHCCCCC
Q ss_conf             069999999999975026899
Q gi|254780930|r    3 ILRAIFSLFIVLLAGCTVGPE   23 (452)
Q Consensus         3 ~~~~~~~l~~~~l~gC~~~p~   23 (452)
                      .|..++++++++|+||+..|+
T Consensus        18 ~~~~~~~~~~~~l~gC~~~~~   38 (246)
T PRK12699         18 LLGPVLIVMLALVGGCSLPTP   38 (246)
T ss_pred             HHHHHHHHHHHHHCCCCCCCC
T ss_conf             488899999998604468999


No 42 
>PRK12697 flgH flagellar basal body L-ring protein; Reviewed
Probab=88.31  E-value=0.89  Score=22.84  Aligned_cols=19  Identities=37%  Similarity=0.525  Sum_probs=12.6

Q ss_pred             HHHHHHHHHHHHHHCCCCC
Q ss_conf             9999999999975026899
Q gi|254780930|r    5 RAIFSLFIVLLAGCTVGPE   23 (452)
Q Consensus         5 ~~~~~l~~~~l~gC~~~p~   23 (452)
                      ..+..+.+++|+||+..|.
T Consensus        11 ~~~~al~~l~LsGCa~~~~   29 (227)
T PRK12697         11 AAACALAALALAGCAQIPR   29 (227)
T ss_pred             HHHHHHHHHHHHCCCCCCC
T ss_conf             8999999999726567899


No 43 
>PRK10866 outer membrane protein assembly complex subunit YfiO; Provisional
Probab=88.29  E-value=0.53  Score=24.32  Aligned_cols=21  Identities=24%  Similarity=0.566  Sum_probs=14.4

Q ss_pred             CCCHHHHHHH--HHHHHHHHCCC
Q ss_conf             9306999999--99999750268
Q gi|254780930|r    1 MNILRAIFSL--FIVLLAGCTVG   21 (452)
Q Consensus         1 M~~~~~~~~l--~~~~l~gC~~~   21 (452)
                      |+.++.++++  ++++|+||+..
T Consensus         1 m~~~k~l~~~~~l~l~l~gCs~~   23 (243)
T PRK10866          1 MTRMKYLVAAATLSLFLAGCSGS   23 (243)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCC
T ss_conf             94589999999999999876899


No 44 
>pfam07901 DUF1672 Protein of unknown function (DUF1672). This family is composed of hypothetical bacterial proteins of unknown function.
Probab=87.70  E-value=0.43  Score=24.89  Aligned_cols=24  Identities=25%  Similarity=0.445  Sum_probs=16.9

Q ss_pred             CCCHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             930699999999999750268999
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTVGPEY   24 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~~p~~   24 (452)
                      |+.+-.++++.+++|+||+..+.-
T Consensus         1 MkK~i~~il~~~llL~GCs~mn~~   24 (304)
T pfam07901         1 MRKLIKLILIATLLLSGCSTTNNE   24 (304)
T ss_pred             CCHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             901899999999997133445554


No 45 
>PRK11443 hypothetical protein; Provisional
Probab=87.69  E-value=0.48  Score=24.62  Aligned_cols=26  Identities=27%  Similarity=0.616  Sum_probs=18.7

Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             69999999999975026899999995
Q gi|254780930|r    4 LRAIFSLFIVLLAGCTVGPEYTKPHM   29 (452)
Q Consensus         4 ~~~~~~l~~~~l~gC~~~p~~~~p~~   29 (452)
                      +++++.+++++|+||...|...+|..
T Consensus         2 k~~~~~~~~lll~GCq~~p~t~ap~~   27 (120)
T PRK11443          2 KKFIAPLLALLVSGCQIDPYTHAPTL   27 (120)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             15899999999966678962468655


No 46 
>COG4764 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=86.87  E-value=0.47  Score=24.68  Aligned_cols=20  Identities=35%  Similarity=0.974  Sum_probs=16.6

Q ss_pred             CHHHHHHHHHHHHHHHCCCC
Q ss_conf             06999999999997502689
Q gi|254780930|r    3 ILRAIFSLFIVLLAGCTVGP   22 (452)
Q Consensus         3 ~~~~~~~l~~~~l~gC~~~p   22 (452)
                      +||.+++..+++|+||++.|
T Consensus         5 ~~r~~~~v~lL~LagCaTaP   24 (197)
T COG4764           5 MMRLVFAVVLLALAGCATAP   24 (197)
T ss_pred             HHHHHHHHHHHHHHHCCCCC
T ss_conf             69899999999970303687


No 47 
>PRK11138 outer membrane protein assembly complex subunit YfgL; Provisional
Probab=86.84  E-value=0.94  Score=22.71  Aligned_cols=21  Identities=24%  Similarity=0.534  Sum_probs=14.4

Q ss_pred             CCCHHHHHHH--HHHHHHHHCCC
Q ss_conf             9306999999--99999750268
Q gi|254780930|r    1 MNILRAIFSL--FIVLLAGCTVG   21 (452)
Q Consensus         1 M~~~~~~~~l--~~~~l~gC~~~   21 (452)
                      |+.+|.++.+  ++++|+||+..
T Consensus         1 ~~~~~~~~~~l~~~~ll~gCs~~   23 (394)
T PRK11138          1 MQLRKLLLPGLLSVALLSGCSLF   23 (394)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCC
T ss_conf             95167799999999998652378


No 48 
>PRK11627 hypothetical protein; Provisional
Probab=86.48  E-value=0.56  Score=24.15  Aligned_cols=19  Identities=32%  Similarity=0.847  Sum_probs=12.1

Q ss_pred             HHHHH-HHHHHHHHHCCCCC
Q ss_conf             99999-99999975026899
Q gi|254780930|r    5 RAIFS-LFIVLLAGCTVGPE   23 (452)
Q Consensus         5 ~~~~~-l~~~~l~gC~~~p~   23 (452)
                      +.+++ +.+++|+||+..|.
T Consensus         4 k~~~~l~a~~lL~gCas~p~   23 (192)
T PRK11627          4 KILFPLVALFMLAGCATPPT   23 (192)
T ss_pred             HHHHHHHHHHHHHHHCCCCC
T ss_conf             79999999999986069976


No 49 
>PRK10796 LPS-assembly lipoprotein RlpB; Provisional
Probab=86.32  E-value=1.3  Score=21.87  Aligned_cols=21  Identities=33%  Similarity=0.594  Sum_probs=15.2

Q ss_pred             CCCHHHHH-HHHHHHHHHHCCC
Q ss_conf             93069999-9999999750268
Q gi|254780930|r    1 MNILRAIF-SLFIVLLAGCTVG   21 (452)
Q Consensus         1 M~~~~~~~-~l~~~~l~gC~~~   21 (452)
                      |+.++.++ .+++++++||-+.
T Consensus         1 ~r~l~~l~l~lavll~agCGFh   22 (196)
T PRK10796          1 MRYLATLLLSLAVLVTAGCGWH   22 (196)
T ss_pred             CHHHHHHHHHHHHHHHCCCCCE
T ss_conf             9569999999999997476715


No 50 
>PRK10802 peptidoglycan-associated outer membrane lipoprotein; Provisional
Probab=86.09  E-value=1.7  Score=20.96  Aligned_cols=21  Identities=19%  Similarity=0.518  Sum_probs=12.7

Q ss_pred             HHHHH-HHHHHHHHHHCCCCCC
Q ss_conf             69999-9999999750268999
Q gi|254780930|r    4 LRAIF-SLFIVLLAGCTVGPEY   24 (452)
Q Consensus         4 ~~~~~-~l~~~~l~gC~~~p~~   24 (452)
                      +|.++ .+.+++|+||+..+..
T Consensus         7 ~K~l~ia~~~l~LaACSS~~~~   28 (173)
T PRK10802          7 LKGLMIALPVMAIAACSSNKNA   28 (173)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCC
T ss_conf             9999999999999855799988


No 51 
>COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms]
Probab=85.57  E-value=2.2  Score=20.33  Aligned_cols=60  Identities=17%  Similarity=0.160  Sum_probs=38.9

Q ss_pred             HHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6666777889999999-99999999987876554323456777653222355798999999
Q gi|254780930|r  164 YIDARHFKERISIAHQ-ILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE  223 (452)
Q Consensus       164 Y~~~~~~~~~~~i~~~-~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~~~~~~~l~~~~  223 (452)
                      ..++...+..++-.+. .+...+...+......+.|.++..++..++..+..++..+..++
T Consensus       111 ~a~~~~~~A~i~~a~a~~l~~a~~~~~R~~~L~~~g~vs~~~~~~a~~a~~~A~A~~~~a~  171 (352)
T COG1566         111 RAQLASAQALIAQAEAQDLDQAQNELERRAELAQRGVVSREELDRARAALQAAEAALAAAQ  171 (352)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             8788888889999998999998988899998875674439999988889999988887768


No 52 
>PRK09967 putative outer membrane lipoprotein; Provisional
Probab=85.55  E-value=0.59  Score=24.03  Aligned_cols=22  Identities=23%  Similarity=0.389  Sum_probs=13.5

Q ss_pred             CCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             9306999999999997502689
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTVGP   22 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~~p   22 (452)
                      ||.+...+++++++|+||+..+
T Consensus         2 ~k~~~~~~l~~~l~lsgC~s~~   23 (160)
T PRK09967          2 IKHLVAPLIFTSLILTGCQSPQ   23 (160)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCC
T ss_conf             0789999999999998458999


No 53 
>pfam06572 DUF1131 Protein of unknown function (DUF1131). This family consists of several hypothetical bacterial proteins of unknown function.
Probab=85.50  E-value=0.91  Score=22.80  Aligned_cols=71  Identities=14%  Similarity=0.165  Sum_probs=35.4

Q ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCC-HHHHHHHHHHHHHCHHHHH
Q ss_conf             9306999999999997502689999999564750102467766667686234366099-8799999999970899899
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFND-TSLNKLVKIALQQNLTILQ   77 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~~p~~~~p~~~~~~~~~~~~~~~~~~~~~~~~ww~~~~d-~~L~~~i~~Al~~np~l~~   77 (452)
                      |+.+|..++...++|+||++...+.=.+.  .|-.|=.....-..  ....  ..-.+ |--+++|..+|.....|+.
T Consensus         1 ~~~~r~~l~~~~llL~GCst~s~fsWSsl--sP~nWFgssl~Vs~--~GVG--~Ita~Tpm~e~aI~~~L~g~Y~lRs   72 (192)
T pfam06572         1 MKSLRLFLLALPLLLTGCSTLSNFSWSSL--SPWNWFGSSLEVTE--QGVG--GITAGTPLNEGAIEDALDGDYRLRS   72 (192)
T ss_pred             CCCHHHHHHHHHHHHHCCCCCCCCCCCCC--CCCCCCCCCEEEEC--CCCC--CCCCCCCCCHHHHHHHHCCCCEECC
T ss_conf             94301368776688606556688542226--87220378428832--6535--2125783688999987589746636


No 54 
>TIGR03352 VI_chp_3 type VI secretion lipoprotein, VC_A0113 family. Work by Mougous, et al. (2006), describes IAHP-related loci as a type VI secretion system (PMID:16763151). This protein family is associated with type VI secretion loci, although not treated explicitly by Mougous, et al.
Probab=85.10  E-value=0.52  Score=24.38  Aligned_cols=24  Identities=33%  Similarity=0.577  Sum_probs=15.5

Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             999999999997502689999999
Q gi|254780930|r    5 RAIFSLFIVLLAGCTVGPEYTKPH   28 (452)
Q Consensus         5 ~~~~~l~~~~l~gC~~~p~~~~p~   28 (452)
                      +.++++++++|+||+..|....|.
T Consensus         3 ~~~~l~~~lllagC~s~~~~~~~~   26 (146)
T TIGR03352         3 FAVLLAACLLLAGCSSAPPPKEPT   26 (146)
T ss_pred             EEHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             755899999985325999988874


No 55 
>PRK10718 hypothetical protein; Provisional
Probab=84.66  E-value=0.73  Score=23.41  Aligned_cols=71  Identities=17%  Similarity=0.174  Sum_probs=35.6

Q ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCC-HHHHHHHHHHHHHCHHHHH
Q ss_conf             9306999999999997502689999999564750102467766667686234366099-8799999999970899899
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFND-TSLNKLVKIALQQNLTILQ   77 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~~p~~~~p~~~~~~~~~~~~~~~~~~~~~~~~ww~~~~d-~~L~~~i~~Al~~np~l~~   77 (452)
                      |+.+|.+++-..++|+||+....+.=.+.  .|-.|=.....-..  ....  ..-.+ |--+++|..||.....|+.
T Consensus         1 ~~~lr~~l~~~~llLsGCst~s~~sWSsl--~P~nWFgs~l~vs~--~GVG--~Ita~Tpm~e~aI~~aL~g~Y~lRs   72 (191)
T PRK10718          1 MKSLRLLLLALPLLLTGCSTMSSVNWSAA--NPWNWFGSSTKVSE--QGVG--EITASTPLQEQAIADALDGDYRLRS   72 (191)
T ss_pred             CCCCCCHHHHHHHHHHCCCCCCCCCCCCC--CCCCCCCCCEEEEC--CCCC--CCCCCCCCCHHHHHHHHCCCCEECC
T ss_conf             98531023122476406566688642236--86111388338842--6534--3135883678999987489736636


No 56 
>COG3317 NlpB Uncharacterized lipoprotein [Cell envelope biogenesis, outer membrane]
Probab=84.37  E-value=0.89  Score=22.85  Aligned_cols=30  Identities=27%  Similarity=0.563  Sum_probs=19.5

Q ss_pred             CCCHHH-HH-HHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             930699-99-9999999750268999999956
Q gi|254780930|r    1 MNILRA-IF-SLFIVLLAGCTVGPEYTKPHMP   30 (452)
Q Consensus         1 M~~~~~-~~-~l~~~~l~gC~~~p~~~~p~~~   30 (452)
                      |+.++. ++ .+++++|+||++.+.+.++...
T Consensus         1 ~k~~~~lv~~al~v~~LaaCSs~~~~~~q~~d   32 (342)
T COG3317           1 MKSSAKLVLGALLVLLLAACSSDSEYKRQVSD   32 (342)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             91178899999999987414688500033445


No 57 
>PRK10781 rcsF outer membrane lipoprotein; Reviewed
Probab=83.66  E-value=1.6  Score=21.18  Aligned_cols=17  Identities=24%  Similarity=0.548  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHHHCCC
Q ss_conf             99999999999750268
Q gi|254780930|r    5 RAIFSLFIVLLAGCTVG   21 (452)
Q Consensus         5 ~~~~~l~~~~l~gC~~~   21 (452)
                      .+.+++++++|+||++.
T Consensus         3 ~lpi~llal~ltGCs~l   19 (133)
T PRK10781          3 ALPICLLALMLTGCSML   19 (133)
T ss_pred             HHHHHHHHHHHHCCCCC
T ss_conf             08999999998431344


No 58 
>pfam03304 Mlp Mlp lipoprotein family. The Mlp (for Multicopy Lipoprotein) family of lipoproteins is found in Borrelia species. This family were previously known as 2.9 lipoprotein genes. These surface expressed genes may represent new candidate vaccinogens for Lyme disease. Members of this family generally are downstream of four ORFs called A,B,C and D that are involved in hemolytic activity.
Probab=83.47  E-value=0.63  Score=23.84  Aligned_cols=20  Identities=40%  Similarity=1.016  Sum_probs=18.4

Q ss_pred             CCCHHHHHHHHHHHHHHHCC
Q ss_conf             93069999999999975026
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTV   20 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~   20 (452)
                      |++.-++||+++++|.||-.
T Consensus         1 MKIINilfclfll~Ln~Cns   20 (150)
T pfam03304         1 MKIINILFCLFLLMLNGCNS   20 (150)
T ss_pred             CCEEHHHHHHHHHHHCCCCC
T ss_conf             94314999999999826567


No 59 
>TIGR00752 slp outer membrane lipoprotein, Slp family; InterPro: IPR004658 Slp superfamily members are present in the Gram-negative gamma proteobacteria Escherichia coli (which also contains a close paralog), Haemophilus influenzae and Pasteurella multocida and Vibrio cholerae. The known members of the family to date share a motif LX[GA]C near the N-terminus, which is compatible with the possibility that the protein is modified into a lipoprotein with Cys as the new N-terminus. Slp from E. coli is known to be a lipoprotein of the outer membrane and to be expressed in response to carbon starvation.; GO: 0019867 outer membrane.
Probab=81.99  E-value=1.5  Score=21.44  Aligned_cols=36  Identities=22%  Similarity=0.513  Sum_probs=20.3

Q ss_pred             CCHHHHH-HHHHHHHHHHCCCCCCCCCCC-CCCCCCCC
Q ss_conf             3069999-999999975026899999995-64750102
Q gi|254780930|r    2 NILRAIF-SLFIVLLAGCTVGPEYTKPHM-PLLPTQFS   37 (452)
Q Consensus         2 ~~~~~~~-~l~~~~l~gC~~~p~~~~p~~-~~~~~~~~   37 (452)
                      |+.+.++ +.++++|+||...|+.-.-+. |.....+.
T Consensus         1 ~~~~g~l~~~l~f~L~gC~~~P~~ikg~~qP~~~~s~v   38 (190)
T TIGR00752         1 NVKKGLLITALAFLLTGCIAVPKAIKGERQPFSQKSYV   38 (190)
T ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHH
T ss_conf             92014568889988753146742345567986200232


No 60 
>TIGR02747 TraV type IV conjugative transfer system protein TraV; InterPro: IPR014118   This entry includes TraV, which is a component of conjugative type IV secretion system. TraV is an outer membrane lipoprotein that is believed to interact with the secretin TraK , , . The alignment contains three conserved cysteines in the N-terminal half..
Probab=81.10  E-value=0.98  Score=22.59  Aligned_cols=20  Identities=40%  Similarity=0.692  Sum_probs=13.7

Q ss_pred             CCCHHHHHHHHHH--HHHHHCC
Q ss_conf             9306999999999--9975026
Q gi|254780930|r    1 MNILRAIFSLFIV--LLAGCTV   20 (452)
Q Consensus         1 M~~~~~~~~l~~~--~l~gC~~   20 (452)
                      |+.++.+++++++  +|+|||.
T Consensus         1 Mmr~~~L~~~~~~~f~LtGCsa   22 (174)
T TIGR02747         1 MMRLKVLLLLACVAFLLTGCSA   22 (174)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHH
T ss_conf             9067899999999872002577


No 61 
>PRK10783 mltD membrane-bound lytic murein transglycosylase D; Provisional
Probab=80.94  E-value=3.3  Score=19.14  Aligned_cols=26  Identities=31%  Similarity=0.505  Sum_probs=16.0

Q ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             9306999999999997502689999999
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTVGPEYTKPH   28 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~~p~~~~p~   28 (452)
                      ||.  .++++..++|+||...+....|.
T Consensus         1 mk~--~~~l~~~~ll~gcq~~~~~~~~~   26 (449)
T PRK10783          1 MKA--KAILLASVLLVGCQSSKNDAQPQ   26 (449)
T ss_pred             CCH--HHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             918--99999999997255788888887


