BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780930|ref|YP_003065343.1| nodulation protein (outer
membrane efflux protein) [Candidatus Liberibacter asiaticus str.
psy62]
         (452 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780930|ref|YP_003065343.1| nodulation protein (outer membrane efflux protein) [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040607|gb|ACT57403.1| nodulation protein (outer membrane efflux protein) [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 452

 Score =  922 bits (2384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/452 (100%), Positives = 452/452 (100%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS
Sbjct: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL 120
           LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL
Sbjct: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL 120

Query: 121 DSDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI 180
           DSDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI
Sbjct: 121 DSDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI 180

Query: 181 LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP 240
           LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP
Sbjct: 181 LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP 240

Query: 241 ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLY 300
           ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLY
Sbjct: 241 ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLY 300

Query: 301 PSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQE 360
           PSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQE
Sbjct: 301 PSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQE 360

Query: 361 TVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERA 420
           TVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERA
Sbjct: 361 TVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERA 420

Query: 421 TAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           TAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP
Sbjct: 421 TAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452


>gi|315122644|ref|YP_004063133.1| nodulation protein (outer membrane efflux protein) [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313496046|gb|ADR52645.1| nodulation protein (outer membrane efflux protein) [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 452

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/452 (74%), Positives = 398/452 (88%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           MNIL+  FS+ +VLLAGC VGPEYTKP MP LPTQFSIG S + IN+DTLKWWESFNDT 
Sbjct: 1   MNILKINFSILVVLLAGCAVGPEYTKPQMPRLPTQFSIGKSNSPINVDTLKWWESFNDTC 60

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL 120
           LNKLV IALQQNLTIL+ATERIN+AKENIL+V+ADLFPS   S+S++ +P   TNSTG++
Sbjct: 61  LNKLVNIALQQNLTILKATERINSAKENILAVKADLFPSLQTSVSYQIMPKSDTNSTGRV 120

Query: 121 DSDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI 180
            SDWKIDLFGQ+R +ES+LAN DS YAQ +IAKL +I+KLI +YIDARHF+ERISIAH+I
Sbjct: 121 HSDWKIDLFGQKRRMESALANFDSVYAQSEIAKLTIIAKLISTYIDARHFQERISIAHKI 180

Query: 181 LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP 240
           LDLYK+N++L+ LK  +GA SKL L+KLEAE+KSIES+IP LEK FR+NVHNISTLLG+ 
Sbjct: 181 LDLYKRNLKLTRLKLFEGAISKLPLIKLEAELKSIESEIPNLEKGFRVNVHNISTLLGHS 240

Query: 241 ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLY 300
           AT+FL Y+QKQ   FQPNLY+ INIGIPADLIRNRPDIRY+EK +ADS+AKIGIAK+DLY
Sbjct: 241 ATDFLAYIQKQKKPFQPNLYMKINIGIPADLIRNRPDIRYREKNIADSIAKIGIAKADLY 300

Query: 301 PSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQE 360
           P++SLNG I+LTHDN  PGY++ WSFGPKLY+PIFD  KI+SNIRRAES A EQYI WQE
Sbjct: 301 PAISLNGFISLTHDNISPGYHSGWSFGPKLYVPIFDGQKIRSNIRRAESFAHEQYIAWQE 360

Query: 361 TVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERA 420
           TVLNA+KEVE+AL SIN+DKK+VT LQ+ VEL+K++MSLS I+YRQG+YSL+D+LDIE+ 
Sbjct: 361 TVLNAVKEVEDALISINQDKKVVTALQNTVELYKQAMSLSTISYRQGKYSLIDLLDIEKT 420

Query: 421 TAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           TAK EVDLSIAKRQLAKSYVDLY+AIGSGYNP
Sbjct: 421 TAKAEVDLSIAKRQLAKSYVDLYVAIGSGYNP 452


>gi|86359005|ref|YP_470897.1| nodulation protein (outer membrane efflux protein) [Rhizobium etli
           CFN 42]
 gi|86283107|gb|ABC92170.1| nodulation protein (outer membrane efflux protein) [Rhizobium etli
           CFN 42]
          Length = 478

