HHsearch alignment of GI: 254780930 and MMDB domain: 1yc9_A_1-69_115-283

>1yc9_A (A:1-69,A:115-283) VCEC, multidrug resistance protein; outer membrane protein; HET: BOG; 1.80A {Vibrio cholerae}
Probab=99.33  E-value=1.2e-09  Score=80.33  Aligned_cols=144  Identities=16%  Similarity=0.149  Sum_probs=132.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHH
Q ss_conf             78997302345565558999964301011222210011222211223445445410443112234510124566567799
Q gi|254780930|r  268 PADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA  347 (452)
Q Consensus       268 ~~~~l~~RPdi~~a~~~~~~a~~~i~~a~a~~~P~i~l~~~~~~~~~~~~~~~~~~~~~g~~l~~Pif~gg~~~a~i~~a  347 (452)
                      -.++|.+.|++..++.+++.+......+.+.                                      ||++++.++.+
T Consensus        39 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------------------------------------~Gk~~a~~~~A   80 (238)
T 1yc9_A           39 IEEALQHSPSLCMAMARLKGAQGFARQAGAI--------------------------------------WGKNRAAVVAA   80 (238)
T ss_dssp             HHHHHHSCHHHHHHHHHHHHHHHHHHHHHGG--------------------------------------TSHHHHHHHHH
T ss_pred             HHHHHHCCHHHHHHHHHHHHHHHHHHHHCCC--------------------------------------HHHHHHHHHHH
T ss_conf             9999963999999999999999999996474--------------------------------------77777889999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999871883289999999999999999
Q gi|254780930|r  348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVD  427 (452)
Q Consensus       348 ~~~~~~a~~~~~~~~~~a~~ev~~a~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~y~~G~~~~~dll~a~~~~~~a~~~  427 (452)
                      +...+.+..+++.+..++..+|..+|.++....+.+...+..+...++.++..+.+|+.|.++..|++.++..+.+++..
T Consensus        81 ~~~~~~a~~~~~~~~~~l~~~v~~aY~~ll~~q~~l~i~~~~l~~~~~~~~~~~~r~~~G~~s~~Dl~~aq~~l~~a~~~  160 (238)
T 1yc9_A           81 TSELAAAEAESVAARLMISTSIANAYAELARLYANQETVHAALQVRNKTVELLEKRYANGLETLGSVSQAKAVAASVEAE  160 (238)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSSCHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999888999999999999999999988642101233556554444346668


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             9999999999999999984999
Q gi|254780930|r  428 LSIAKRQLAKSYVDLYIAIGSG  449 (452)
Q Consensus       428 ~~~a~~~~~~a~~~L~~AlGGg  449 (452)
                      +..++.++..+...|...+|-.
T Consensus       161 l~~ae~~~~~a~~~L~~LlG~~  182 (238)
T 1yc9_A          161 LLGIQESIQLQKNALAALVGQG  182 (238)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTCC
T ss_pred             HHHHHHHHHHHHHHHHHHHCCC
T ss_conf             9999999999998899984778