No 62 
>PRK11372 lysozyme inhibitor; Provisional
Probab=80.78  E-value=1.6  Score=21.25  Aligned_cols=21  Identities=29%  Similarity=0.551  Sum_probs=15.6

Q ss_pred             CCCHHHHHHHHHHHHHHHCCC
Q ss_conf             930699999999999750268
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTVG   21 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~~   21 (452)
                      |-|++.++....++|+||+.-
T Consensus         1 ~~MKkll~~~~~llLsGCs~~   21 (109)
T PRK11372          1 MSMKKLLIICLPVLLTGCSAY   21 (109)
T ss_pred             CCHHHHHHHHHHHHHHCCCCC
T ss_conf             954889999999997045432


No 63 
>PRK13613 lipoprotein LpqB; Provisional
Probab=80.49  E-value=2.3  Score=20.19  Aligned_cols=24  Identities=33%  Similarity=0.321  Sum_probs=15.9

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             999999999975026899999995
Q gi|254780930|r    6 AIFSLFIVLLAGCTVGPEYTKPHM   29 (452)
Q Consensus         6 ~~~~l~~~~l~gC~~~p~~~~p~~   29 (452)
                      .+..|++++|+||+..|.-..+..
T Consensus         5 ~~~~~~~vllaGCasiP~sg~v~~   28 (603)
T PRK13613          5 AYTGCGAVLLAGCASMPDSGDLRG   28 (603)
T ss_pred             HHHHHHHHEEECCCCCCCCCCCCC
T ss_conf             654524402101136999999634


No 64 
>TIGR03017 EpsF chain length determinant protein EpsF. Sequences in this family of proteins are members of the chain length determinant family (pfam02706) which includes the wzc protein from E.coli. This family of proteins are homologous to the EpsF protein of the methanolan biosynthesis operon of Methylobacillus species strain 12S. The distribution of this protein appears to be restricted to a subset of exopolysaccharide operons containing a syntenic grouping of genes including a variant of the EpsH exosortase protein. Exosortase has been proposed to be involved in the targetting and processing of proteins containing the PEP-CTERM domain to the exopolysaccharide layer.
Probab=80.17  E-value=3.5  Score=18.98  Aligned_cols=63  Identities=10%  Similarity=0.111  Sum_probs=28.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             78899999999999999998787655432345677765-322235579899999985688887687
Q gi|254780930|r  170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVK-LEAEIKSIESDIPTLEKSFRMNVHNIS  234 (452)
Q Consensus       170 ~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~-a~~~~~~~~~~l~~~~~~~~~a~~~L~  234 (452)
                      ..+++.-.+..++..+..+...+.  +.|.++..+-.. ...++.....++..++.+...+.....
T Consensus       176 l~~ql~~~~~~l~~~e~~l~~f~~--~~~~~~~~~~~~~~~~~l~~l~~~l~~~~~~~~~~~~~~~  239 (444)
T TIGR03017       176 FVQQIAALREDLARAQSKLSAYQQ--EKGIVSSDERLDVERARLNELSAQLVAAQAQVMDASSKEG  239 (444)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH--HCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999999999--7598684014448999999999999999999999999975


No 65 
>COG4259 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=80.05  E-value=1.6  Score=21.14  Aligned_cols=23  Identities=39%  Similarity=0.689  Sum_probs=14.9

Q ss_pred             CCCHHHHH----HHHHHHHHHHCCCCC
Q ss_conf             93069999----999999975026899
Q gi|254780930|r    1 MNILRAIF----SLFIVLLAGCTVGPE   23 (452)
Q Consensus         1 M~~~~~~~----~l~~~~l~gC~~~p~   23 (452)
                      |..++.+.    ++.+++|+||..+|.
T Consensus         1 M~~~ktlsr~al~~av~~LagC~~gpK   27 (121)
T COG4259           1 MSKLKTLSRLALLLAVAALAGCGGGPK   27 (121)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             951488999999999999988057986


No 66 
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family; InterPro: IPR014315   Members of this protein are found mostly in the Cyanobacteria, but also in the Planctomycetes. DevB from Anabaena sp. (strain PCC 7120) is partially characterised as a membrane fusion protein of the DevBCA ABC exporter, probably a glycolipid exporter required for heterocyst formation. Most Cyanobacteria have one member only, but Nostoc sp. which has seven members..
Probab=79.82  E-value=3.6  Score=18.90  Aligned_cols=83  Identities=12%  Similarity=0.160  Sum_probs=73.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999987666677788999999999999999987876554323----4567776532223557989999998568888
Q gi|254780930|r  155 NVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGA----TSKLSLVKLEAEIKSIESDIPTLEKSFRMNV  230 (452)
Q Consensus       155 ~l~~~v~~aY~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~----~~~~d~~~a~~~~~~~~~~l~~~~~~~~~a~  230 (452)
                      ++...-...+-++...+..+.-++..++..+..++..+..+..|.    +|..|+..-...+.+++..|..++.++....
T Consensus        97 t~~~~~~~~~~~~aA~~A~l~rl~~e~~~A~re~~Ry~~L~~~GARqRLvS~~~lD~~~L~~~~~~~~L~~a~A~~~~~q  176 (363)
T TIGR02971        97 TVARAAAKLVKDVAAQQATLNRLEAELETAQRELDRYRSLFRDGARQRLVSASDLDSKKLKLRTAEEELEEAKASLSRTQ  176 (363)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             08999988888874201469999999998788999999996488210147600333489999999999999987688778


Q ss_pred             HHHHHHC
Q ss_conf             7687763
Q gi|254780930|r  231 HNISTLL  237 (452)
Q Consensus       231 ~~L~~l~  237 (452)
                      ..|..-+
T Consensus       177 ~TL~~~~  183 (363)
T TIGR02971       177 ETLAEQI  183 (363)
T ss_pred             HHHHHHH
T ss_conf             9999999


No 67 
>PRK10397 hypothetical protein; Provisional
Probab=79.22  E-value=1.9  Score=20.73  Aligned_cols=40  Identities=20%  Similarity=0.312  Sum_probs=25.5

Q ss_pred             HHHHHHHHHHHHHHCCCCCCC----CCCCCCCCCCCCCCCCCCC
Q ss_conf             999999999997502689999----9995647501024677666
Q gi|254780930|r    5 RAIFSLFIVLLAGCTVGPEYT----KPHMPLLPTQFSIGNSKNL   44 (452)
Q Consensus         5 ~~~~~l~~~~l~gC~~~p~~~----~p~~~~~~~~~~~~~~~~~   44 (452)
                      ++++...+++|+||+-.++|.    .|+.......|....++..
T Consensus         3 k~~~~g~~l~LsGCa~v~nY~~vVk~PaPagl~GyWqs~gPQs~   46 (137)
T PRK10397          3 KLAIAGALMLLAGCAEVENYNNVVKTPAPAGLAGYWQSKGPQRA   46 (137)
T ss_pred             HHHHHHHHHHHHCCCCCCCHHHHHCCCCCCCCCEEEECCCCCCC
T ss_conf             24677899997353244106656448997332304452587233


No 68 
>TIGR02722 lp_ uncharacterized lipoprotein; InterPro: IPR014094   Members of this protein family are restricted to the Proteobacteria, and all are predicted lipoproteins. In genomes that contain the thiK gene for the salvage enzyme thiamin kinase, the member of this family is encoded nearby..
Probab=78.92  E-value=2.5  Score=19.96  Aligned_cols=24  Identities=42%  Similarity=0.804  Sum_probs=14.4

Q ss_pred             HH-HHHHHHHHHHCCC-CCCCCCCCC
Q ss_conf             99-9999999750268-999999956
Q gi|254780930|r    7 IF-SLFIVLLAGCTVG-PEYTKPHMP   30 (452)
Q Consensus         7 ~~-~l~~~~l~gC~~~-p~~~~p~~~   30 (452)
                      ++ ++.+++|+||.-. +.|..|..+
T Consensus         7 ~~~~~~Al~L~GC~~~~~~y~~~~~~   32 (215)
T TIGR02722         7 IFVALLALLLSGCVSQRVAYTDATDP   32 (215)
T ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCC
T ss_conf             99999999985468872665688756


No 69 
>pfam05590 DUF769 Xylella fastidiosa protein of unknown function (DUF769). This family consists of several uncharacterized hypothetical proteins of unknown function from Xylella fastidiosa, the organism that causes Pierce's disease in plants.
Probab=78.58  E-value=1.7  Score=20.96  Aligned_cols=24  Identities=33%  Similarity=0.636  Sum_probs=13.9

Q ss_pred             CCCHHHH---HHHHHHHHHHHCCCCCC
Q ss_conf             9306999---99999999750268999
Q gi|254780930|r    1 MNILRAI---FSLFIVLLAGCTVGPEY   24 (452)
Q Consensus         1 M~~~~~~---~~l~~~~l~gC~~~p~~   24 (452)
                      |++...+   ++...++|+||+.+|..
T Consensus         1 Msl~prL~~SllaAslLLagCSsgPpI   27 (279)
T pfam05590         1 MSLHPRLSCSLLAASLLLAGCSSGPPI   27 (279)
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCCCCCC
T ss_conf             986664016999999997237889986


No 70 
>COG3056 Uncharacterized lipoprotein [Cell envelope biogenesis, outer membrane]
Probab=78.58  E-value=1.9  Score=20.75  Aligned_cols=20  Identities=40%  Similarity=0.768  Sum_probs=13.0

Q ss_pred             HHHHHHHHH-HHHHHHCCCCC
Q ss_conf             699999999-99975026899
Q gi|254780930|r    4 LRAIFSLFI-VLLAGCTVGPE   23 (452)
Q Consensus         4 ~~~~~~l~~-~~l~gC~~~p~   23 (452)
                      +++++++.. ++|+||+..|.
T Consensus        16 ~k~L~~laa~~lLagC~a~~~   36 (204)
T COG3056          16 KKILFPLAAIFLLAGCAAPPT   36 (204)
T ss_pred             HHHHHHHHHHHHHHHCCCCCC
T ss_conf             999999999999975379975


No 71 
>PRK11548 hypothetical protein; Provisional
Probab=77.85  E-value=1.6  Score=21.27  Aligned_cols=21  Identities=29%  Similarity=0.479  Sum_probs=13.7

Q ss_pred             CCCHH--HHHHHHHHHHHHHCCC
Q ss_conf             93069--9999999999750268
Q gi|254780930|r    1 MNILR--AIFSLFIVLLAGCTVG   21 (452)
Q Consensus         1 M~~~~--~~~~l~~~~l~gC~~~   21 (452)
                      |+++.  ..+++++++++||+..
T Consensus         1 m~~k~l~~a~ll~~lllsgCS~~   23 (113)
T PRK11548          1 MRCKTLTAAAAVLLMLTAGCSTL   23 (113)
T ss_pred             CCHHHHHHHHHHHHHHHCCCCCC
T ss_conf             92578899999999998011578


No 72 
>COG3017 LolB Outer membrane lipoprotein involved in outer membrane biogenesis [Cell envelope biogenesis, outer membrane]
Probab=76.10  E-value=2.7  Score=19.67  Aligned_cols=20  Identities=35%  Similarity=0.579  Sum_probs=11.5

Q ss_pred             CCCHHH-HHHHHHHHHHHHCC
Q ss_conf             930699-99999999975026
Q gi|254780930|r    1 MNILRA-IFSLFIVLLAGCTV   20 (452)
Q Consensus         1 M~~~~~-~~~l~~~~l~gC~~   20 (452)
                      |+.++. +..+.+++|+||+.
T Consensus         4 ~~~~~~~l~~~As~LL~aC~~   24 (206)
T COG3017           4 MKRLLFLLLALASLLLTACTL   24 (206)
T ss_pred             HHHHHHHHHHHHHHHHHHCCC
T ss_conf             777878999999999975656


No 73 
>pfam07273 DUF1439 Protein of unknown function (DUF1439). This family consists of several hypothetical bacterial proteins of around 190 residues in length. Several members of this family are annotated as being putative lipoproteins and are often known as YceB. The function of this family is unknown.
Probab=75.51  E-value=2.1  Score=20.36  Aligned_cols=19  Identities=37%  Similarity=0.772  Sum_probs=15.3

Q ss_pred             CCCHHHHHHHHHHHHHHHC
Q ss_conf             9306999999999997502
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCT   19 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~   19 (452)
                      ||.+..++++++++|+||.
T Consensus         1 Mk~~~~~~~~l~~~LsgC~   19 (177)
T pfam07273         1 MKKLLLLILLLVLLLSGCA   19 (177)
T ss_pred             CCHHHHHHHHHHHHHHCCC
T ss_conf             9148999999999971557


No 74 
>TIGR02448 TIGR02448 conserverd hypothetical protein; InterPro: IPR012661   This family consists of small hypothetical proteins, about 100 amino acids in length. The family includes five members (three in tandem) in Pseudomonas aeruginosa PAO1, and also in Pseudomonas putida (strain KT2440), four in Pseudomonas syringae DC3000, and single members in several other Proteobacteria. The function is unknown..
Probab=73.96  E-value=2.5  Score=19.91  Aligned_cols=27  Identities=11%  Similarity=0.132  Sum_probs=22.6

Q ss_pred             HHHHHHHHHHHHHCH-HHHHHHHHHHHH
Q ss_conf             879999999997089-989999999999
Q gi|254780930|r   59 TSLNKLVKIALQQNL-TILQATERINAA   85 (452)
Q Consensus        59 ~~L~~~i~~Al~~np-~l~~a~~~i~~a   85 (452)
                      +.|+.+++..-.+|| .++++-.++-+|
T Consensus        76 A~LEaAl~~lR~~~P~~L~AsD~eLA~A  103 (107)
T TIGR02448        76 ARLEAALRQLRSDNPEALQASDLELAQA  103 (107)
T ss_pred             HHHHHHHHHHHHHCHHHCCCCHHHHHHH
T ss_conf             7899999999762744403347999998


No 75 
>pfam06085 Rz1 Lipoprotein Rz1 precursor. This family consists of several bacteria and phage lipoprotein Rz1 precursors. Rz1 is a proline-rich lipoprotein from bacteriophage lambda which is known to have fusogenic properties. Rz1-induced liposome fusion is thought to be mediated primarily by the generation of local perturbation in the bilayer lipid membrane and to a lesser extent by electrostatic forces.
Probab=73.96  E-value=4.3  Score=18.41  Aligned_cols=24  Identities=17%  Similarity=0.422  Sum_probs=15.3

Q ss_pred             CCCHHHH-H-HHHHHHHHHHCCCCCC
Q ss_conf             9306999-9-9999999750268999
Q gi|254780930|r    1 MNILRAI-F-SLFIVLLAGCTVGPEY   24 (452)
Q Consensus         1 M~~~~~~-~-~l~~~~l~gC~~~p~~   24 (452)
                      |+.++.. + ..+.++++||...|..
T Consensus         1 Mr~lkm~l~~~m~~L~vsaC~S~p~v   26 (59)
T pfam06085         1 MRKLKMKLCVMMLPLVVSACSSKPPV   26 (59)
T ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             95202569999989999982699986


No 76 
>PRK02944 OxaA-like protein precursor; Validated
Probab=73.22  E-value=4.4  Score=18.29  Aligned_cols=19  Identities=26%  Similarity=0.724  Sum_probs=11.3

Q ss_pred             CCCHHHHHHH---HHHHHHHHC
Q ss_conf             9306999999---999997502
Q gi|254780930|r    1 MNILRAIFSL---FIVLLAGCT   19 (452)
Q Consensus         1 M~~~~~~~~l---~~~~l~gC~   19 (452)
                      ||....++.+   .+++|+||+
T Consensus         1 mkk~~~~~~~~~~~~~~lsgC~   22 (255)
T PRK02944          1 MKKKLGLLAMVVALMAILAGCS   22 (255)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCC
T ss_conf             9289999999999999996246


No 77 
>PRK10449 heat-inducible protein; Provisional
Probab=73.03  E-value=3.4  Score=19.07  Aligned_cols=21  Identities=24%  Similarity=0.493  Sum_probs=12.3

Q ss_pred             CCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             9306999999999997502689
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTVGP   22 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~~p   22 (452)
                      ||.+ ..++++.++|+||+..+
T Consensus         1 MKk~-l~l~~~~llLagC~s~~   21 (140)
T PRK10449          1 MKKV-VALVALSLLMAGCVSSG   21 (140)
T ss_pred             CCHH-HHHHHHHHHHHHCCCCC
T ss_conf             9034-99999999997523899


No 78 
>PRK10477 outer membrane lipoprotein Blc; Provisional
Probab=72.88  E-value=4.5  Score=18.24  Aligned_cols=20  Identities=20%  Similarity=0.496  Sum_probs=15.4

Q ss_pred             CCCHHHHHHH-HHHHHHHHCC
Q ss_conf             9306999999-9999975026
Q gi|254780930|r    1 MNILRAIFSL-FIVLLAGCTV   20 (452)
Q Consensus         1 M~~~~~~~~l-~~~~l~gC~~   20 (452)
                      |+++..++.+ ++++|+||+.
T Consensus         1 ~~~~~~~~~~~~~~~~~~c~~   21 (177)
T PRK10477          1 MRLLPVVAAVTAAFLVVACSS   21 (177)
T ss_pred             CCHHHHHHHHHHHHHHHHCCC
T ss_conf             940789999999999976469


No 79 
>TIGR00999 8a0102 Membrane Fusion Protein cluster 2 protein; InterPro: IPR005695    Gram-negative bacteria have evolved transport complexes that export macromolecules and toxic substances such as heavy metals across the two membranes of the cell envelope in a single energy coupled step. The process requires (1) a cytoplasmic membrane export system, (2) a membrane fusion protein (MFP), and (3) an outer membrane factor. Phylogenetic analyses reveal that the MFPs cluster in accordance with the type of cytoplasmic membrane transport systems with which they function - proteins in this family are associated with reisistance to heavy metal poisoning. ; GO: 0046873 metal ion transmembrane transporter activity, 0030001 metal ion transport.
Probab=72.38  E-value=5.6  Score=17.62  Aligned_cols=73  Identities=12%  Similarity=0.202  Sum_probs=52.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8766667778899999999999999998787655432345677765322235579899999985688887687
Q gi|254780930|r  162 PSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS  234 (452)
Q Consensus       162 ~aY~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~~d~~~a~~~~~~~~~~l~~~~~~~~~a~~~L~  234 (452)
                      ..+-++..++.+++.++...+.....++--+.+++.|.++..|..+++..+..++.+...++..+..++..-.
T Consensus        24 ~~~~~~~~A~~~~e~ar~~YE~~~~tyeR~kkL~~~~~~~~~e~~~~~~~l~~a~~~~~~~~~~l~~~~~~~~   96 (284)
T TIGR00999        24 KVAAELKEAQKRVELARKTYEAVKKTYEREKKLFEQKVIPKQEFESAEYKLEEAKAEVQAAKSELKAAREAKD   96 (284)
T ss_pred             HHHHHHHHHHHHHHHHCCEEEEEEEEEECCCCCHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             9999999988867633020101345652157804432770789999999999999999999999988556514