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 191/464 (41%), Positives = 289/464 (62%), Gaps = 15/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M  LR      ++LL+GC VGP++  P MPL P +F  G +K++ ++ T  WW +FND  
Sbjct: 1   MVSLRFATPALLLLLSGCVVGPDHAPPEMPL-PAKFGEGGTKSVGDVATAAWWTAFNDPK 59

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH---------RFIPN 111
           LN  V+  L QNL++ QA ERINAA  N+ +  A   P+     SH         R   +
Sbjct: 60  LNGYVQAGLDQNLSVQQAIERINAASANVTTAGAGGLPNLTVGGSHTVSGQRGELRTQFD 119

Query: 112 LKTNSTGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
            +  + G +   W +DLFG  +R  ES+LA+LDSAYA  D+AKL ++  L+ SYID R++
Sbjct: 120 TRNTTAGDVQLSWLLDLFGLYKRSTESALASLDSAYASADVAKLTLVQDLVSSYIDVRYY 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           ++R++++   L   ++  EL+  +   GA S+L +V+ E  ++S  ++IP LE + R++ 
Sbjct: 180 QQRLALSKANLKSRQETYELTKFQLEAGAASRLDVVQAEGLVQSTLAEIPGLETNIRVSA 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           H+I+TLLG PA+  +  + K     QP     IN GIPADLIRNRPDIR  E+ LA + A
Sbjct: 240 HHIATLLGLPASALVDELLK--GRGQPVFRGGINSGIPADLIRNRPDIRVAERDLAAATA 297

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDN--SFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
            IG+A++ LYPS+SL+GSI+ ++ N     G  T WSFGP L LPIFD G++++N++ A+
Sbjct: 298 NIGVAEAQLYPSISLSGSISPSYINQRGIHGDLTPWSFGPTLNLPIFDGGRLRANVKSAQ 357

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           S+A   Y+ W+ TVL A+++VENAL ++  D + V  LQ  V+  ++++ LS  +Y+ G 
Sbjct: 358 STAATAYLNWKSTVLTAVEQVENALAAVRRDARTVAALQAQVKTTQETLELSTASYKDGA 417

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            SLLD+LD +R  +  +  L+ A +Q+AK YV L IA+G GY P
Sbjct: 418 SSLLDVLDAQRQVSLAQASLAQAVQQMAKDYVSLNIAVGGGYAP 461


>gi|209550733|ref|YP_002282650.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209536489|gb|ACI56424.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 480

 Score =  378 bits (971), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 187/449 (41%), Positives = 284/449 (63%), Gaps = 15/449 (3%)

Query: 16  AGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTI 75
           +GC VGP++  P MPL P +F  G +K++ ++ T  WW +FND  LN  VK  L QNLT+
Sbjct: 17  SGCVVGPDHVPPEMPL-PAKFGEGGTKSVGDVATAAWWTAFNDPKLNGYVKAGLDQNLTV 75

Query: 76  LQATERINAAKENILSVRADLFPSSYASISH---------RFIPNLKTNSTGQLDSDWKI 126
            QA ERINAA  N+ +  A   P+     SH         R   + +  S G++   W +
Sbjct: 76  QQAIERINAASANVTTAGAGALPNLTVGGSHTVSGQRGELRTQFDTRNTSAGEVQLSWLL 135

Query: 127 DLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYK 185
           DLFG  +R  ES+LA+LDSAYA  D+AKL ++  L+ SYID R++++R++++   L   +
Sbjct: 136 DLFGLYKRSTESALASLDSAYASADVAKLTLVQDLVSSYIDVRYYQQRLALSRANLKSRQ 195

Query: 186 KNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFL 245
           +  EL+  +   GA S+L +V+ E  ++S  ++IP LE + R++ H+I+TLLG PA+  +
Sbjct: 196 ETYELTKFQLEAGAASRLDVVQAEGLVQSTLAEIPGLETNIRISAHHIATLLGLPASALV 255

Query: 246 HYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSL 305
             + K   + QP     IN GIPADLIRNRPD+R  E+ LA + A IG+A++ LYPS+SL
Sbjct: 256 DELLK--GHGQPVFRGGINSGIPADLIRNRPDVRVAERDLAAATANIGVAQAQLYPSISL 313

Query: 306 NGSIALTHDN--SFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVL 363
           +GSI+ ++ N     G  T WSFGP L LPIFD G++++N++ A+S A   Y+ W+ TVL
Sbjct: 314 SGSISPSYINQRGIHGGLTPWSFGPTLNLPIFDGGRLRANVKSAQSDAATAYLNWKSTVL 373