No 80 
>PRK13883 conjugal transfer protein TrbH; Provisional
Probab=72.35  E-value=2.9  Score=19.53  Aligned_cols=18  Identities=22%  Similarity=0.685  Sum_probs=11.2

Q ss_pred             HHH-HHHHHHHHHHHC-CCC
Q ss_conf             999-999999997502-689
Q gi|254780930|r    5 RAI-FSLFIVLLAGCT-VGP   22 (452)
Q Consensus         5 ~~~-~~l~~~~l~gC~-~~p   22 (452)
                      |++ +.++++.|+||+ ++|
T Consensus         3 K~~~~all~laL~gCAtt~~   22 (156)
T PRK13883          3 KILSLALLALALGGCATTSQ   22 (156)
T ss_pred             HHHHHHHHHHHHHCCCCCCC
T ss_conf             68999999999703313578


No 81 
>PRK11189 lipoprotein NlpI; Provisional
Probab=72.06  E-value=4.5  Score=18.27  Aligned_cols=20  Identities=40%  Similarity=0.572  Sum_probs=12.4

Q ss_pred             CCCHHHHHHH-HHHHHHHHCC
Q ss_conf             9306999999-9999975026
Q gi|254780930|r    1 MNILRAIFSL-FIVLLAGCTV   20 (452)
Q Consensus         1 M~~~~~~~~l-~~~~l~gC~~   20 (452)
                      |+.+|..+.+ ++++|+||+.
T Consensus         2 ~~~~r~~~~~~~~l~LsGC~s   22 (297)
T PRK11189          2 KPFLRWCFVATAALLLAGCAS   22 (297)
T ss_pred             CHHHHHHHHHHHHHHHHHHCC
T ss_conf             518999999999999986405


No 82 
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW; InterPro: IPR013360    Proteins in this entry are designated PilF  and PilW . This outer membrane protein is required both for pilus stability and for pilus functions such as adherence to human cells. Members of this family contain copies of the TPR (tetratricopeptide repeat) domain..
Probab=71.29  E-value=3.5  Score=18.98  Aligned_cols=26  Identities=12%  Similarity=0.018  Sum_probs=15.5

Q ss_pred             HHHHHHHHHCHHHHHHHHHHHHHHHH
Q ss_conf             99999997089989999999999999
Q gi|254780930|r   63 KLVKIALQQNLTILQATERINAAKEN   88 (452)
Q Consensus        63 ~~i~~Al~~np~l~~a~~~i~~a~~~   88 (452)
                      .-|+.||+++|+.-.+..-+...-.+
T Consensus        58 ~~l~~AL~~dp~~~~a~~~lA~~Yq~   83 (247)
T TIGR02521        58 ENLDKALEHDPDDYDAYLALALYYQQ   83 (247)
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHHH
T ss_conf             99999987376661289999999987


No 83 
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO. Members of this protein family include YfiO, a near-essential protein of the outer membrane, part of a complex involved in protein insertion into the bacterial outer membrane. Many proteins in this family are annotated as ComL, based on the involvement of this protein in natural transformation with exogenous DNA in Neisseria gonorrhoeae. This protein family shows sequence similarity to, but is distinct from, the tol-pal system protein YbgF (TIGR02795).
Probab=71.09  E-value=4.9  Score=18.00  Aligned_cols=19  Identities=37%  Similarity=0.653  Sum_probs=11.5

Q ss_pred             HHHH-HHHHHHHHHHHCCCC
Q ss_conf             6999-999999997502689
Q gi|254780930|r    4 LRAI-FSLFIVLLAGCTVGP   22 (452)
Q Consensus         4 ~~~~-~~l~~~~l~gC~~~p   22 (452)
                      ++.+ +++++++|+||+..+
T Consensus         2 ~~~~~~~~~~~~l~sCs~~~   21 (235)
T TIGR03302         2 LLLILLLALLLLLAGCSSKK   21 (235)
T ss_pred             HHHHHHHHHHHHHHHCCCCC
T ss_conf             79999999999998738997


No 84 
>COG5633 Predicted periplasmic lipoprotein [General function prediction only]
Probab=70.66  E-value=2.9  Score=19.47  Aligned_cols=22  Identities=41%  Similarity=0.641  Sum_probs=14.6

Q ss_pred             CCCHHHHHHHHHHHHHHHCCCCC
Q ss_conf             93069999999999975026899
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTVGPE   23 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~~p~   23 (452)
                      ||.+.. ..+.+++|.||+..+.
T Consensus         1 Mrk~~~-~~l~~~lLvGCsS~~~   22 (123)
T COG5633           1 MRKLCL-LSLALLLLVGCSSHQE   22 (123)
T ss_pred             CCEEHH-HHHHHHHHHCCCCCCC
T ss_conf             930038-9999999420478877


No 85 
>PRK11917 bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein; Reviewed
Probab=70.21  E-value=3.5  Score=18.95  Aligned_cols=26  Identities=15%  Similarity=0.308  Sum_probs=20.5

Q ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             93069999999999975026899999
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTVGPEYTK   26 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~~p~~~~   26 (452)
                      |+.+|.++.++++.|++|...+....
T Consensus         1 m~~~~~l~~~~~~~l~~~~~~~~~~a   26 (259)
T PRK11917          1 MVFRKSLLKLAVFALGACVAFSNANA   26 (259)
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCHH
T ss_conf             94279999999999999986345211


No 86 
>PRK01622 OxaA-like protein precursor; Validated
Probab=70.04  E-value=5.5  Score=17.68  Aligned_cols=20  Identities=30%  Similarity=0.756  Sum_probs=10.7

Q ss_pred             CCCHHHHH----HHHHHHHHHHCC
Q ss_conf             93069999----999999975026
Q gi|254780930|r    1 MNILRAIF----SLFIVLLAGCTV   20 (452)
Q Consensus         1 M~~~~~~~----~l~~~~l~gC~~   20 (452)
                      ||..|.++    ++.+++|+||+.
T Consensus         2 ~k~~~~~l~~~~~~~~~~lsgc~~   25 (266)
T PRK01622          2 LKSYRAVLISLSLLLVFVLSGCSN   25 (266)
T ss_pred             CHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             538899999999999999954689


No 87 
>pfam11153 DUF2931 Protein of unknown function (DUF2931). Some members in this family of proteins are annotated as lipoproteins however this cannot be confirmed. Currently, there is no known function.
Probab=69.82  E-value=4.3  Score=18.40  Aligned_cols=17  Identities=24%  Similarity=0.690  Sum_probs=12.9

Q ss_pred             HHHHHHHHHHHHHHHCC
Q ss_conf             69999999999975026
Q gi|254780930|r    4 LRAIFSLFIVLLAGCTV   20 (452)
Q Consensus         4 ~~~~~~l~~~~l~gC~~   20 (452)
                      +++++++++++|+||+.
T Consensus         2 ~~i~~ll~~lll~aCs~   18 (202)
T pfam11153         2 KKILLLLLLLLLTACST   18 (202)
T ss_pred             HHHHHHHHHHHHHHHCC
T ss_conf             01489999999876025


No 88 
>PRK10461 thiamine biosynthesis lipoprotein ApbE; Provisional
Probab=69.26  E-value=5.8  Score=17.51  Aligned_cols=25  Identities=28%  Similarity=0.491  Sum_probs=15.7

Q ss_pred             CCHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             3069999999999975026899999
Q gi|254780930|r    2 NILRAIFSLFIVLLAGCTVGPEYTK   26 (452)
Q Consensus         2 ~~~~~~~~l~~~~l~gC~~~p~~~~   26 (452)
                      +.-+..++.++++|+||.-.|...+
T Consensus         4 ~~~~~~ll~~~~~l~gC~~~~~~~~   28 (351)
T PRK10461          4 TFTRVALLAAALLLVGCDQAPQPAK   28 (351)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             0799999999999987248887755


No 89 
>COG3521 Predicted component of the type VI protein secretion system [Intracellular trafficking, secretion, and    vesicular transport]
Probab=69.20  E-value=5.2  Score=17.85  Aligned_cols=28  Identities=29%  Similarity=0.619  Sum_probs=16.2

Q ss_pred             CCC-HHHHHHH-HHHHHHHHCCCCCCCCCC
Q ss_conf             930-6999999-999997502689999999
Q gi|254780930|r    1 MNI-LRAIFSL-FIVLLAGCTVGPEYTKPH   28 (452)
Q Consensus         1 M~~-~~~~~~l-~~~~l~gC~~~p~~~~p~   28 (452)
                      |+. .+.+..+ .+++++||+..++..+|.
T Consensus         1 M~~~~~a~~~l~al~~~sgCsss~~~~pp~   30 (159)
T COG3521           1 MNSSRKAVLALFALLVLSGCSSSKPLLPPS   30 (159)
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCCCCCCC
T ss_conf             942577899999999852412588778971


No 90 
>PRK11679 lipoprotein; Provisional
Probab=69.16  E-value=4.4  Score=18.35  Aligned_cols=22  Identities=23%  Similarity=0.522  Sum_probs=14.4

Q ss_pred             HHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             9999999999975026899999
Q gi|254780930|r    5 RAIFSLFIVLLAGCTVGPEYTK   26 (452)
Q Consensus         5 ~~~~~l~~~~l~gC~~~p~~~~   26 (452)
                      +.+.++++++|+||+..+.+.+
T Consensus        12 ~v~~~~lv~~L~ACss~~~~rr   33 (345)
T PRK11679         12 KVAGVSLVLLLAACSSDQRYKR   33 (345)
T ss_pred             HHHHHHHHHHHHHCCCCHHHHH
T ss_conf             7888999999986079757777


No 91 
>TIGR02887 spore_ger_x_C germination protein, Ger(x)C family; InterPro: IPR008844 The GerAA, -AB, and -AC proteins of the Bacillus subtilis spore are required for the germination response to L-alanine as the sole germinant. Members of GerAC family are thought to be located in the inner spore membrane. Although the function of this family is unclear, they are likely to encode the components of the germination apparatus that respond directly to this germinant, mediating the spore's response .; GO: 0009847 spore germination, 0016020 membrane.
Probab=67.70  E-value=3.2  Score=19.24  Aligned_cols=17  Identities=35%  Similarity=0.712  Sum_probs=10.8

Q ss_pred             CHHHH-HHHHHHHHHHHC
Q ss_conf             06999-999999997502
Q gi|254780930|r    3 ILRAI-FSLFIVLLAGCT   19 (452)
Q Consensus         3 ~~~~~-~~l~~~~l~gC~   19 (452)
                      +++.+ +++++++|+||-
T Consensus         2 ~~~~~~~~~~~~lL~GCw   19 (400)
T TIGR02887         2 KLKILLLILALLLLTGCW   19 (400)
T ss_pred             HHHHHHHHHHHHHHCCCC
T ss_conf             466789999999832665


No 92 
>PRK10838 spr putative outer membrane lipoprotein; Provisional
Probab=67.64  E-value=4.6  Score=18.22  Aligned_cols=22  Identities=36%  Similarity=0.588  Sum_probs=13.5

Q ss_pred             CHHHHHHH-HHHHHHHHCCCCCC
Q ss_conf             06999999-99999750268999
Q gi|254780930|r    3 ILRAIFSL-FIVLLAGCTVGPEY   24 (452)
Q Consensus         3 ~~~~~~~l-~~~~l~gC~~~p~~   24 (452)
                      ++|.+..+ ++++|++|+..|..
T Consensus        10 ~l~~~~~~~~~~~l~ac~~~~~~   32 (188)
T PRK10838         10 ILRGIPAIAVAVLLSACSSNNTA   32 (188)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             99871799999988863389855


No 93 
>PRK10510 putative outer membrane lipoprotein; Provisional
Probab=66.60  E-value=6.2  Score=17.35  Aligned_cols=22  Identities=23%  Similarity=0.495  Sum_probs=12.8

Q ss_pred             CCCHHHHHHHH---HHHHHHHCCCC
Q ss_conf             93069999999---99997502689
Q gi|254780930|r    1 MNILRAIFSLF---IVLLAGCTVGP   22 (452)
Q Consensus         1 M~~~~~~~~l~---~~~l~gC~~~p   22 (452)
                      |+....++..+   +++|+||++.|
T Consensus         1 m~~r~~lia~~~a~~l~lsgC~t~p   25 (219)
T PRK10510          1 MKKRVYLIAAIVSGALAVSGCTTNP   25 (219)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             9426899999999998741356789


No 94 
>pfam05643 DUF799 Putative bacterial lipoprotein (DUF799). This family consists of several bacterial proteins of unknown function. Some of the family members are described as putative lipoproteins.
Probab=65.91  E-value=5.6  Score=17.62  Aligned_cols=20  Identities=30%  Similarity=0.562  Sum_probs=11.5

Q ss_pred             CCCHHHHHHH-HHHHHHHHCCCC
Q ss_conf             9306999999-999997502689
Q gi|254780930|r    1 MNILRAIFSL-FIVLLAGCTVGP   22 (452)
Q Consensus         1 M~~~~~~~~l-~~~~l~gC~~~p   22 (452)
                      ||  +.++.+ .+++|+||+..+
T Consensus         1 mK--~lil~l~~~l~L~gCa~~~   21 (215)
T pfam05643         1 MK--PLILGLAAVLALSACQVQK   21 (215)
T ss_pred             CH--HHHHHHHHHHHHHHCCCCC
T ss_conf             93--1499999999986234899


No 95 
>PRK11669 pbpG D-alanyl-D-alanine endopeptidase; Provisional
Probab=65.82  E-value=6.6  Score=17.17  Aligned_cols=27  Identities=30%  Similarity=0.460  Sum_probs=15.7

Q ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             9306999999999997502689999999
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTVGPEYTKPH   28 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~~p~~~~p~   28 (452)
                      ||++.. ++.|+++++||.+.|...++.
T Consensus         1 mk~~~~-~~~~~~~~~~~~~~~~~~a~~   27 (308)
T PRK11669          1 MKIRVS-LLSLLLLLAGVPVAPQAVAKT   27 (308)
T ss_pred             CCHHHH-HHHHHHHHHHHCCCCCCCCCC
T ss_conf             932699-999999997400365546788


No 96 
>PRK10672 rare lipoprotein A; Provisional
Probab=65.68  E-value=7.7  Score=16.72  Aligned_cols=22  Identities=27%  Similarity=0.220  Sum_probs=17.0

Q ss_pred             CCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             9306999999999997502689
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTVGP   22 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~~p   22 (452)
                      ||.--+++++..++|+||+...
T Consensus         1 mr~~wl~~~~~~~ll~~c~~~~   22 (369)
T PRK10672          1 MRKQWLGICIAAGLLAACTSDD   22 (369)
T ss_pred             CCHHHHHHHHHHHHHHHCCCCC
T ss_conf             9333589999999986525886


No 97 
>PRK10871 nlpD lipoprotein NlpD; Provisional
Probab=65.45  E-value=4.9  Score=18.04  Aligned_cols=26  Identities=27%  Similarity=0.397  Sum_probs=15.2

Q ss_pred             CHHHHHHHHH-HHHHHHCCCCCCCCCC
Q ss_conf             0699999999-9997502689999999
Q gi|254780930|r    3 ILRAIFSLFI-VLLAGCTVGPEYTKPH   28 (452)
Q Consensus         3 ~~~~~~~l~~-~~l~gC~~~p~~~~p~   28 (452)
                      +.|+.+|.++ ++|+||+..+...+|-
T Consensus        10 ~~~~~~~~~~~~~l~gcs~~~~~~api   36 (374)
T PRK10871         10 VRRIAALSLVSLWLAGCTNTSNPPAPV   36 (374)
T ss_pred             HHHHHHHHHHHHHHECCCCCCCCCCCE
T ss_conf             789999999998601037888886864


No 98 
>pfam06291 Lambda_Bor Bor protein. This family consists of several Bacteriophage lambda Bor and Escherichia coli Iss proteins. Expression of bor significantly increases the survival of the Escherichia coli host cell in animal serum. This property is a well known bacterial virulence determinant indeed, bor and its adjacent sequences are highly homologous to the iss serum resistance locus of the plasmid ColV2-K94, which confers virulence in animals. It has been suggested that lysogeny may generally have a role in bacterial survival in animal hosts, and perhaps in pathogenesis.
Probab=64.62  E-value=5  Score=17.96  Aligned_cols=19  Identities=21%  Similarity=0.492  Sum_probs=11.8

Q ss_pred             CCCHHHHHHHHHHHHHHHCC
Q ss_conf             93069999999999975026
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTV   20 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~   20 (452)
                      ||.+-.. .++.++|+||+.
T Consensus         1 MKk~~~~-~~~allLtgCa~   19 (97)
T pfam06291         1 MKKMLFA-AALALLITGCAQ   19 (97)
T ss_pred             CHHHHHH-HHHHHHHCCCCC
T ss_conf             9225999-999999721330


No 99 
>PRK12450 foldase protein PrsA; Reviewed
Probab=64.24  E-value=6.7  Score=17.12  Aligned_cols=21  Identities=19%  Similarity=0.412  Sum_probs=12.4

Q ss_pred             CCCHHHHH-----HHHHHHHHHHCCC
Q ss_conf             93069999-----9999999750268
Q gi|254780930|r    1 MNILRAIF-----SLFIVLLAGCTVG   21 (452)
Q Consensus         1 M~~~~~~~-----~l~~~~l~gC~~~   21 (452)
                      |+.|+.++     +++++.|+||+..
T Consensus         1 m~~mKK~~~~~~~~~svl~LaAC~s~   26 (309)
T PRK12450          1 MKQMNKLITGVVTLATVVTLSACQSS   26 (309)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             91799999999999999999860589


No 100
>pfam10368 YkyA Putative cell-wall binding lipoprotein. YkyA is a family of proteins containing a lipoprotein signal and a hydrolase domain. It is similar to cell wall binding proteins and might also be recognisable by a host immune defence system. It is thus likely to belong to pathways important for pathogenicity.
Probab=63.09  E-value=3.4  Score=19.09  Aligned_cols=13  Identities=62%  Similarity=1.050  Sum_probs=8.5

Q ss_pred             HHHHHHHHHHCCC
Q ss_conf             9999999750268
Q gi|254780930|r    9 SLFIVLLAGCTVG   21 (452)
Q Consensus         9 ~l~~~~l~gC~~~   21 (452)
                      ++++++|+||..+
T Consensus         2 ~~s~~lLaGC~~~   14 (205)
T pfam10368         2 ILSILLLTGCTTG   14 (205)
T ss_pred             CHHHHHHHHHCCC
T ss_conf             1899999862699


No 101
>PRK13614 lipoprotein LpqB; Provisional
Probab=62.84  E-value=8.7  Score=16.38  Aligned_cols=19  Identities=26%  Similarity=0.424  Sum_probs=12.9

Q ss_pred             HHHHHHHHHHHHCCCCCCC
Q ss_conf             9999999997502689999
Q gi|254780930|r    7 IFSLFIVLLAGCTVGPEYT   25 (452)
Q Consensus         7 ~~~l~~~~l~gC~~~p~~~   25 (452)
                      ++.++.++|+||+..|.-.
T Consensus        13 ll~~~~v~LagCasiP~sg   31 (573)
T PRK13614         13 LLVLLGVTLSACAQIPRSG   31 (573)
T ss_pred             HHHHHHHHHHHHCCCCCCC
T ss_conf             9999998865404699998


No 102
>PRK10598 hypothetical protein; Provisional
Probab=61.35  E-value=6.5  Score=17.21  Aligned_cols=20  Identities=30%  Similarity=0.398  Sum_probs=12.6

Q ss_pred             CCCHHHHHHH-HHHHHHHHCC
Q ss_conf             9306999999-9999975026
Q gi|254780930|r    1 MNILRAIFSL-FIVLLAGCTV   20 (452)
Q Consensus         1 M~~~~~~~~l-~~~~l~gC~~   20 (452)
                      ||.+....++ ++.+|+||+.
T Consensus         1 mkk~~l~~~l~l~~llsGC~~   21 (186)
T PRK10598          1 MKKFLLAAALLVSGLLVGCNQ   21 (186)
T ss_pred             CCHHHHHHHHHHHHHHHCCCC
T ss_conf             912699999999999714353


No 103
>PRK13731 conjugal transfer surface exclusion protein TraT; Provisional
Probab=60.41  E-value=5.4  Score=17.76  Aligned_cols=21  Identities=19%  Similarity=0.332  Sum_probs=12.7

Q ss_pred             CCCHHHHH---HHHHHHHHHHCCC
Q ss_conf             93069999---9999999750268
Q gi|254780930|r    1 MNILRAIF---SLFIVLLAGCTVG   21 (452)
Q Consensus         1 M~~~~~~~---~l~~~~l~gC~~~   21 (452)
                      |++++.++   ++.+++|+||+..
T Consensus         1 m~~kk~~~~~~~~~~l~lsGC~a~   24 (243)
T PRK13731          1 MKTKKLMMVALVSSTLALSGCGAM   24 (243)
T ss_pred             CCHHHHHHHHHHHHHHHHCCHHHH
T ss_conf             933775799999999997156876


No 104
>COG2980 RlpB Rare lipoprotein B [Cell envelope biogenesis, outer membrane]
Probab=59.81  E-value=9.8  Score=16.04  Aligned_cols=20  Identities=30%  Similarity=0.589  Sum_probs=13.6

Q ss_pred             CCCHHHHHH-HHHHHHHHHCC
Q ss_conf             930699999-99999975026
Q gi|254780930|r    1 MNILRAIFS-LFIVLLAGCTV   20 (452)
Q Consensus         1 M~~~~~~~~-l~~~~l~gC~~   20 (452)
                      |+.++.+++ +.+.+|+||-.
T Consensus         1 M~~L~~~lL~~a~~~L~aCGF   21 (178)
T COG2980           1 MRKLKTLLLLAAVLLLAACGF   21 (178)
T ss_pred             CCCHHHHHHHHHHHHHHHCCE
T ss_conf             900589999999999733453


No 105
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldI is a FKBP-type peptidyl-prolyl cis-trans isomerase (pfam00254) linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockout of this gene abolishes the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. This family is only found in Bacteroidetes containing the suite of genes proposed to confer the gliding motility phenotype.
Probab=59.26  E-value=8.6  Score=16.41  Aligned_cols=18  Identities=44%  Similarity=0.811  Sum_probs=10.8

Q ss_pred             CCCHHHHHHHHHHHHHHHC
Q ss_conf             9306999999999997502
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCT   19 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~   19 (452)
                      ||.+..+ +++++++.||.
T Consensus         1 m~~~i~~-i~~~~~~~sC~   18 (177)
T TIGR03516         1 MKHLIAV-ILLLLLLLGCK   18 (177)
T ss_pred             CCCHHHH-HHHHHHHHHCC
T ss_conf             9430478-98989987269


No 106
>PRK10957 iron-enterobactin transporter periplasmic binding protein; Provisional
Probab=59.24  E-value=8  Score=16.62  Aligned_cols=23  Identities=26%  Similarity=0.341  Sum_probs=14.5

Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             99999999999750268999999
Q gi|254780930|r    5 RAIFSLFIVLLAGCTVGPEYTKP   27 (452)
Q Consensus         5 ~~~~~l~~~~l~gC~~~p~~~~p   27 (452)
                      |.++++..++++||+......-|
T Consensus         8 ~~~~~~~~~~~~g~~~~~~~~~p   30 (319)
T PRK10957          8 RLALLLLGLLLSGIAAAQAADWP   30 (319)
T ss_pred             HHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             99999999997478755458988


No 107
>PRK10722 hypothetical protein; Provisional
Probab=58.98  E-value=10  Score=15.95  Aligned_cols=16  Identities=38%  Similarity=0.532  Sum_probs=10.8

Q ss_pred             HHHHHHHHHHHHCCCC
Q ss_conf             9999999997502689
Q gi|254780930|r    7 IFSLFIVLLAGCTVGP   22 (452)
Q Consensus         7 ~~~l~~~~l~gC~~~p   22 (452)
                      +..+.+++|+||+..+
T Consensus        20 ~~~~~~l~L~gC~~~~   35 (248)
T PRK10722         20 IAGLPCLALAGCVQNA   35 (248)
T ss_pred             HHHHHHHHHHHCCCCC
T ss_conf             9714999886304788


No 108
>PRK10531 putative pectinesterase; Provisional
Probab=58.86  E-value=6.4  Score=17.25  Aligned_cols=34  Identities=29%  Similarity=0.447  Sum_probs=19.2

Q ss_pred             CCCHH----HHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             93069----99999999997502689999999564750
Q gi|254780930|r    1 MNILR----AIFSLFIVLLAGCTVGPEYTKPHMPLLPT   34 (452)
Q Consensus         1 M~~~~----~~~~l~~~~l~gC~~~p~~~~p~~~~~~~   34 (452)
                      |+..+    .+.+.+.+.|.+|+..|....|....+|.
T Consensus         1 ~~~~~~~~la~al~~~v~l~ac~~~~~~~~~~~q~~pg   38 (427)
T PRK10531          1 MNTISVSRLALALAFGVTLTACSSTPPDQRPSDQTAPG   38 (427)
T ss_pred             CCEEHHHHHHHHHHHHEEEHHHCCCCCCCCCCCCCCCC
T ss_conf             96000888999986411314124889887855586998


No 109
>PRK10759 hypothetical protein; Provisional
Probab=58.75  E-value=4.6  Score=18.17  Aligned_cols=16  Identities=38%  Similarity=0.951  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHHHHC
Q ss_conf             6999999999997502
Q gi|254780930|r    4 LRAIFSLFIVLLAGCT   19 (452)
Q Consensus         4 ~~~~~~l~~~~l~gC~   19 (452)
                      ||.+++.++++++||+
T Consensus         1 ~r~~~~~~~l~~sgc~   16 (106)
T PRK10759          1 MRALIVPLLLLLSGCS   16 (106)
T ss_pred             CCHHHHHHHHHHCCCH
T ss_conf             9039999999984423


No 110
>pfam08139 LPAM_1 Prokaryotic membrane lipoprotein lipid attachment site. In prokaryotes, membrane lipoproteins are synthesized with a precursor signal peptide, which is cleaved by a specific lipoprotein signal peptidase (signal peptidase II). The peptidase recognizes a conserved sequence and cuts upstream of a cysteine residue to which a glyceride-fatty acid lipid is attached.
Probab=58.28  E-value=8.1  Score=16.57  Aligned_cols=18  Identities=33%  Similarity=0.727  Sum_probs=10.0

Q ss_pred             HHHHHHHH-HHHHHHCCCC
Q ss_conf             99999999-9997502689
Q gi|254780930|r    5 RAIFSLFI-VLLAGCTVGP   22 (452)
Q Consensus         5 ~~~~~l~~-~~l~gC~~~p   22 (452)
                      |.++++.+ ++|+||+...
T Consensus         3 k~~~l~~~~l~LagCas~~   21 (26)
T pfam08139         3 KLLLLLLALLLLAGCASXX   21 (26)
T ss_pred             HHHHHHHHHHHHHCCCCCC
T ss_conf             6999999999982332001


No 111
>pfam12262 Lipase_bact_N Bacterial virulence factor lipase N-terminal. This domain family is found in bacteria, and is typically between 258 and 271 amino acids in length. There are two conserved sequence motifs: DGT and DGWST. This family is the N-terminal region of bacterial virulence factor lipase. The N-terminal region contains a potential signalling sequence.
Probab=57.73  E-value=6.5  Score=17.21  Aligned_cols=20  Identities=35%  Similarity=0.336  Sum_probs=14.2

Q ss_pred             CCCHHHHHHHHHH-HHHHHCC
Q ss_conf             9306999999999-9975026
Q gi|254780930|r    1 MNILRAIFSLFIV-LLAGCTV   20 (452)
Q Consensus         1 M~~~~~~~~l~~~-~l~gC~~   20 (452)
                      ||.+.....+|.. .|+||.-
T Consensus         1 MKk~~l~~~i~SAL~LaGCg~   21 (269)
T pfam12262         1 MKKKFLALLLASALLLAGCGD   21 (269)
T ss_pred             CCHHHHHHHHHHHHHHCCCCC
T ss_conf             924799999999864111579


No 112
>PRK10533 putative lipoprotein; Provisional
Probab=57.58  E-value=7.4  Score=16.84  Aligned_cols=24  Identities=29%  Similarity=0.531  Sum_probs=14.6

Q ss_pred             CCCHHHH-HHHHHHHHHHHCC-CCCC
Q ss_conf             9306999-9999999975026-8999
Q gi|254780930|r    1 MNILRAI-FSLFIVLLAGCTV-GPEY   24 (452)
Q Consensus         1 M~~~~~~-~~l~~~~l~gC~~-~p~~   24 (452)
                      ||...+. ++-|.++|++|+. .|.+
T Consensus         1 Mr~~~~~ll~PlallLSACttV~Pa~   26 (171)
T PRK10533          1 MRYSKLALLLPCALLLSACTTVTPAY   26 (171)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCCHHH
T ss_conf             98620389999999998722476114


No 113
>PRK09973 putative outer membrane lipoprotein; Provisional
Probab=57.45  E-value=6.6  Score=17.19  Aligned_cols=20  Identities=30%  Similarity=0.551  Sum_probs=11.7

Q ss_pred             CCCHHHH--HHHHHHHHHHHCC
Q ss_conf             9306999--9999999975026
Q gi|254780930|r    1 MNILRAI--FSLFIVLLAGCTV   20 (452)
Q Consensus         1 M~~~~~~--~~l~~~~l~gC~~   20 (452)
                      ||....+  ++|...+|+||+.
T Consensus         1 mrtk~vlGaviLaS~LLaGCsn   22 (85)
T PRK09973          1 MKTIFTVGAVVLATCLLSGCVN   22 (85)
T ss_pred             CCCEEHHHHHHHHHHHHHCCCC
T ss_conf             9602110699999999981555


No 114
>COG4669 EscJ Type III secretory pathway, lipoprotein EscJ [Intracellular trafficking and secretion]
Probab=56.21  E-value=8.2  Score=16.56  Aligned_cols=19  Identities=53%  Similarity=0.983  Sum_probs=12.5

Q ss_pred             CCCHH-HHH-HHHHHHHHHHC
Q ss_conf             93069-999-99999997502
Q gi|254780930|r    1 MNILR-AIF-SLFIVLLAGCT   19 (452)
Q Consensus         1 M~~~~-~~~-~l~~~~l~gC~   19 (452)
                      |+.++ .++ ++++++|+||-
T Consensus         1 ~k~~~~~l~~l~l~l~L~gCk   21 (246)
T COG4669           1 MKSLRKYLFLLLLILLLTGCK   21 (246)
T ss_pred             CCHHHHHHHHHHHHHHHHCCH
T ss_conf             902899999999999983356


No 115
>pfam04741 InvH InvH outer membrane lipoprotein. This family represents the Salmonella outer membrane lipoprotein InvH. The molecular function of this protein is unknown, but it is required for the localisation to outer membrane of InvG, which is involved in a type III secretion apparatus mediating host cell invasion.
Probab=54.28  E-value=9.9  Score=16.01  Aligned_cols=21  Identities=33%  Similarity=0.535  Sum_probs=13.7

Q ss_pred             CCCHHHHHHHHHHHHHHHCCCCC
Q ss_conf             93069999999999975026899
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTVGPE   23 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~~p~   23 (452)
                      |+  +...|+-+++|-||+-.|.
T Consensus         1 m~--k~ysclpvflligcaqvp~   21 (147)
T pfam04741         1 MK--KFYSCLPVFLLIGCAQVPP   21 (147)
T ss_pred             CC--HHHHHHHHHHHHCCCCCCC
T ss_conf             94--2664426999850114789


No 116
>PRK02463 OxaA-like protein precursor; Provisional
Probab=53.85  E-value=12  Score=15.40  Aligned_cols=11  Identities=27%  Similarity=0.673  Sum_probs=7.4

Q ss_pred             HHHHHHHHHCC
Q ss_conf             99999975026
Q gi|254780930|r   10 LFIVLLAGCTV   20 (452)
Q Consensus        10 l~~~~l~gC~~   20 (452)
                      ..+++|+||..
T Consensus        16 ~~~l~LsgC~~   26 (307)
T PRK02463         16 SMLLTLTGCVG   26 (307)
T ss_pred             HHHHHHHCCCC
T ss_conf             99999963468


No 117
>PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional
Probab=52.30  E-value=13  Score=15.25  Aligned_cols=39  Identities=5%  Similarity=0.111  Sum_probs=29.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             234567776532223557989999998568888768776
Q gi|254780930|r  198 GATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL  236 (452)
Q Consensus       198 G~~~~~d~~~a~~~~~~~~~~l~~~~~~~~~a~~~L~~l  236 (452)
                      +.+++.++.+++..+..++.++.+++..++.++..|..-
T Consensus       117 ~aiS~~~ld~a~~~l~~a~aql~~A~A~l~~A~l~L~~T  155 (310)
T PRK10559        117 QAMSREEIDQANNVLQTVLHQLAKAQATRDLAKLDLERT  155 (310)
T ss_pred             HHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             100599999999999999999999999999999887258


No 118
>TIGR02544 III_secr_YscJ type III secretion apparatus lipoprotein, YscJ/HrcJ family; InterPro: IPR003282 Secretion of virulence factors in Gram-negative bacteria involves transportation of the protein across two membranes to reach the cell exterior. There have been four secretion systems described in animal enteropathogens such as Salmonella and Yersinia, with further sequence similarities in plant pathogens like Ralstonia and Erwinia.   The type III secretion system is of great interest as it is used to transport virulence factors from the pathogen directly into the host cell  and is only triggered when the bacterium comes into close contact with the host. The protein subunits of the system are very similar to those of bacterial flagellar biosynthesis . However, while the latter forms a ring structure to allow secretion of flagellin and is an integral part of the flagellum itself, type III subunits in the outer membrane translocate secreted proteins through a channel-like structure.    One of the outer membrane protein subunit families, termed "K" here for nomenclature purposes, aids in the structural assembly of the invasion complex . It is also described as a lipoprotein. Members of this family include the Salmonella PrgK and SsaJ genes, MxiJ from Shigella, YscJ from Yersinia, and from the plant enteropathogens NolT (Rhizobium) and HrcJ Erwinia). The flagellar M-ring protein FliF also shares a low level of similarity, presumably due to evolution of the type III secretion system from the flagellar biosynthetic pathway.; GO: 0009306 protein secretion.
Probab=52.20  E-value=9.2  Score=16.24  Aligned_cols=16  Identities=38%  Similarity=0.937  Sum_probs=10.5

Q ss_pred             HHHHHHHHHHHHHHCC
Q ss_conf             9999999999975026
Q gi|254780930|r    5 RAIFSLFIVLLAGCTV   20 (452)
Q Consensus         5 ~~~~~l~~~~l~gC~~   20 (452)
                      +.++++++++|+||..
T Consensus         4 ~~~~~~l~llL~GC~~   19 (203)
T TIGR02544         4 KLLLLLLLLLLTGCKV   19 (203)
T ss_pred             HHHHHHHHHHHHCCCC
T ss_conf             8899999999717874


No 119
>COG4851 CamS Protein involved in sex pheromone biosynthesis [General function prediction only]
Probab=51.97  E-value=11  Score=15.74  Aligned_cols=21  Identities=24%  Similarity=0.339  Sum_probs=12.9

Q ss_pred             CCC-HHHHHHHHHHHHHHHCCC
Q ss_conf             930-699999999999750268
Q gi|254780930|r    1 MNI-LRAIFSLFIVLLAGCTVG   21 (452)
Q Consensus         1 M~~-~~~~~~l~~~~l~gC~~~   21 (452)
                      |+. |-+.++..+++|+||...
T Consensus         1 Mkktl~i~~ta~vliLs~C~~~   22 (382)
T COG4851           1 MKKTLGIAATASVLILSGCFPF   22 (382)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCC
T ss_conf             9401558999999998611676


No 120
>COG5461 Type IV pili component [Cell motility and secretion]
Probab=50.97  E-value=14  Score=15.11  Aligned_cols=21  Identities=29%  Similarity=0.417  Sum_probs=13.5

Q ss_pred             HHHHHHHHHHHHHHCCCCCCC
Q ss_conf             999999999997502689999
Q gi|254780930|r    5 RAIFSLFIVLLAGCTVGPEYT   25 (452)
Q Consensus         5 ~~~~~l~~~~l~gC~~~p~~~   25 (452)
                      ..+..+...+|+||+..++..
T Consensus        10 ~VL~~a~~allagCAs~d~~~   30 (224)
T COG5461          10 SVLLVAATALLAGCASRDPST   30 (224)
T ss_pred             HHHHHHHHHHHHHCCCCCCCC
T ss_conf             899999999863213689655


No 121
>pfam07269 consensus
Probab=50.90  E-value=13  Score=15.30  Aligned_cols=17  Identities=35%  Similarity=0.616  Sum_probs=10.1

Q ss_pred             HHHHHHHHHHHHHCCCC
Q ss_conf             99999999997502689
Q gi|254780930|r    6 AIFSLFIVLLAGCTVGP   22 (452)
Q Consensus         6 ~~~~l~~~~l~gC~~~p   22 (452)
                      ..++++++.|+||.+..
T Consensus         3 y~ll~l~l~LAgC~T~d   19 (55)
T pfam07269         3 YCLLLLILALAGCQTND   19 (55)
T ss_pred             HHHHHHHHHHHHCCCCC
T ss_conf             14999999987511467


No 122
>pfam02999 Borrelia_orfD Borrelia orf-D family. Borrelia burgdorferi supercoiled plasmids encode multicopy tandem open reading frames called Orf-A, Orf-B, Orf-C and Orf-D. This family corresponds to Orf-D. The putative product of this gene has no known function.
Probab=50.62  E-value=14  Score=15.08  Aligned_cols=21  Identities=24%  Similarity=0.512  Sum_probs=12.4