Query: 364 NAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAK 423
            ++++VENAL ++  D + V+ LQ  V+  ++++ LS  +Y+ G  SLLD+LD +R  + 
Sbjct: 374 TSVEQVENALAAVRRDARTVSALQAQVKTTQETLELSTASYKDGASSLLDVLDAQRQVSL 433

Query: 424 VEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            +  L+ A +Q+AK YV L IA+G GY P
Sbjct: 434 AQASLAQAVQQMAKDYVSLNIAVGGGYAP 462


>gi|190893232|ref|YP_001979774.1| nodulation protein (outer membrane efflux protein) [Rhizobium etli
           CIAT 652]
 gi|190698511|gb|ACE92596.1| nodulation protein (outer membrane efflux protein) [Rhizobium etli
           CIAT 652]
          Length = 478

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 190/464 (40%), Positives = 287/464 (61%), Gaps = 15/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M  LR      ++LL+GC VGP++  P MPL P +F  G +K++ ++ T  WW +F D  
Sbjct: 1   MVSLRFATPALLLLLSGCVVGPDHAPPEMPL-PAKFGEGGTKSVGDVATAAWWTAFKDPR 59

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH---------RFIPN 111
           LN  V+  L+QNLT+ QA ERINAA  N+    A   PS     SH         R   +
Sbjct: 60  LNGYVQAGLEQNLTVQQAIERINAASANVTIAGAGALPSLNVGASHTVSGQKGELRTQFD 119

Query: 112 LKTNSTGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
            +  S G +   W +DLFG  +R  ES+ A+LDSAYA  D+AKL ++  L+ SYID R +
Sbjct: 120 TRNTSAGDVQLSWLLDLFGLYKRSTESAAASLDSAYASADVAKLTLVQDLVSSYIDVRFY 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           ++R++++   L   ++  EL+  +   GA S+L +V+ E  ++S  ++IP LE + R++ 
Sbjct: 180 QQRLALSKANLKSRQETYELTKFQLEAGAASRLDVVQAEGLVQSTLAEIPGLETNIRISA 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           H+I+TLLG PA+  ++ + +     QP  +  IN GIPADLIRNRPDIR  E+ LA + A
Sbjct: 240 HHIATLLGLPASALVNELLR--GGGQPVFHGGINSGIPADLIRNRPDIRVAERDLAAATA 297

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDN--SFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
            IG+A++ LYPS+SL+GSI+ ++ N     G  T WSFGP L LPIFD G++++N++ A+
Sbjct: 298 NIGVAEAQLYPSISLSGSISPSYINQRGVHGGLTPWSFGPTLNLPIFDGGRLRANVKSAQ 357

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           S A   Y+ W+ TVL A+++VENAL ++  D + V  LQ  V+  ++++ LS  +Y+ G 
Sbjct: 358 SDAATAYLNWKSTVLTAVEQVENALAAVRRDAQTVAALQAQVKTTQETLELSTASYKDGA 417

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            SLLD+LD +R  +  +  L+ + +Q+AK YV L IA+G GY P
Sbjct: 418 SSLLDVLDAQRQVSLAQASLAQSVQQMAKDYVSLNIAVGGGYAP 461


>gi|58294348|gb|AAW70092.1| NodTch [Rhizobium etli]
          Length = 479

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 191/465 (41%), Positives = 290/465 (62%), Gaps = 16/465 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M  LR      ++LL+GC VGP++  P MPL P +F  G +K++ ++ T  WW +FND  
Sbjct: 1   MVSLRFATPALLLLLSGCVVGPDHAPPEMPL-PAKFGEGGTKSVGDVATAAWWTAFNDPK 59

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS-SYASISH---------RFIP 110
           LN  V+  L QNL++ QA ERINAA  N+ +  A   P+ +    SH         R   
Sbjct: 60  LNGYVQAGLDQNLSVQQAIERINAASANVTTAGAGPLPNLTVGGGSHMVSGQRGELRTQF 119

Query: 111 NLKTNSTGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
           + +  + G +   W +DLFG  +R  ES+LA+LDSAYA  D+AKL ++  L+ SYID R+
Sbjct: 120 DTRNTTAGDVQLSWLLDLFGLYKRTTESALASLDSAYASADVAKLTLVQDLVSSYIDVRY 179