Q ss_pred             CHHHHHHHHHHHHHHHCCCCC
Q ss_conf             069999999999975026899
Q gi|254780930|r    3 ILRAIFSLFIVLLAGCTVGPE   23 (452)
Q Consensus         3 ~~~~~~~l~~~~l~gC~~~p~   23 (452)
                      +++.+.+++++++-+|.+.|.
T Consensus         1 ~lk~~~~ll~~l~lsC~tIaS   21 (117)
T pfam02999         1 MLKLLNLLLLLLILSCTTIAS   21 (117)
T ss_pred             CHHHHHHHHHHHHHHHCCCCC
T ss_conf             912899999999999434356


No 123
>COG3009 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=49.20  E-value=14  Score=15.04  Aligned_cols=19  Identities=37%  Similarity=0.707  Sum_probs=12.6

Q ss_pred             HHHHHHHHHHHHHHCC-CCC
Q ss_conf             9999999999975026-899
Q gi|254780930|r    5 RAIFSLFIVLLAGCTV-GPE   23 (452)
Q Consensus         5 ~~~~~l~~~~l~gC~~-~p~   23 (452)
                      +-+.++.+++|+||+. .|.
T Consensus         3 ~wl~~~aal~L~~Cas~~p~   22 (190)
T COG3009           3 RWLMIIAALLLAGCASGEPS   22 (190)
T ss_pred             HHHHHHHHHHHHHCCCCCCC
T ss_conf             37999999998753799988


No 124
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL. Members of this protein family are YfgL, a lipoprotein component of a complex that acts protein insertion into the bacterial outer membrane. Other members of this complex are NlpB, YfiO, and YaeT. This protein contains multiple copies of a repeat that, in other contexts, are associated with binding of the coenzyme PQQ.
Probab=48.85  E-value=15  Score=14.90  Aligned_cols=15  Identities=33%  Similarity=0.660  Sum_probs=10.1

Q ss_pred             HHHHHHHHHHHHHCC
Q ss_conf             999999999975026
Q gi|254780930|r    6 AIFSLFIVLLAGCTV   20 (452)
Q Consensus         6 ~~~~l~~~~l~gC~~   20 (452)
                      .++++++++|+||+.
T Consensus         4 ~~~~~~~~~l~gCs~   18 (377)
T TIGR03300         4 ALVIALAALLSGCSW   18 (377)
T ss_pred             HHHHHHHHHHHHCCC
T ss_conf             899999999855657


No 125
>COG5510 Predicted small secreted protein [Function unknown]
Probab=48.32  E-value=13  Score=15.18  Aligned_cols=14  Identities=43%  Similarity=0.619  Sum_probs=8.8

Q ss_pred             HHHHHHHHHHHHHC
Q ss_conf             99999999997502
Q gi|254780930|r    6 AIFSLFIVLLAGCT   19 (452)
Q Consensus         6 ~~~~l~~~~l~gC~   19 (452)
                      .+++++.++|+||-
T Consensus        10 ~~vll~s~llaaCN   23 (44)
T COG5510          10 ALVLLASTLLAACN   23 (44)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999998866


No 126
>PRK06481 fumarate reductase flavoprotein subunit; Validated
Probab=48.21  E-value=15  Score=14.83  Aligned_cols=15  Identities=27%  Similarity=0.638  Sum_probs=9.5

Q ss_pred             HHHHHHHHHHCCCCC
Q ss_conf             999999975026899
Q gi|254780930|r    9 SLFIVLLAGCTVGPE   23 (452)
Q Consensus         9 ~l~~~~l~gC~~~p~   23 (452)
                      +++.++|+||+....
T Consensus        12 ~~~~~~~~~c~~~~~   26 (506)
T PRK06481         12 LLLALILTGCGSNTT   26 (506)
T ss_pred             HHHHHHHHHCCCCCC
T ss_conf             999999865079999


No 127
>PRK11616 hypothetical protein; Provisional
Probab=47.91  E-value=15  Score=14.80  Aligned_cols=30  Identities=20%  Similarity=0.221  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             999999999997502689999999564750
Q gi|254780930|r    5 RAIFSLFIVLLAGCTVGPEYTKPHMPLLPT   34 (452)
Q Consensus         5 ~~~~~l~~~~l~gC~~~p~~~~p~~~~~~~   34 (452)
                      .++++..+++++||+..-....|.....|.
T Consensus         7 ~f~~~~g~l~~sGCSSvMtHtG~~qGyY~G   36 (109)
T PRK11616          7 AFMICSGMLLLSGCSSVMSHTGGKEGTYPG   36 (109)
T ss_pred             HHHHHHHHHHHCCCHHHHCCCCCCCCCCCC
T ss_conf             799985899875751230114798885666


No 128
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only]
Probab=47.67  E-value=15  Score=14.78  Aligned_cols=21  Identities=29%  Similarity=0.362  Sum_probs=13.7

Q ss_pred             CCCHH-HHHHHHHHHHHHHCCC
Q ss_conf             93069-9999999999750268
Q gi|254780930|r    1 MNILR-AIFSLFIVLLAGCTVG   21 (452)
Q Consensus         1 M~~~~-~~~~l~~~~l~gC~~~   21 (452)
                      |+..+ -+.|+.++.|+||+..
T Consensus         1 mk~f~~~~~~~~~~~LagC~~~   22 (297)
T COG4785           1 MKPFLRWCFVATALTLAGCSNQ   22 (297)
T ss_pred             CCCHHHHHHHHHHHHHHHHHCC
T ss_conf             9604778999999987753046


No 129
>PRK09810 entericidin A; Provisional
Probab=47.06  E-value=12  Score=15.52  Aligned_cols=21  Identities=33%  Similarity=0.521  Sum_probs=12.9

Q ss_pred             CCCHHHHHHHHHHHHHHHCCC
Q ss_conf             930699999999999750268
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTVG   21 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~~   21 (452)
                      ||.+-.++++...+|.||-+.
T Consensus         2 mkrli~lil~~~~ll~gcnta   22 (41)
T PRK09810          2 MKRLIVLVLLASTLLTGCNTA   22 (41)
T ss_pred             HHHHHHHHHHHHHHHHCCCCC
T ss_conf             389999999999998256212


No 130
>PRK13733 conjugal transfer protein TraV; Provisional
Probab=46.59  E-value=2  Score=20.57  Aligned_cols=19  Identities=32%  Similarity=0.639  Sum_probs=13.3

Q ss_pred             CCCHHHHHHH-HHHHHHHHC
Q ss_conf             9306999999-999997502
Q gi|254780930|r    1 MNILRAIFSL-FIVLLAGCT   19 (452)
Q Consensus         1 M~~~~~~~~l-~~~~l~gC~   19 (452)
                      ||.+..+++| .+++|+||+
T Consensus         1 mk~~~~l~~l~~~llLtGCA   20 (171)
T PRK13733          1 MKKISLLIPLLGTLLLSGCA   20 (171)
T ss_pred             CCEEEEEHHHCCEEEEECCC
T ss_conf             95167511202600260245


No 131
>TIGR02898 spore_YhcN_YlaJ sporulation lipoprotein,  YhcN/YlaJ family; InterPro: IPR014247   This entry contains YhcN and YlaJ, which are predicted lipoproteins that have been detected as spore proteins but not vegetative proteins in Bacillus subtilis. Both appear to be expressed under control of the RNA polymerase sigma-G factor. The YlaJ-like members of this family have a low-complexity, strongly acidic, 40-residue C-terminal domain. .
Probab=46.34  E-value=13  Score=15.35  Aligned_cols=18  Identities=39%  Similarity=0.735  Sum_probs=11.3

Q ss_pred             HHHHHHHHHH--HHHCCCCC
Q ss_conf             9999999999--75026899
Q gi|254780930|r    6 AIFSLFIVLL--AGCTVGPE   23 (452)
Q Consensus         6 ~~~~l~~~~l--~gC~~~p~   23 (452)
                      +++++++++|  +||+....
T Consensus         3 ~~~ll~~~~l~~tgC~~~~~   22 (185)
T TIGR02898         3 FIILLLLLLLLATGCTNAQK   22 (185)
T ss_pred             HHHHHHHHHHHHHCCCCCCC
T ss_conf             88999999998731341001


No 132
>cd07618 BAR_Rich1 The Bin/Amphiphysin/Rvs (BAR) domain of RhoGAP interacting with CIP4 homologs protein 1. BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. RhoGAP interacting with CIP4 homologs protein 1 (Rich1) is also called Neuron-associated developmentally-regulated protein (Nadrin) or Rho GTPase activating protein 17 (ARHGAP17). It is a Cdc42- and Rac-specific GAP that binds to polarity proteins through the scaffold protein angiomotin and plays a role in maintaining the integrity of tight junctions. It may be a component of a sorting mechanism in the recycling of tight junction transmembrane proteins. Rich1 contains an N-terminal BAR domain followed by a Rho GAP domain and a C-terminal proline-rich domain. It interacts with the BAR domain proteins endophilin and amphiphysin through its proline-rich region. The BAR domain of Rich1 forms oligomers and can bind membranes and induce membrane tubulation.
Probab=46.23  E-value=16  Score=14.64  Aligned_cols=54  Identities=11%  Similarity=0.031  Sum_probs=27.8

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999987188328999999999999999999999999999999999
Q gi|254780930|r  388 HAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYI  444 (452)
Q Consensus       388 ~~~~~a~~~~~~~~~~y~~G~~~~~dll~a~~~~~~a~~~~~~a~~~~~~a~~~L~~  444 (452)
                      ..++.+..-++..+..+..   +.+.++..+.++.+--..++.++.+|....+.++.
T Consensus       167 eEleea~~K~E~~kd~~~~---~M~~~l~~E~e~a~~l~~lve~Q~~YHr~al~~Le  220 (246)
T cd07618         167 EEMDEAGNKVEQCKDQLAA---DMYNFASKEGEYAKFFVLLLEAQADYHRKALAVIE  220 (246)
T ss_pred             HHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             8999999999988999999---99999874799999999999999999999999999


No 133
>PRK10568 periplasmic protein; Provisional
Probab=45.99  E-value=5.7  Score=17.56  Aligned_cols=29  Identities=21%  Similarity=0.257  Sum_probs=23.0

Q ss_pred             HHHCCHHHHHHHHHHHHHCHHHHHHHHHH
Q ss_conf             66099879999999997089989999999
Q gi|254780930|r   54 ESFNDTSLNKLVKIALQQNLTILQATERI   82 (452)
Q Consensus        54 ~~~~d~~L~~~i~~Al~~np~l~~a~~~i   82 (452)
                      ...+|..+..=|..+|..+++++.....+
T Consensus        54 ~~iDD~~It~KVkaal~~d~~lk~~~I~V   82 (203)
T PRK10568         54 NFMDDSAITAKVKAALVDHDNIKSTDISV   82 (203)
T ss_pred             CCCCCHHHHHHHHHHHHCCCCCCCCEEEE
T ss_conf             51260999999999985388866413799


No 134
>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family; InterPro: IPR005705    This family contains gamma proteobacterial proteins involved in ATP-dependent capsule polysaccharide export , .; GO: 0015542 sugar efflux transmembrane transporter activity, 0006859 extracellular carbohydrate transport, 0009276 1-2nm peptidoglycan-based cell wall.
Probab=45.94  E-value=16  Score=14.61  Aligned_cols=140  Identities=14%  Similarity=0.170  Sum_probs=71.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             788999999999999999987876-----554323456777653222355798999999856888876877639992130
Q gi|254780930|r  170 FKERISIAHQILDLYKKNIELSHL-----KFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEF  244 (452)
Q Consensus       170 ~~~~~~i~~~~~~~~~~~~~~~~~-----r~~~G~~~~~d~~~a~~~~~~~~~~l~~~~~~~~~a~~~L~~l~G~~~~~~  244 (452)
                      .++++..+++.++.+++.++..+.     |...+..      .-+++..-.-.-+...+.++...+.+|..|.-..++  
T Consensus       169 ~~d~~~FaE~~V~~A~~~l~~~~~~L~~yq~~n~~~------Dp~~qs~a~~~Lis~l~~eLi~~~a~L~QL~s~~~~--  240 (364)
T TIGR01010       169 RKDTIAFAEEEVKEAEQRLNATKAELLKYQIKNKVL------DPKAQSEAQLSLISTLEGELIRVQAQLAQLRSITPE--  240 (364)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC------CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC--
T ss_conf             999999999999999998999999999989854787------807899999999997986699999989986650666--


Q ss_pred             CCCCCCCCCCCCCCHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCEE
Q ss_conf             00123455443310012210488789973023455655589999643010112222100112222112234454454104
Q gi|254780930|r  245 LHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHW  324 (452)
Q Consensus       245 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~RPdi~~a~~~~~~a~~~i~~a~a~~~P~i~l~~~~~~~~~~~~~~~~~~~  324 (452)
                                                   .+|-|..+..++++-+++|+..+..      |+|.-|   ++.....    
T Consensus       241 -----------------------------~nPqv~~L~~r~~sL~K~ideq~~~------l~g~~G---~~~~~~~----  278 (364)
T TIGR01010       241 -----------------------------DNPQVPSLQARIKSLRKQIDEQRKK------LSGGQG---GDSLNEQ----  278 (364)
T ss_pred             -----------------------------CCCHHHHHHHHHHHHHHHHHHHHHH------HHCCCC---HHHHHHH----
T ss_conf             -----------------------------7854389999999999999999998------625664---0689999----


Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             43112234510124566567799999999999999999999999
Q gi|254780930|r  325 SFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKE  368 (452)
Q Consensus       325 ~~g~~l~~Pif~gg~~~a~i~~a~~~~~~a~~~~~~~~~~a~~e  368 (452)
                      ++       -|  -+.+.+..-|+.++..+...+++|...|.++
T Consensus       279 ~a-------~y--~~l~l~~elA~~~~~~altSLq~tr~EA~R~  313 (364)
T TIGR01010       279 TA-------DY--QRLVLQNELAQQQLKAALTSLQQTRVEADRQ  313 (364)
T ss_pred             HH-------HH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98-------99--9999999999999999999899878888887


No 135
>PRK11162 mltA murein transglycosylase A; Provisional
Probab=45.82  E-value=16  Score=14.60  Aligned_cols=80  Identities=13%  Similarity=0.148  Sum_probs=35.2

Q ss_pred             CHHHHHHHHHHHHHHHCCCCCCCCCCC--CCCCCCCCCCCC-CCCCCCCCHHHHHHHCCHHHHHHHHHHHHHCHHHHHHH
Q ss_conf             069999999999975026899999995--647501024677-66667686234366099879999999997089989999
Q gi|254780930|r    3 ILRAIFSLFIVLLAGCTVGPEYTKPHM--PLLPTQFSIGNS-KNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQAT   79 (452)
Q Consensus         3 ~~~~~~~l~~~~l~gC~~~p~~~~p~~--~~~~~~~~~~~~-~~~~~~~~~~ww~~~~d~~L~~~i~~Al~~np~l~~a~   79 (452)
                      .++.++.+++++|+||+..|....+.-  ............ ........      +.  ....=++.....+|.+....
T Consensus         3 ~~~~~~~~~~~~l~~c~~~p~~~g~qy~~~~~~~~l~~v~~~~~~~~~~~------~~--~f~~q~~~v~~~s~~l~~~~   74 (362)
T PRK11162          3 VKYLLMGIVVALLAACSSKPTDRGQQYKDGKFTQPLSLVNQPDASGKPIN------AG--DFAEQVNNIRNSSPRLYNRY   74 (362)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC------HH--HHHHHHHHHHHHCHHHHHHH
T ss_conf             89999999999997604798766755557844776531038664678356------88--99999999986393766654


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999999
Q gi|254780930|r   80 ERINAAKENIL   90 (452)
Q Consensus        80 ~~i~~a~~~~~   90 (452)
                      ..+-.+-.+..
T Consensus        75 ~~~y~~~~~w~   85 (362)
T PRK11162         75 SNLYNAVQEWL   85 (362)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999999


No 136
>pfam11873 DUF3393 Domain of unknown function (DUF3393). This domain is functionally uncharacterized. This domain is found in bacteria. This presumed domain is typically between 188 to 206 amino acids in length. This domain is found associated with pfam01464.
Probab=45.64  E-value=16  Score=14.71  Aligned_cols=16  Identities=31%  Similarity=0.638  Sum_probs=9.7

Q ss_pred             HHHHHHHHHHHHCCCC
Q ss_conf             9999999997502689
Q gi|254780930|r    7 IFSLFIVLLAGCTVGP   22 (452)
Q Consensus         7 ~~~l~~~~l~gC~~~p   22 (452)
                      ++++++++|+||+..+
T Consensus         5 ~~~~~~llL~~Cs~~~   20 (200)
T pfam11873         5 SLLLILLLLSGCSSQF   20 (200)
T ss_pred             HHHHHHHHHHHCCCCC
T ss_conf             7999999984157765


No 137
>COG5645 Predicted periplasmic lipoprotein [General function prediction only]
Probab=45.35  E-value=13  Score=15.28  Aligned_cols=20  Identities=25%  Similarity=0.444  Sum_probs=10.5

Q ss_pred             CCCHHHHHHHHHHHHHHHCCC
Q ss_conf             930699999999999750268
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTVG   21 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~~   21 (452)
                      |++.-.. +...++|+||+..
T Consensus         1 mr~i~l~-l~v~lllSGC~SV   20 (80)
T COG5645           1 MRNILLS-LMVLLLLSGCGSV   20 (80)
T ss_pred             CCEEHHH-HHHHHHHCCCCEE
T ss_conf             9153278-9999983764103


No 138
>COG5468 Predicted secreted (periplasmic) protein [Function unknown]
Probab=44.86  E-value=17  Score=14.53  Aligned_cols=25  Identities=24%  Similarity=0.525  Sum_probs=17.2

Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             9999999999975026899999995
Q gi|254780930|r    5 RAIFSLFIVLLAGCTVGPEYTKPHM   29 (452)
Q Consensus         5 ~~~~~l~~~~l~gC~~~p~~~~p~~   29 (452)
                      +....+.+++|+||.+.|-|..|..
T Consensus         7 ~va~a~S~~~l~~C~v~PLYsg~~a   31 (172)
T COG5468           7 RVALAFSLATLTACQVRPLYSGERA   31 (172)
T ss_pred             HHHHHHHHHHHHCCEEEECCCCCCC
T ss_conf             9999999998631145541357875


No 139
>PRK11530 hypothetical protein; Provisional
Probab=44.30  E-value=11  Score=15.60  Aligned_cols=16  Identities=25%  Similarity=0.484  Sum_probs=10.2

Q ss_pred             HHHHHHHHHHHHHHHC
Q ss_conf             6999999999997502
Q gi|254780930|r    4 LRAIFSLFIVLLAGCT   19 (452)
Q Consensus         4 ~~~~~~l~~~~l~gC~   19 (452)
                      +|..++-++++|+||+
T Consensus         3 ~~~~ll~sll~LsgCa   18 (176)
T PRK11530          3 LRLLLLGSLLSLSACA   18 (176)
T ss_pred             EEHHHHHHHHHHHHCC
T ss_conf             0034888999986424


No 140
>PRK00178 tolB translocation protein TolB; Provisional
Probab=44.25  E-value=17  Score=14.44  Aligned_cols=19  Identities=21%  Similarity=0.354  Sum_probs=9.2

Q ss_pred             CCCHHH-HHHHHHHHHHHHC
Q ss_conf             930699-9999999997502
Q gi|254780930|r    1 MNILRA-IFSLFIVLLAGCT   19 (452)
Q Consensus         1 M~~~~~-~~~l~~~~l~gC~   19 (452)
                      |+.|+. +++++++++++++
T Consensus         1 m~~l~~~~~l~~~l~~~~~a   20 (433)
T PRK00178          1 MIKLKRIALLVLCLLAGGAA   20 (433)
T ss_pred             CCCHHHHHHHHHHHHHHHHH
T ss_conf             90179999999999876762


No 141
>PRK04517 hypothetical protein; Provisional
Probab=43.88  E-value=16  Score=14.70  Aligned_cols=21  Identities=14%  Similarity=0.509  Sum_probs=16.2

Q ss_pred             CCCHHHHHHHHHHHHHHHCCC
Q ss_conf             930699999999999750268
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTVG   21 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~~   21 (452)
                      ||+.+.+.+++++++++++..
T Consensus         1 MK~~~~~~~ll~l~~s~sa~A   21 (216)
T PRK04517          1 MKLIKPLTCLLALAMSGSAFA   21 (216)
T ss_pred             CCCHHHHHHHHHHHHHHHHHH
T ss_conf             960279999999997135533


No 142
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family. Members of this protein family are bacterial lipoproteins largely from the Gammaproteobacteria. Characterized members are expressed in extracellularly and have esterase activity. Members include the lipase Pla-1 from Aeromonas hydrophila (AF092033) and CHO cell elongation factor (cef) from Vibrio hollisae
Probab=43.39  E-value=16  Score=14.74  Aligned_cols=19  Identities=32%  Similarity=0.429  Sum_probs=13.6

Q ss_pred             CCCHHHHHHHHH-HHHHHHC
Q ss_conf             930699999999-9997502
Q gi|254780930|r    1 MNILRAIFSLFI-VLLAGCT   19 (452)
Q Consensus         1 M~~~~~~~~l~~-~~l~gC~   19 (452)
                      ||++.+.+.++. +.|+||-
T Consensus         1 MKk~~l~~~iasal~LagCG   20 (792)
T TIGR03502         1 MKKLLLSLAIASALGLAGCG   20 (792)
T ss_pred             CCHHHHHHHHHHHHHHHCCC
T ss_conf             93378999999987500457


No 143
>PRK01904 hypothetical protein; Provisional
Probab=43.36  E-value=16  Score=14.60  Aligned_cols=27  Identities=15%  Similarity=0.176  Sum_probs=18.3

Q ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             930699999999999750268999999
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTVGPEYTKP   27 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~~p~~~~p   27 (452)
                      ||+...++++++++.++|+......-|
T Consensus         1 MK~~~~~~al~~l~~S~~a~A~tL~lp   27 (217)
T PRK01904          1 MKLRAAALAVATLLTSTASFAGMVTTS   27 (217)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             970079999999986089887514078


No 144
>COG3218 ABC-type uncharacterized transport system, auxiliary component [General function prediction only]
Probab=42.94  E-value=18  Score=14.31  Aligned_cols=11  Identities=36%  Similarity=0.609  Sum_probs=7.4

Q ss_pred             HHHHHHHHHHC
Q ss_conf             99999997502
Q gi|254780930|r    9 SLFIVLLAGCT   19 (452)
Q Consensus         9 ~l~~~~l~gC~   19 (452)
                      +.++++|+||.
T Consensus        17 la~~a~L~gC~   27 (205)
T COG3218          17 LALAATLAGCG   27 (205)
T ss_pred             HHHHHHHHCCC
T ss_conf             99999972347


No 145
>TIGR01004 PulS_OutS lipoprotein, PulS/OutS family; InterPro: IPR005699    This family comprises lipoproteins from four gamma proteobacterial species: PulS protein of Klebsiella pneumoniae (P20440 from SWISSPROT), the OutS protein of Erwinia chrysanthemi (Q01567 from SWISSPROT) and Pectobacterium chrysanthemi, and the functionally uncharacterised E. coli protein EtpO. PulS and OutS have been shown to interact with and facilitate insertion of secretins into the outer membrane, suggesting a chaperone-like, or piloting function for members of this family.; GO: 0008565 protein transporter activity, 0006886 intracellular protein transport.
Probab=42.76  E-value=18  Score=14.29  Aligned_cols=15  Identities=40%  Similarity=0.795  Sum_probs=10.2

Q ss_pred             HHHHHHHHHHHHHCC
Q ss_conf             999999999975026
Q gi|254780930|r    6 AIFSLFIVLLAGCTV   20 (452)
Q Consensus         6 ~~~~l~~~~l~gC~~   20 (452)
                      +++.++++.|+||-+
T Consensus        12 ~~~~~~~v~lsgCqt   26 (136)
T TIGR01004        12 VLSLLVVVLLSGCQT   26 (136)
T ss_pred             HHHHHHHHHHHHCCC
T ss_conf             999999998640478


No 146
>TIGR00998 8a0101 efflux pump membrane protein; InterPro: IPR005694    emrA and emrB confer resistance to carbonylcyanide m-chlorophenylhydrazone, nalidixic acid, and a number of other toxic compounds. EmrB encodes a highly hydrophobic 56.2-kDa peptide, with 14 potential alpha-helices to span the inner membrane. EmrA encodes a putative 42.7-kDa peptide containing a single hydrophobic domain and a large C-terminal hydrophilic domain.; GO: 0015238 drug transporter activity, 0006855 multidrug transport, 0009276 1-2nm peptidoglycan-based cell wall.
Probab=42.26  E-value=18  Score=14.25  Aligned_cols=68  Identities=15%  Similarity=0.169  Sum_probs=52.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99987666677788999999999999999987876554323456---777653222355798999999856
Q gi|254780930|r  159 KLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSK---LSLVKLEAEIKSIESDIPTLEKSF  226 (452)
Q Consensus       159 ~v~~aY~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~G~~~~---~d~~~a~~~~~~~~~~l~~~~~~~  226 (452)
                      +|-..=..+..+++.+.-.++.++..+--++.-+...+.|.++.   -|+.+++-.+..+++.|..+.+++
T Consensus       121 ~v~s~~~~~~qar~~l~qae~~~~~~~~dl~Rr~~L~~~G~I~~RkFE~l~~ar~a~~~a~A~L~aa~~~I  191 (379)
T TIGR00998       121 KVESLKIKLEQAREKLKQAEEKIKLVKLDLRRRVPLLKKGLISRRKFEELDHARKALLSAKAALNAAIQEI  191 (379)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             89999999999999987678765653215353488984789987544434768999999998788998543


No 147
>TIGR03042 PS_II_psbQ_bact photosystem II protein PsbQ. This protein through the member sll1638 from Synechocystis sp. PCC 6803, was shown to be part of the cyanobacteria photosystem II. It is homologous to (but quite diverged from) the chloroplast PsbQ protein, called oxygen-evolving enhancer protein 3 (OEE3). We designate this cyanobacteria protein PsbQ by homology.
Probab=41.88  E-value=19  Score=14.21  Aligned_cols=12  Identities=25%  Similarity=0.813  Sum_probs=7.5

Q ss_pred             HHHHHHHHHHHC
Q ss_conf             999999997502
Q gi|254780930|r    8 FSLFIVLLAGCT   19 (452)
Q Consensus         8 ~~l~~~~l~gC~   19 (452)
                      +++++++|.+|+
T Consensus         9 L~~~~~fLvsC~   20 (142)
T TIGR03042         9 LVLLLTFLVSCS   20 (142)
T ss_pred             HHHHHHHHHHCC
T ss_conf             999999998838


No 148
>pfam10671 TcpQ Toxin co-regulated pilus biosynthesis protein Q. The toxin-coregulated pilus (TCP) of Vibrio cholerae and the soluble TcpF protein that is secreted via the TCP biogenesis apparatus are essential for intestinal colonisation in the disease of cholera. TcpQ is part of an outer membrane complex of the TCP biogenesis apparatus, comprised of TcpC and TcpQ, and the TcpQ is required for proper localisation of TcpC to the outer membrane.
Probab=40.96  E-value=14  Score=15.12  Aligned_cols=21  Identities=24%  Similarity=0.336  Sum_probs=14.2

Q ss_pred             CCCHHHHHHHHHHHHHHHCCC
Q ss_conf             930699999999999750268
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTVG   21 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~~   21 (452)
                      ||.-..+..++.++++||+..
T Consensus         1 mkknyii~~~iaii~sgcssi   21 (178)
T pfam10671         1 MKKNYIIGACIAIILSGCSSI   21 (178)
T ss_pred             CCCCEEEHHHHHHHHCCCCCH
T ss_conf             975243154599996576302


No 149
>pfam08085 Entericidin Entericidin EcnA/B family. This family consists of the entericidin antidote/toxin peptides. The entericidin locus is activated in stationary phase under high osmolarity conditions by rho-S and simultaneously repressed by the osmoregulatory EnvZ/OmpR signal transduction pathway. The entericidin locus encodes tandem paralogous genes (ecnAB) and directs the synthesis of two small cell-envelope lipoproteins which can maintain plasmids in bacterial population by means of post-segregational killing.
Probab=40.86  E-value=19  Score=14.11  Aligned_cols=20  Identities=40%  Similarity=0.838  Sum_probs=10.1

Q ss_pred             CCCHHHHH-HHHH--HHHHHHCC
Q ss_conf             93069999-9999--99975026
Q gi|254780930|r    1 MNILRAIF-SLFI--VLLAGCTV   20 (452)
Q Consensus         1 M~~~~~~~-~l~~--~~l~gC~~   20 (452)
                      ||.+..++ .+++  ++|+||-+
T Consensus         1 Mk~~~~~~~~l~~~~~~lagCNT   23 (42)
T pfam08085         1 MKKLIALLLALLLLALVLAGCNT   23 (42)
T ss_pred             CHHHHHHHHHHHHHHHHHHCCHH
T ss_conf             92369999999999999861222


No 150
>pfam11353 DUF3153 Protein of unknown function (DUF3153). This family of proteins with unknown function appear to be restricted to Cyanobacteria. Some members are annotated as membrane proteins however this cannot be confirmed.
Probab=40.02  E-value=18  Score=14.38  Aligned_cols=13  Identities=38%  Similarity=0.958  Sum_probs=9.4

Q ss_pred             HHHHHHHHHHHHC
Q ss_conf             9999999997502
Q gi|254780930|r    7 IFSLFIVLLAGCT   19 (452)
Q Consensus         7 ~~~l~~~~l~gC~   19 (452)
                      ++++..++|+||.
T Consensus         3 vlllltlLLSGCV   15 (210)
T pfam11353         3 VLLLLTLLLSGCV   15 (210)
T ss_pred             HHHHHHHHHCCEE
T ss_conf             2999999847818


No 151
>TIGR02269 TIGR02269 Myxococcus xanthus paralogous lipoprotein family TIGR02269; InterPro: IPR011755   This family consists of at least 9 paralogs in Myxococcus xanthus, a member of the Deltaproteobacteria. One appears truncated toward the N-terminus; the others are predicted lipoproteins. The function is unknown..
Probab=40.02  E-value=20  Score=14.02  Aligned_cols=19  Identities=26%  Similarity=0.590  Sum_probs=11.7

Q ss_pred             HHHHHHHHHHHHCCCCCCC
Q ss_conf             9999999997502689999
Q gi|254780930|r    7 IFSLFIVLLAGCTVGPEYT   25 (452)
Q Consensus         7 ~~~l~~~~l~gC~~~p~~~   25 (452)
                      ++.++.++|.||+.++...
T Consensus         3 ~~~lla~ll~GCa~~~~~~   21 (228)
T TIGR02269         3 LLLLLALLLVGCASTAPKS   21 (228)
T ss_pred             HHHHHHHHHHHHCCCCCCC
T ss_conf             7998899987520578778


No 152
>PRK03002 prsA peptidylprolyl isomerase; Reviewed
Probab=39.91  E-value=20  Score=14.01  Aligned_cols=20  Identities=20%  Similarity=0.348  Sum_probs=11.6

Q ss_pred             CCCHHHHH---HHHHHHHHHHCC
Q ss_conf             93069999---999999975026
Q gi|254780930|r    1 MNILRAIF---SLFIVLLAGCTV   20 (452)
Q Consensus         1 M~~~~~~~---~l~~~~l~gC~~   20 (452)
                      |+...+++   ++++++|+||+.
T Consensus         1 mkkK~i~~~~~~~svl~LaaC~~   23 (285)
T PRK03002          1 MRGKHIFIITALISILMLSACGQ   23 (285)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHCC
T ss_conf             96018999999999999998457


No 153
>PRK03095 prsA peptidylprolyl isomerase; Reviewed
Probab=38.85  E-value=21  Score=13.91  Aligned_cols=20  Identities=15%  Similarity=0.303  Sum_probs=12.2

Q ss_pred             CCCHHHHH-HHHHHHHHHHCC
Q ss_conf             93069999-999999975026
Q gi|254780930|r    1 MNILRAIF-SLFIVLLAGCTV   20 (452)
Q Consensus         1 M~~~~~~~-~l~~~~l~gC~~   20 (452)
                      |+.+.+.+ +++++.|+||+.
T Consensus         1 MKK~~la~~~~svl~LaaC~~   21 (287)
T PRK03095          1 MKKAMLALAATSVIALSACGT   21 (287)
T ss_pred             CCHHHHHHHHHHHHHHHHCCC
T ss_conf             907899999999999985168


No 154
>TIGR01781 Trep_dent_lipo Treponema denticola clustered lipoprotein; InterPro: IPR010103   This entry represents a family of six predicted lipoproteins from a region of about 20 tandemly arranged genes in the Treponema denticola genome. Two other neighbouring genes share the lipoprotein signal peptide region but do not show more extensive homology. The function of this locus is unknown..
Probab=38.77  E-value=20  Score=14.05  Aligned_cols=18  Identities=39%  Similarity=0.687  Sum_probs=12.8

Q ss_pred             CHHHHHHHHHH-HHHHHCC
Q ss_conf             06999999999-9975026
Q gi|254780930|r    3 ILRAIFSLFIV-LLAGCTV   20 (452)
Q Consensus         3 ~~~~~~~l~~~-~l~gC~~   20 (452)
                      .++.||+|+++ +|.+|+-
T Consensus         5 KlKlIFIL~LAvLLFSC~k   23 (463)
T TIGR01781         5 KLKLIFILMLAVLLFSCKK   23 (463)
T ss_pred             HHHHHHHHHHHHHHHCCCC
T ss_conf             0468889999998604762


No 155
>PRK09558 ushA bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor; Reviewed
Probab=37.92  E-value=22  Score=13.81  Aligned_cols=22  Identities=27%  Similarity=0.502  Sum_probs=14.1

Q ss_pred             CCCHHHHHHHHH-HHHHHHCCCC
Q ss_conf             930699999999-9997502689
Q gi|254780930|r    1 MNILRAIFSLFI-VLLAGCTVGP   22 (452)
Q Consensus         1 M~~~~~~~~l~~-~~l~gC~~~p   22 (452)
                      ||++|.++.+++ +.|++|+...
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~   24 (551)
T PRK09558          2 MKLLKGLVALALLAALALCGSTA   24 (551)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             25899999999999987406766


No 156
>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones]
Probab=37.74  E-value=22  Score=13.79  Aligned_cols=21  Identities=19%  Similarity=0.542  Sum_probs=14.4

Q ss_pred             CCCHHHHHHHHHHHHHHHCCC
Q ss_conf             930699999999999750268
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTVG   21 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~~   21 (452)
                      ||.+.+++.++.+++++|++.
T Consensus         2 mRvl~i~Lliis~fl~a~~s~   22 (182)
T COG2143           2 MRVLLIVLLIISLFLSACKSN   22 (182)
T ss_pred             CCHHHHHHHHHHHHHHHHHCC
T ss_conf             001999999999999997178


No 157
>COG4380 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=36.97  E-value=22  Score=13.72  Aligned_cols=13  Identities=23%  Similarity=0.452  Sum_probs=8.4

Q ss_pred             HHHHHHHHHHCCC
Q ss_conf             9999999750268
Q gi|254780930|r    9 SLFIVLLAGCTVG   21 (452)
Q Consensus         9 ~l~~~~l~gC~~~   21 (452)
                      +..+++|+||.+.
T Consensus         8 ~~~vl~ls~c~~~   20 (216)
T COG4380           8 LAAVLALSACQVQ   20 (216)
T ss_pred             HHHHHHHHHCCCC
T ss_conf             9999998653577


No 158
>PRK10564 maltose regulon periplasmic protein; Provisional
Probab=36.17  E-value=23  Score=13.64  Aligned_cols=27  Identities=26%  Similarity=0.491  Sum_probs=12.9

Q ss_pred             HHHHHHHHHHHHHHHH--HHHHHHHHHHH
Q ss_conf             9999999999999999--99999999999
Q gi|254780930|r  352 QEQYITWQETVLNAIK--EVENALTSINE  378 (452)
Q Consensus       352 ~~a~~~~~~~~~~a~~--ev~~a~~~~~~  378 (452)
                      ...+.-|.+.+.+++.  ||..|+.-+..
T Consensus       254 ~dTe~Yy~~aI~~AVk~~DI~KAL~LldE  282 (303)
T PRK10564        254 NDTESYFNQAIKDAVKKGDVDKALKLLNE  282 (303)
T ss_pred             CHHHHHHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             33899999999999975999999999999


No 159
>TIGR02522 pilus_cpaD pilus (Caulobacter type) biogenesis lipoprotein CpaD; InterPro: IPR013361    Proteins in this entry consist of a pilus biogenesis protein, CpaD, from Caulobacter, and homologues in other bacteria, including three in the root nodule bacterium Bradyrhizobium japonicum. The molecular function of the homologues is not known..
Probab=35.80  E-value=23  Score=13.60  Aligned_cols=16  Identities=31%  Similarity=0.611  Sum_probs=11.1

Q ss_pred             HHHHHHHHHHHHCCCC
Q ss_conf             9999999997502689
Q gi|254780930|r    7 IFSLFIVLLAGCTVGP   22 (452)
Q Consensus         7 ~~~l~~~~l~gC~~~p   22 (452)
                      +++.++++|+||+..+
T Consensus         3 ~~~a~~~~LagC~~~~   18 (211)
T TIGR02522         3 LLLALTALLAGCASTD   18 (211)
T ss_pred             HHHHHHHHHHHCCCCC
T ss_conf             8988999975305888


No 160
>pfam09619 YscW Type III secretion system lipoprotein chaperone (YscW). This entry is encoded within type III secretion operons. The protein has been characterized as a chaperone for the outer membrane pore component YscC. YscW is a lipoprotein which is itself localized to the outer membrane and, it is believed, facilitates the oligomerisation and localisation of YscC.
Probab=35.77  E-value=17  Score=14.47  Aligned_cols=17  Identities=29%  Similarity=0.626  Sum_probs=9.9