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
           +++R++++   L   ++  EL+  +   GA S+L +V+ E  ++S  ++IP LE + R++
Sbjct: 180 YQQRLALSKANLKSRQETYELTKFQLEAGAASRLDVVQAEGLVQSTLAEIPGLETNIRVS 239

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            H+I+TLLG PA+  +  + K     QP     IN GIPADLIRNRPDIR  E+ LA + 
Sbjct: 240 AHHIATLLGLPASALVDELLK--GRGQPVFRGGINSGIPADLIRNRPDIRVAERDLAAAT 297

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHDN--SFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
           A IG+A++ LYPS+SL+GSI+ ++ N     G  T WSFGP L LPIFD G++++N++ A
Sbjct: 298 ANIGVAEAQLYPSISLSGSISPSYINQRGIHGDLTPWSFGPTLNLPIFDGGRLRANVKSA 357

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           +S+A   Y+ W+ TVL A+++VENAL ++  D + V  LQ  V+  ++++ LS  +Y+ G
Sbjct: 358 QSTAATAYLNWKSTVLTAVEQVENALAAVRRDARTVAALQAQVKTTQETLELSTASYKDG 417

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
             SLLD+LD +R  +  +  L+ A +Q+AK YV L IA+G GY P
Sbjct: 418 ASSLLDVLDAQRQVSLAQASLAQAVQQMAKDYVSLNIAVGGGYAP 462


>gi|327188981|gb|EGE56170.1| nodulation protein (outer membrane efflux protein) [Rhizobium etli
           CNPAF512]
          Length = 478

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 190/464 (40%), Positives = 287/464 (61%), Gaps = 15/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M  LR      ++LL+GC VGP++  P MPL P +F  G +K++ ++ T  WW +F D  
Sbjct: 1   MVSLRFATPALLLLLSGCVVGPDHAPPEMPL-PAKFGEGGTKSVGDVATAAWWTAFKDPR 59

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH---------RFIPN 111
           LN  V+  L+QNLT+ QA ERINAA  N+    A   PS     SH         R   +
Sbjct: 60  LNGYVQAGLEQNLTVQQAIERINAASANVTIAGAGGLPSLNVGASHTVSGQKGELRTQFD 119

Query: 112 LKTNSTGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
            +  S G +   W +DLFG  +R  ES+ A+LDSAYA  D+AKL ++  L+ SYID R +
Sbjct: 120 TRNTSAGDVQLSWLLDLFGLYKRSTESAAASLDSAYASADVAKLTLVQDLVSSYIDVRFY 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           ++R++++   L   ++  EL+  +   GA S+L +V+ E  ++S  ++IP LE + R++ 
Sbjct: 180 QQRLALSKANLKSRQETYELTKFQLEAGAASRLDVVQAEGLVQSTLAEIPGLETNIRISA 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           H+I+TLLG PA+  ++ + +     QP  +  IN GIPADLIRNRPDIR  E+ LA + A
Sbjct: 240 HHIATLLGLPASALVNELLR--GGGQPVFHGGINSGIPADLIRNRPDIRVAERDLAAATA 297

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDN--SFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
            IG+A++ LYPS+SL+GSI+ ++ N     G  T WSFGP L LPIFD G++++N++ A+
Sbjct: 298 NIGVAEAQLYPSISLSGSISPSYINQRGVHGGLTPWSFGPTLNLPIFDGGRLRANVKSAQ 357

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           S A   Y+ W+ TVL A+++VENAL ++  D + V  LQ  V+  ++++ LS  +Y+ G 
Sbjct: 358 SDAATAYLNWKSTVLTAVEQVENALAAVRRDAQTVAALQAQVKTTQETLELSTASYKDGA 417

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            SLLD+LD +R  +  +  L+ + +Q+AK YV L IA+G GY P
Sbjct: 418 SSLLDVLDAQRQVSLAQASLAQSVQQMAKDYVSLNIAVGGGYAP 461


>gi|325293923|ref|YP_004279787.1| nodulation protein T precursor [Agrobacterium sp. H13-3]
 gi|325061776|gb|ADY65467.1| nodulation protein T precursor [Agrobacterium sp. H13-3]
          Length = 480