Q ss_pred             HHHHHHHHHCCCCCCCC
Q ss_conf             99999975026899999
Q gi|254780930|r   10 LFIVLLAGCTVGPEYTK   26 (452)
Q Consensus        10 l~~~~l~gC~~~p~~~~   26 (452)
                      +++++|+||.+.|....
T Consensus         3 ~l~~lL~GCVt~p~~~~   19 (124)
T pfam09619         3 PLLLLLTGCVTTPMPKP   19 (124)
T ss_pred             HHHHHHHCCCCCCCCCC
T ss_conf             03324606556777884


No 161
>PRK04405 prsA peptidylprolyl isomerase; Provisional
Probab=35.61  E-value=23  Score=13.58  Aligned_cols=10  Identities=40%  Similarity=0.982  Sum_probs=6.6

Q ss_pred             HHHHHHHHCC
Q ss_conf             9999975026
Q gi|254780930|r   11 FIVLLAGCTV   20 (452)
Q Consensus        11 ~~~~l~gC~~   20 (452)
                      +++.|+||+.
T Consensus        17 ~~l~LaaCss   26 (298)
T PRK04405         17 LLLSLAGCSS   26 (298)
T ss_pred             HHHHHHHCCC
T ss_conf             9999987179


No 162
>PRK12473 hypothetical protein; Provisional
Probab=34.46  E-value=24  Score=13.46  Aligned_cols=22  Identities=14%  Similarity=0.173  Sum_probs=12.5

Q ss_pred             HHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             9999999975026899999995
Q gi|254780930|r    8 FSLFIVLLAGCTVGPEYTKPHM   29 (452)
Q Consensus         8 ~~l~~~~l~gC~~~p~~~~p~~   29 (452)
                      ..+++.+|+||+.-.....|+.
T Consensus        10 a~is~~~ls~CSl~g~~~epAN   31 (193)
T PRK12473         10 AAISFGALSGCSLLGMIAEKAN   31 (193)
T ss_pred             HHHHHHHHCCCHHCCCCCCCCC
T ss_conf             9999998500010488778987


No 163
>PRK11087 hypothetical protein; Provisional
Probab=33.97  E-value=15  Score=14.84  Aligned_cols=33  Identities=12%  Similarity=0.243  Sum_probs=14.3

Q ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             9306999999999997502689999999564750
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPT   34 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~~p~~~~p~~~~~~~   34 (452)
                      ||+ |.+.+..++.|+.|.+.....+.+.|..|.
T Consensus         1 ~~~-~~~~~~~~~~l~~~~~~~~~~a~~~p~~p~   33 (238)
T PRK11087          1 MKL-KVLALAALLGLSASLLAMAAQAAELPDFPH   33 (238)
T ss_pred             CCC-HHHHHHHHHHHHHHHHCCCHHHCCCCCCCE
T ss_conf             930-499999999987766324344347999987


No 164
>cd07595 BAR_RhoGAP_Rich-like The Bin/Amphiphysin/Rvs (BAR) domain of Rich-like Rho GTPase Activating Proteins. BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. This subfamily is composed of Rho and Rac GTPase activating proteins (GAPs) with similarity to GAP interacting with CIP4 homologs proteins (Rich). Members contain an N-terminal BAR domain, followed by a Rho GAP domain, and a C-terminal prolin-rich region. Vertebrates harbor at least three Rho GAPs in this subfamily including Rich1, Rich2, and SH3-domain binding protein 1 (SH3BP1). Rich1 and Rich2 play complementary roles in the establishment and maintenance of cell polarity. Rich1 is a Cdc42- and Rac-specific GAP that binds to polarity proteins through the scaffold protein angiomotin and plays a role in maintaining the integrity of tight junctions. Rich2 is a Rac GAP that interacts with CD317 and plays a role in actin cytoskeleton organization and 
Probab=33.83  E-value=25  Score=13.39  Aligned_cols=53  Identities=17%  Similarity=0.162  Sum_probs=29.6

Q ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999871883289999999999999999999999999999999998
Q gi|254780930|r  390 VELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIA  445 (452)
Q Consensus       390 ~~~a~~~~~~~~~~y~~G~~~~~dll~a~~~~~~a~~~~~~a~~~~~~a~~~L~~A  445 (452)
                      +..++.-++..+..+..   +..++++.+.++.+.-.+++.++.+|+..-+..+..
T Consensus       167 ~~~a~~K~eeskd~~~~---~M~~ll~~E~e~~~~l~~~veaQ~~YH~~a~~~Le~  219 (244)
T cd07595         167 YEEAELKLEQCRDALAT---DMYEFLAKEAEIASYLIDLIEAQREYHRTALSVLEA  219 (244)
T ss_pred             HHHHHHHHHHHHHHHHH---HHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999997999999---999998761999999999999999999999999999


No 165
>PRK02998 prsA peptidylprolyl isomerase; Reviewed
Probab=33.78  E-value=25  Score=13.39  Aligned_cols=19  Identities=16%  Similarity=0.410  Sum_probs=11.4

Q ss_pred             CCCHHHHHHH----HHHHHHHHC
Q ss_conf             9306999999----999997502
Q gi|254780930|r    1 MNILRAIFSL----FIVLLAGCT   19 (452)
Q Consensus         1 M~~~~~~~~l----~~~~l~gC~   19 (452)
                      |+..+.++.+    .++.|+||+
T Consensus         1 Mkkkk~~~~~~~~~~~l~LaaC~   23 (283)
T PRK02998          1 MKKKKLFIGTIISCVVLALSACG   23 (283)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHCC
T ss_conf             93589999999999999998668


No 166
>COG4238 Murein lipoprotein [Cell envelope biogenesis, outer membrane]
Probab=33.64  E-value=25  Score=13.37  Aligned_cols=12  Identities=50%  Similarity=0.744  Sum_probs=7.6

Q ss_pred             HHHHHHHHHHCC
Q ss_conf             999999975026
Q gi|254780930|r    9 SLFIVLLAGCTV   20 (452)
Q Consensus         9 ~l~~~~l~gC~~   20 (452)
                      .+..++|+||+.
T Consensus        12 vlg~lllAGc~s   23 (78)
T COG4238          12 VLGSLLLAGCSS   23 (78)
T ss_pred             HHHHHHHHHCCC
T ss_conf             987799970110


No 167
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein; InterPro: IPR014266   This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system , analogous to the LPXTG/sortase system common in Gram-positive bacteria. The proteins in this entry occur in a species if, and only if, a transmembrane histidine kinase (IPR014265 from INTERPRO) and a DNA-binding response regulator (IPR014264 from INTERPRO) also occur. The present of tetratricopeptide repeats (TPR) suggests they may be involved in protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator..
Probab=33.57  E-value=25  Score=13.37  Aligned_cols=16  Identities=25%  Similarity=0.148  Sum_probs=9.9

Q ss_pred             HHHHCHHHHHHHHHHH
Q ss_conf             9970899899999999
Q gi|254780930|r   68 ALQQNLTILQATERIN   83 (452)
Q Consensus        68 Al~~np~l~~a~~~i~   83 (452)
                      ||+.+|+...+|..+.
T Consensus        55 AL~~~p~~~EARflLg   70 (924)
T TIGR02917        55 ALQKDPNDAEARFLLG   70 (924)
T ss_pred             HHHCCCCCHHHHHHHH
T ss_conf             7740867478899999


No 168
>PRK10175 hypothetical protein; Provisional
Probab=32.90  E-value=23  Score=13.62  Aligned_cols=21  Identities=33%  Similarity=0.593  Sum_probs=12.5

Q ss_pred             HHHHHHHHHHHHCCCCCCCCC
Q ss_conf             999999999750268999999
Q gi|254780930|r    7 IFSLFIVLLAGCTVGPEYTKP   27 (452)
Q Consensus         7 ~~~l~~~~l~gC~~~p~~~~p   27 (452)
                      +..+++++|+||+..-....|
T Consensus         5 ~~~~~~lllsGC~SIms~t~p   25 (75)
T PRK10175          5 VVSIMVTLLSGCGSIISRTIP   25 (75)
T ss_pred             HHHHHHHHHCCCHHHHCCCCC
T ss_conf             888899998164244305577


No 169
>pfam01298 Lipoprotein_5 Transferrin binding protein-like solute binding protein. This family of proteins are distantly related to other families of solute binding proteins.
Probab=32.78  E-value=26  Score=13.28  Aligned_cols=20  Identities=35%  Similarity=0.509  Sum_probs=13.2

Q ss_pred             CCCH--HHHHHHHHHHHHHHCC
Q ss_conf             9306--9999999999975026
Q gi|254780930|r    1 MNIL--RAIFSLFIVLLAGCTV   20 (452)
Q Consensus         1 M~~~--~~~~~l~~~~l~gC~~   20 (452)
                      |++.  ..++.|.+++|++|+-
T Consensus         1 M~~~l~~~~lal~~~LLSAC~G   22 (589)
T pfam01298         1 MNIPLNKLALALAAGLLSACSG   22 (589)
T ss_pred             CCCCCCHHHHHHHHHHHHHHCC
T ss_conf             9656545499999999997346


No 170
>pfam02402 Lysis_col Lysis protein. These small bacterial proteins are required for colicin release and partial cell lysis. This family contains lysis proteins for several different forms of colicin. Bacillus subtilis lytA has been included in this family, the similarity is not highly significant, however it is also a short protein, that is involved in secretion of other proteins (Bateman A pers. obs.).
Probab=31.86  E-value=23  Score=13.63  Aligned_cols=20  Identities=35%  Similarity=0.467  Sum_probs=11.5

Q ss_pred             CCCHHHHH-HHHHHHHHHHCC
Q ss_conf             93069999-999999975026
Q gi|254780930|r    1 MNILRAIF-SLFIVLLAGCTV   20 (452)
Q Consensus         1 M~~~~~~~-~l~~~~l~gC~~   20 (452)
                      ||....++ ++..++|+||-.
T Consensus         1 Mkki~~~~i~~~~~~L~aCQa   21 (46)
T pfam02402         1 MKKILFIGILLLTVLLSACQA   21 (46)
T ss_pred             CCEEEEHHHHHHHHHHHHHHH
T ss_conf             924201399999999998555


No 171
>PRK04168 hypothetical protein; Provisional
Probab=31.70  E-value=13  Score=15.29  Aligned_cols=52  Identities=12%  Similarity=-0.081  Sum_probs=26.5

Q ss_pred             HHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCC
Q ss_conf             7999999999708998999999999999999875420530111011245665
Q gi|254780930|r   60 SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN  111 (452)
Q Consensus        60 ~L~~~i~~Al~~np~l~~a~~~i~~a~~~~~~a~a~~~P~~~~~~~~~~~~~  111 (452)
                      .++++...--+.+|++.....--............+--|.+-+++.+...+.
T Consensus        46 pf~ei~~~Fe~~~p~v~v~~e~~GS~~~ar~Ite~g~~aDVfaSAD~~~i~~   97 (336)
T PRK04168         46 PFEEYEKEFEAYYPNVDVQREAGGSVACVRKITELGKPADILASADYTLIPK   97 (336)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHCCCCCCEEEECCHHHHHH
T ss_conf             9999999999878996599984738999999995799988899898578788


No 172
>PRK11397 dacD D-alanyl-D-alanine carboxypeptidase; Provisional
Probab=31.53  E-value=27  Score=13.15  Aligned_cols=34  Identities=12%  Similarity=0.119  Sum_probs=15.3

Q ss_pred             CCCHHHHHHHHHHH----HHHHCCCCCCCCCCCCCCCC
Q ss_conf             93069999999999----97502689999999564750
Q gi|254780930|r    1 MNILRAIFSLFIVL----LAGCTVGPEYTKPHMPLLPT   34 (452)
Q Consensus         1 M~~~~~~~~l~~~~----l~gC~~~p~~~~p~~~~~~~   34 (452)
                      |.|+|.++++++++    ...|........|+.|.+.+
T Consensus         1 m~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~P~i~A   38 (390)
T PRK11397          1 MLLKRRLIIAASLFVFNLSSAFAAENIPFSPQPPAIDA   38 (390)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC
T ss_conf             94378999999999999999874045778999996553


No 173
>pfam06316 Ail_Lom Enterobacterial Ail/Lom protein. This family consists of several bacterial and phage Ail/Lom-like proteins. The Yersinia enterocolitica Ail protein is a known virulence factor. Proteins in this family are predicted to consist of eight transmembrane beta-sheets and four cell surface-exposed loops. It is thought that Ail directly promotes invasion and loop 2 contains an active site, perhaps a receptor-binding domain. The phage protein Lom is expressed during lysogeny, and encode host-cell envelope proteins. Lom is found in the bacterial outer membrane, and is homologous to virulence proteins of two other enterobacterial genera. It has been suggested that lysogeny may generally have a role in bacterial survival in animal hosts, and perhaps in pathogenesis.
Probab=31.00  E-value=28  Score=13.09  Aligned_cols=20  Identities=25%  Similarity=0.127  Sum_probs=14.5

Q ss_pred             CCCHHHHHHHHHHHHHHHCC
Q ss_conf             93069999999999975026
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTV   20 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~   20 (452)
                      ||.+-..++++.++|++|.+
T Consensus         1 m~~~~~~~l~~~~~l~~~~~   20 (199)
T pfam06316         1 MRKLCAAILSAAICLAAAGT   20 (199)
T ss_pred             CCHHHHHHHHHHHHHHHHCC
T ss_conf             90177899999999997277


No 174
>PRK10653 D-ribose transporter subunit RbsB; Provisional
Probab=29.64  E-value=29  Score=12.95  Aligned_cols=21  Identities=19%  Similarity=0.159  Sum_probs=14.2

Q ss_pred             CCCHHHHHHHHHHHHHHHCCC
Q ss_conf             930699999999999750268
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTVG   21 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~~   21 (452)
                      |||.|....++.+.++.|...
T Consensus         1 ~~~~k~~~~~~~~~~~~~~~a   21 (295)
T PRK10653          1 MNMKKLATLVSAVALSATVSA   21 (295)
T ss_pred             CCHHHHHHHHHHHHHHHHCCC
T ss_conf             970799999999987652121


No 175
>pfam12563 Hemolysin_N Hemolytic toxin N terminal. This domain family is found in bacteria, and is approximately 190 amino acids in length. The family is found in association with pfam07968, pfam00652. This family is a bacterial virulence factor - hemolysin - which forms pores in erythrocytes and causes them to lyse.
Probab=29.58  E-value=29  Score=12.94  Aligned_cols=16  Identities=6%  Similarity=-0.008  Sum_probs=7.3

Q ss_pred             HHHHHHHHHHCCCCHH
Q ss_conf             8888768776399921
Q gi|254780930|r  227 RMNVHNISTLLGYPAT  242 (452)
Q Consensus       227 ~~a~~~L~~l~G~~~~  242 (452)
                      ..++..+...+|+...
T Consensus        93 ~~aqa~~r~~~Gv~F~  108 (187)
T pfam12563        93 AEAKAKFRKKYGLSFA  108 (187)
T ss_pred             HHHHHHHHHHHCCCCC
T ss_conf             9999999997283502


No 176
>PRK13835 conjugal transfer protein TrbH; Provisional
Probab=29.42  E-value=29  Score=12.92  Aligned_cols=16  Identities=25%  Similarity=0.710  Sum_probs=10.1

Q ss_pred             HHHHHHHHHHHCCCCC
Q ss_conf             9999999975026899
Q gi|254780930|r    8 FSLFIVLLAGCTVGPE   23 (452)
Q Consensus         8 ~~l~~~~l~gC~~~p~   23 (452)
                      ++++.++|+||.+..+
T Consensus         7 ~~i~a~~lsgCqta~d   22 (144)
T PRK13835          7 ACILALLLSGCQTATD   22 (144)
T ss_pred             HHHHHHHHHHCCCCCC
T ss_conf             9999998640413688


No 177
>PRK01326 prsA foldase protein PrsA; Reviewed
Probab=29.42  E-value=29  Score=12.92  Aligned_cols=21  Identities=24%  Similarity=0.161  Sum_probs=11.5

Q ss_pred             CCCHHHHH---HHHHHHHHHHCCC
Q ss_conf             93069999---9999999750268
Q gi|254780930|r    1 MNILRAIF---SLFIVLLAGCTVG   21 (452)
Q Consensus         1 M~~~~~~~---~l~~~~l~gC~~~   21 (452)
                      |+..-++.   ++++++|+||+..
T Consensus         1 MKKKl~~~~~~~~svl~LaaCs~~   24 (310)
T PRK01326          1 MKKKLIAGAVTLLSVATLAACSKT   24 (310)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             908899999999999999871699


No 178
>TIGR03530 GldJ_short gliding motility-associated lipoprotein GldJ. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldJ is a lipoprotein linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae. Knockouts of GldJ abolish the gliding phenotype. GldJ is homologous to GldK. This model represents the GldJ homolog in Cytophaga hutchinsonii and several other species which is of shorter architecture than that found in Flavobacterium johnsoniae and is represented by a separate model (TIGR03524). Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.
Probab=28.62  E-value=30  Score=12.83  Aligned_cols=26  Identities=23%  Similarity=0.428  Sum_probs=15.5

Q ss_pred             HHHHHHH-HHHHHHHHCCCCCCCCCCC
Q ss_conf             6999999-9999975026899999995
Q gi|254780930|r    4 LRAIFSL-FIVLLAGCTVGPEYTKPHM   29 (452)
Q Consensus         4 ~~~~~~l-~~~~l~gC~~~p~~~~p~~   29 (452)
                      .+.++++ ...+|.||...|.+..|..
T Consensus         2 ~~~~~~~~~~~~~~~c~~~~~~~~~~~   28 (402)
T TIGR03530         2 KHAAMLIAAASILFSCNKTPGYGNPTA   28 (402)
T ss_pred             CHHHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             301589999999865114778898645


No 179
>COG4314 NosL Predicted lipoprotein involved in nitrous oxide reduction [Energy production and conversion]
Probab=28.44  E-value=31  Score=12.81  Aligned_cols=21  Identities=29%  Similarity=0.347  Sum_probs=12.1

Q ss_pred             CCCHHHHHHHHHHHHHHHCCC
Q ss_conf             930699999999999750268
Q gi|254780930|r    1 MNILRAIFSLFIVLLAGCTVG   21 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~gC~~~   21 (452)
                      ||..-+.++++.++|+||...
T Consensus         1 mkr~Lla~la~~~llAgC~~~   21 (176)
T COG4314           1 MKRTLLAILAVTALLAGCRQA   21 (176)
T ss_pred             CCHHHHHHHHHHHHHHHCCHH
T ss_conf             940379999999998753431


No 180
>PRK13528 outer membrane receptor FepA; Provisional
Probab=28.22  E-value=31  Score=12.79  Aligned_cols=16  Identities=25%  Similarity=0.389  Sum_probs=9.6

Q ss_pred             CCCHHHHHHHHHHHHH
Q ss_conf             9306999999999997
Q gi|254780930|r    1 MNILRAIFSLFIVLLA   16 (452)
Q Consensus         1 M~~~~~~~~l~~~~l~   16 (452)
                      |+.+|.++++.+++.+
T Consensus         3 ~~~~~~~~~~~~~~~~   18 (727)
T PRK13528          3 MRANKILWLLTVVLAG   18 (727)
T ss_pred             CHHHHHHHHHHHHHHH
T ss_conf             3046699999999998


No 181
>TIGR01433 CyoA ubiquinol oxidase, subunit II; InterPro: IPR006333   Members of this domain catalyze the oxidation of ubiquinol with the concomitant reduction of molecular oxygen to water. This acts as the terminal electron acceptor in the respiratory chain. Subunit II is responsible for binding and oxidation of the ubiquinone substrate. This sequence is closely related to QoxA, which oxidizes quinol in Gram-positive bacteria but which is in complex with subunits which utilise cytochrome a in the reduction of molecular oxygen. Slightly more distantly related is subunit II of cytochrome c oxidase which uses cytochrome c as the oxidant . ; GO: 0016682 oxidoreductase activity acting on diphenols and related substances as donors oxygen as acceptor, 0006118 electron transport, 0016020 membrane.
Probab=27.75  E-value=31  Score=12.82  Aligned_cols=10  Identities=50%  Similarity=0.979  Sum_probs=4.8

Q ss_pred             HHHHHHHHHC
Q ss_conf             9999997502
Q gi|254780930|r   10 LFIVLLAGCT   19 (452)
Q Consensus        10 l~~~~l~gC~   19 (452)
                      +..++|+||-
T Consensus         5 ~~~~lLsGCN   14 (228)
T TIGR01433         5 LASLLLSGCN   14 (228)
T ss_pred             HHHHHHHCCC
T ss_conf             8999861256


No 182
>PHA00407 phage lambda Rz1-like protein
Probab=27.38  E-value=32  Score=12.69  Aligned_cols=14  Identities=14%  Similarity=0.672  Sum_probs=9.7

Q ss_pred             HHHHHHHHHHHHCC
Q ss_conf             99999999975026
Q gi|254780930|r    7 IFSLFIVLLAGCTV   20 (452)
Q Consensus         7 ~~~l~~~~l~gC~~   20 (452)
                      ++.+|++.++||+.
T Consensus        38 lllicv~tISGCaS   51 (84)
T PHA00407         38 LLLICVATISGCAS   51 (84)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999766650


No 183
>PRK10803 hypothetical protein; Provisional
Probab=27.05  E-value=32  Score=12.66  Aligned_cols=34  Identities=12%  Similarity=0.153  Sum_probs=14.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             7776532223557989999998568888768776
Q gi|254780930|r  203 LSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL  236 (452)
Q Consensus       203 ~d~~~a~~~~~~~~~~l~~~~~~~~~a~~~L~~l  236 (452)
                      .|+.+.+.+++....++.+++.+.+.....|..+
T Consensus        68 ~EV~~LRGqiEe~~~~l~ql~~rQrd~Y~dLD~~  101 (262)
T PRK10803         68 SDIDSLRGQIQENQYQLNQVVERQKQIYLQIDSL  101 (262)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999998799999999999999999999999988


No 184
>cd07593 BAR_MUG137_fungi The Bin/Amphiphysin/Rvs (BAR) domain of Schizosaccharomyces pombe Meiotically Up-regulated Gene 137 protein and similar proteins. BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions including organelle biogenesis, membrane trafficking or remodeling, and cell division and migration. This subfamily is composed predominantly of uncharacterized fungal proteins with similarity to Schizosaccharomyces pombe Meiotically Up-regulated Gene 137 protein (MUG137), which may play a role in meiosis and sporulation in fission yeast. MUG137 contains an N-terminal BAR domain and a C-terminal SH3 domain, similar to endophilins. Endophilins play roles in synaptic vesicle formation, virus budding, mitochondrial morphology maintenance, receptor-mediated endocytosis inhibition, and endosomal sorting. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be invol
Probab=26.68  E-value=33  Score=12.61  Aligned_cols=54  Identities=13%  Similarity=0.167  Sum_probs=30.3

Q ss_pred             HHHHHHHHHHHHHCC----CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999998718----832899999999999999999999999999999999984
Q gi|254780930|r  393 HKKSMSLSMINYRQG----RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAI  446 (452)
Q Consensus       393 a~~~~~~~~~~y~~G----~~~~~dll~a~~~~~~a~~~~~~a~~~~~~a~~~L~~Al  446 (452)
                      +++-++.++..|+.-    ......+++.+.+...--..+++++.+|+.--..+...|
T Consensus       147 ~eeElr~A~~kfees~e~~~~~M~~i~~~e~e~~~~L~~fveAQl~Yh~q~~~~L~~l  204 (215)
T cd07593         147 LEEELRRAKAKYEESSEDVEARMVAIKESEADQYRDLTDLLDAELDYHQQSLDVLREV  204 (215)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             1799999999999999999999997876548899999999999999999999999999


No 185
>TIGR02567 YscW type III secretion system chaperone YscW; InterPro: IPR013400    This entry is encoded within type III secretion operons. The protein has been characterised  as a chaperone for the outer membrane pore component YscC (IPR003522 from INTERPRO). YscW is a lipoprotein which is itself localized to the outer membrane and, it is believed, facilitates the oligomerisation and localization of YscC..
Probab=26.43  E-value=32  Score=12.65  Aligned_cols=12  Identities=33%  Similarity=0.916  Sum_probs=8.6

Q ss_pred             HHHHHHHHHHCC
Q ss_conf             999999975026
Q gi|254780930|r    9 SLFIVLLAGCTV   20 (452)
Q Consensus         9 ~l~~~~l~gC~~   20 (452)
                      ++.+++|+||+.
T Consensus         2 l~~~lLL~GC~~   13 (131)
T TIGR02567         2 LILLLLLTGCVS   13 (131)
T ss_pred             HHHHHHHHCCCC
T ss_conf             354100210001


No 186
>PRK11281 potassium efflux protein KefA; Provisional
Probab=25.56  E-value=34  Score=12.48  Aligned_cols=27  Identities=15%  Similarity=0.068  Sum_probs=11.7

Q ss_pred             HHHHHHHHHCHHHHHHHHHHHHHHHHH
Q ss_conf             999999970899899999999999999
Q gi|254780930|r   63 KLVKIALQQNLTILQATERINAAKENI   89 (452)
Q Consensus        63 ~~i~~Al~~np~l~~a~~~i~~a~~~~   89 (452)
                      +..+.++.+=-+++....+.++-+..+
T Consensus        61 q~Lq~aL~~L~~~~~~~~~~~~l~k~i   87 (1107)
T PRK11281         61 QDLEQTLALLDKIERQKEETVQLKQQL   87 (1107)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999999999999


No 187
>pfam09676 TraV Type IV conjugative transfer system lipoprotein (TraV). This entry includes TraV, which is a component of conjugative type IV secretion system. TraV is an outer membrane lipoprotein that is believed to interact with the secretin TraK. The alignment contains three conserved cysteines in the N-terminal half.
Probab=25.45  E-value=26  Score=13.26  Aligned_cols=11  Identities=45%  Similarity=0.905  Sum_probs=8.5

Q ss_pred             HHHHHHHHHCC
Q ss_conf             99999975026
Q gi|254780930|r   10 LFIVLLAGCTV   20 (452)
Q Consensus        10 l~~~~l~gC~~   20 (452)
                      +++++|+||+.
T Consensus         2 ~~~llLsGCas   12 (134)
T pfam09676         2 LAALLLTGCSS   12 (134)
T ss_pred             HHHHHHHHHHH
T ss_conf             77988655232


No 188
>PRK09534 btuF corrinoid ABC transporter substrate-binding protein; Reviewed
Probab=25.25  E-value=35  Score=12.44  Aligned_cols=10  Identities=20%  Similarity=0.149  Sum_probs=5.7

Q ss_pred             CCCHHHHHHH
Q ss_conf             9306999999
Q gi|254780930|r    1 MNILRAIFSL   10 (452)
Q Consensus         1 M~~~~~~~~l   10 (452)
                      |+.+|.+.++
T Consensus         1 ~~~~r~~~l~   10 (364)
T PRK09534          1 MHRMRFASLV   10 (364)
T ss_pred             CCCHHHHHHH
T ss_conf             9520236999


No 189
>COG1464 NlpA ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism]
Probab=25.17  E-value=35  Score=12.43  Aligned_cols=20  Identities=25%  Similarity=0.489  Sum_probs=11.5

Q ss_pred             CCCHHHHHHHH--HHHHHHHCC
Q ss_conf             93069999999--999975026
Q gi|254780930|r    1 MNILRAIFSLF--IVLLAGCTV   20 (452)
Q Consensus         1 M~~~~~~~~l~--~~~l~gC~~   20 (452)
                      |++++.++++.  +++++||..
T Consensus         1 m~~~~~~~~~~~~~l~~~~~~~   22 (268)
T COG1464           1 MKKLKKLALALVALLALAACGA   22 (268)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHH
T ss_conf             9438899999999999975223


No 190
>TIGR02117 chp_urease_rgn conserved hypothetical protein; InterPro: IPR011727   This conserved hypothetical protein of unknown function is found in several Proteobacteria. Its function is unknown and its genome context is not well-conserved. It is found amid urease genes in at least one species..
Probab=24.88  E-value=35  Score=12.40  Aligned_cols=20  Identities=35%  Similarity=0.373  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHHCCCCCCCCC
Q ss_conf             99999999750268999999
Q gi|254780930|r    8 FSLFIVLLAGCTVGPEYTKP   27 (452)
Q Consensus         8 ~~l~~~~l~gC~~~p~~~~p   27 (452)
                      +++++++|.+|++.|...-+
T Consensus         2 v~~L~llL~~Gt~~p~~~~~   21 (212)
T TIGR02117         2 VLLLVLLLALGTLVPRPVKA   21 (212)
T ss_pred             HHHHHHHHHHHHCCCCCCCC
T ss_conf             88877999831037745547


No 191
>COG4808 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=24.60  E-value=36  Score=12.37  Aligned_cols=19  Identities=37%  Similarity=0.775  Sum_probs=11.2

Q ss_pred             CCCHHHHH-----HHHHHHHHHHC
Q ss_conf             93069999-----99999997502
Q gi|254780930|r    1 MNILRAIF-----SLFIVLLAGCT   19 (452)
Q Consensus         1 M~~~~~~~-----~l~~~~l~gC~   19 (452)
                      |+.++.++     .++++.|+||-
T Consensus         1 Mk~l~kl~~~~~alil~~sl~gCg   24 (152)
T COG4808           1 MKALNKLFSLVVALVLVFSLAGCG   24 (152)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             906887889999999988754048


No 192
>PRK11251 DNA-binding transcriptional activator OsmE; Provisional
Probab=24.56  E-value=36  Score=12.36  Aligned_cols=17  Identities=29%  Similarity=0.528  Sum_probs=9.8

Q ss_pred             HHHH-HHHHHHHHHHCCC
Q ss_conf             9999-9999999750268
Q gi|254780930|r    5 RAIF-SLFIVLLAGCTVG   21 (452)
Q Consensus         5 ~~~~-~l~~~~l~gC~~~   21 (452)
                      ..++ ...+.+|+||+..
T Consensus         4 ~~l~aaa~~~~LaGCt~~   21 (109)
T PRK11251          4 GILSAAAVLTMLAGCTAY   21 (109)
T ss_pred             HHHHHHHHHHHHHHCCCC
T ss_conf             588999999999714477


No 193
>COG5567 Predicted small periplasmic lipoprotein [Cell motility and secretion]
Probab=23.10  E-value=38  Score=12.18  Aligned_cols=33  Identities=30%  Similarity=0.447  Sum_probs=17.5

Q ss_pred             CCCHHHHH--HHHHHHHHHHCC-CCCCCCCCCCCCC
Q ss_conf             93069999--999999975026-8999999956475
Q gi|254780930|r    1 MNILRAIF--SLFIVLLAGCTV-GPEYTKPHMPLLP   33 (452)
Q Consensus         1 M~~~~~~~--~l~~~~l~gC~~-~p~~~~p~~~~~~   33 (452)
                      ||.....+  ++.++.|+||-. +|-+-+|+.-..|
T Consensus         1 mk~~~~s~~ala~l~sLA~CG~KGPLy~Ppadk~a~   36 (58)
T COG5567           1 MKNVFKSLLALATLFSLAGCGLKGPLYFPPADKNAP   36 (58)
T ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHCCCC
T ss_conf             904899999999999998526678762782430588


No 194
>pfam07365 Toxin_8 Alpha conotoxin precursor. This family consists of several alpha conotoxin precursor proteins from a number of Conus species. The alpha-conotoxins are small peptide neurotoxins from the venom of fish-hunting cone snails which block nicotinic acetylcholine receptors (nAChRs).
Probab=22.97  E-value=38  Score=12.16  Aligned_cols=14  Identities=21%  Similarity=0.550  Sum_probs=10.2

Q ss_pred             CCCHHHHHHHHHHH
Q ss_conf             93069999999999
Q gi|254780930|r    1 MNILRAIFSLFIVL   14 (452)
Q Consensus         1 M~~~~~~~~l~~~~   14 (452)
                      |++|+.+|+|.++.
T Consensus         3 mrmmftvfllvvla   16 (66)
T pfam07365         3 MRMMFTVFLLVVLA   16 (66)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             02678999999886


No 195
>KOG1026 consensus
Probab=22.51  E-value=19  Score=14.12  Aligned_cols=25  Identities=40%  Similarity=0.658  Sum_probs=19.1

Q ss_pred             CCCCCCCCEEEEECCCCCCCCHHHHH
Q ss_conf             44544541044311223451012456
Q gi|254780930|r  315 NSFPGYNTHWSFGPKLYLPIFDKGKI  340 (452)
Q Consensus       315 ~~~~~~~~~~~~g~~l~~Pif~gg~~  340 (452)
                      +.|+..++.|++||.| |-||+.|..
T Consensus       680 ~kFTteSDVWs~GVvL-WEIFsyG~Q  704 (774)
T KOG1026         680 GKFTTESDVWSFGVVL-WEIFSYGKQ  704 (774)
T ss_pred             CCCCCHHHHHHHHHHH-HHHHCCCCC
T ss_conf             7656033442543015-332326668


No 196
>COG3126 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=21.80  E-value=41  Score=12.01  Aligned_cols=20  Identities=35%  Similarity=0.537  Sum_probs=13.1

Q ss_pred             CCCHHH-HHHHHHHHHHHHCC
Q ss_conf             930699-99999999975026
Q gi|254780930|r    1 MNILRA-IFSLFIVLLAGCTV   20 (452)
Q Consensus         1 M~~~~~-~~~l~~~~l~gC~~   20 (452)
                      ||.+.. +..++.++|+||+.
T Consensus         1 Mk~~~~~~g~~~~~~La~c~~   21 (158)
T COG3126           1 MKLVHIPIGLLAAILLAACAS   21 (158)
T ss_pred             CCCEEHHHHHHHHHHHHHCCC
T ss_conf             970321467899999875312


No 197
>pfam09580 Spore_YhcN_YlaJ Sporulation lipoprotein YhcN/YlaJ (Spore_YhcN_YlaJ). This entry contains YhcN and YlaJ, which are predicted lipoproteins that have been detected as spore proteins but not vegetative proteins in Bacillus subtilis. Both appear to be expressed under control of the RNA polymerase sigma-G factor. The YlaJ-like members of this family have a low-complexity, strongly acidic, 40-residue C-terminal domain.
Probab=21.64  E-value=36  Score=12.32  Aligned_cols=12  Identities=42%  Similarity=0.930  Sum_probs=8.3

Q ss_pred             HHHHHHHHCCCC
Q ss_conf             999997502689
Q gi|254780930|r   11 FIVLLAGCTVGP   22 (452)
Q Consensus        11 ~~~~l~gC~~~p   22 (452)
                      ++++|+||....
T Consensus         2 ~~~~LaGC~~~~   13 (169)
T pfam09580         2 LLLLLAGCGTNN   13 (169)
T ss_pred             CHHHHCCCCCCC
T ss_conf             204310157787


No 198
>COG1732 OpuBC Periplasmic glycine betaine/choline-binding (lipo)protein of an ABC-type transport system (osmoprotectant binding protein) [Cell envelope biogenesis, outer membrane]
Probab=21.06  E-value=42  Score=11.92  Aligned_cols=17  Identities=29%  Similarity=0.362  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHHHCHHHHH
Q ss_conf             799999999970899899
Q gi|254780930|r   60 SLNKLVKIALQQNLTILQ   77 (452)
Q Consensus        60 ~L~~~i~~Al~~np~l~~   77 (452)
                      .|-+.+.+.+++| +++.
T Consensus        47 IL~~m~~~lle~~-~~kv   63 (300)
T COG1732          47 ILGNILKQLLEKN-GIKV   63 (300)
T ss_pred             HHHHHHHHHHHHC-CCCE
T ss_conf             9999999999865-9914


No 199
>PRK06760 hypothetical protein; Provisional
Probab=20.59  E-value=43  Score=11.85  Aligned_cols=21  Identities=14%  Similarity=0.338  Sum_probs=11.9

Q ss_pred             CCCHH---HHHHHHHHHHHHHCCC
Q ss_conf             93069---9999999999750268
Q gi|254780930|r    1 MNILR---AIFSLFIVLLAGCTVG   21 (452)
Q Consensus         1 M~~~~---~~~~l~~~~l~gC~~~   21 (452)
                      |+..-   .+..+.+.+|+||+.+
T Consensus         1 MKK~l~i~i~~iis~~~lsaCS~~   24 (223)
T PRK06760          1 MKKTLTIFMLTILLLISFSACSKK   24 (223)
T ss_pred             CCEEEEEHHHHHHHHHHHHHCCCC
T ss_conf             950676499999999984003367


No 200
>PRK03642 hypothetical protein; Provisional
Probab=20.47  E-value=43  Score=11.84  Aligned_cols=14  Identities=14%  Similarity=0.180  Sum_probs=6.7

Q ss_pred             HHHHHHHHHHHHHC
Q ss_conf             99999999997502
Q gi|254780930|r    6 AIFSLFIVLLAGCT   19 (452)
Q Consensus         6 ~~~~l~~~~l~gC~   19 (452)
                      .++++..+++.||+
T Consensus         3 ~~~~~~~~~~~~~~   16 (432)
T PRK03642          3 FTLLATSLLAFSCS   16 (432)
T ss_pred             EEHHHHHHHHHHHH
T ss_conf             54379999998742


No 201
>PRK11186 carboxy-terminal protease; Provisional
Probab=20.14  E-value=44  Score=11.79  Aligned_cols=32  Identities=25%  Similarity=0.447  Sum_probs=16.5

Q ss_pred             CCCHHHHHHH-HHHHHHHHCC--CCCCCCCCCCCC
Q ss_conf             9306999999-9999975026--899999995647
Q gi|254780930|r    1 MNILRAIFSL-FIVLLAGCTV--GPEYTKPHMPLL   32 (452)
Q Consensus         1 M~~~~~~~~l-~~~~l~gC~~--~p~~~~p~~~~~   32 (452)
                      ||++..+.++ ++++++||+.  .|.....+.|.+
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~p~l   35 (673)
T PRK11186          1 MNKFFRLTAIAGLLALAGSAFAVEPTIRADQLPVL   35 (673)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHCCCCCCCHHHCCCC
T ss_conf             96213479999999986500015787996667778


Done!