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 191/460 (41%), Positives = 285/460 (61%), Gaps = 17/460 (3%)

Query: 4   LRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNK 63
           +RA   L ++LL+GC VGP++  P + L P +F+     +  +I ++ WW +FND  LN 
Sbjct: 4   IRATIPLTMLLLSGCVVGPDHKTPEIQL-PGKFAEAGKTSNGDISSVAWWTAFNDNRLNG 62

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH---------RFIPNLKT 114
            V   L QNLT++QA ERIN A+  ++   A   PS   S SH         R +P +  
Sbjct: 63  YVSTGLAQNLTVMQAIERINQAQAQVIVDGAGGLPSLTGSGSHTTSETKGSYRDVP-VTN 121

Query: 115 NSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
            S G L   W +DLFG+ RR  ES+ A+LD+AY+ VD+ +L +IS +  +YID R+++ER
Sbjct: 122 VSNGSLSVSWFLDLFGRYRRATESADASLDAAYSTVDVQRLTLISSVAAAYIDVRYYQER 181

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
           ++IA Q L   ++ ++L+ L+   GA S+L +V+ E  + S  S IP LE SFR + H I
Sbjct: 182 LAIARQNLSSRRETLDLTKLQLEAGAASRLDVVQSEGLVNSTLSQIPGLETSFRKSAHRI 241

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
           +TLLG PA+  +  +QK +   QP        GIPADLIRNRPDIR  E+ LA +VA IG
Sbjct: 242 ATLLGMPASSLIAELQKGAR--QPVARAVPRTGIPADLIRNRPDIRVAERNLAAAVATIG 299

Query: 294 IAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESS 350
           + ++ LYPS+ L G+I  +++       G    WSFGP L LPI D G++++N+  A S 
Sbjct: 300 VTEAQLYPSIELGGAITPSYNFLSGGGRGTANSWSFGPSLTLPILDGGRLRANVDIANSQ 359

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
           A+EQY+ W+ TVLNA++EVENAL +IN D++ V  L+  V  +++++ LS  +YR G  S
Sbjct: 360 AREQYLVWKATVLNAVEEVENALAAINRDQRTVDALRKTVSSYQEALQLSTASYRDGASS 419

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           LLD+LD +R+ +  + +L+ A +  A+ YV L +A+G GY
Sbjct: 420 LLDVLDAQRSVSDAQANLATAIQTTAQDYVSLNVALGGGY 459


>gi|159185264|ref|NP_355492.2| nodulation protein T precursor [Agrobacterium tumefaciens str. C58]
 gi|9957271|gb|AAG09298.1|AF177860_1 NodT homolog [Agrobacterium tumefaciens]
 gi|9963889|gb|AAG09747.1|AF232237_5 outer membrane protein [Agrobacterium tumefaciens]
 gi|159140524|gb|AAK88277.2| nodulation protein T precursor [Agrobacterium tumefaciens str. C58]
          Length = 484

 Score =  367 bits (943), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 185/461 (40%), Positives = 286/461 (62%), Gaps = 17/461 (3%)

Query: 4   LRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNK 63
           +RA   L ++LL+GC VGP++  P + L P +F+     +  +I T+ WW +FND+ LN 
Sbjct: 4   IRATLPLTMLLLSGCVVGPDHQTPEIQL-PGKFAEAGKTSNGDISTVAWWNAFNDSRLNG 62

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF------IP----NLK 113
            V   L QNLT+LQA ERIN A+ NI    A   PS  ++  H+       +P    N+ 
Sbjct: 63  YVSTGLTQNLTVLQAIERINQAQSNITVAGAGSLPSLTSTFRHQTQGSGGSLPSTNDNVT 122

Query: 114 TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
             ++   +  W +DLFGQ RR  ES+ A+LD+AYA  ++ +L +IS +  +YID R+++E
Sbjct: 123 NTTSNAFNVGWLLDLFGQYRRAQESAGASLDAAYATANVQRLTLISAVTSAYIDVRYYQE 182

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
           R++IA Q L   ++ + L+ L+   GA S+L +V+ E  + S  + +P LE +FR   H 
Sbjct: 183 RLAIARQNLGSRRETLSLTKLQLDAGAASRLDVVQSEGLVNSTLAQMPALETNFRRAAHR 242

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           I+TLLG PA   +  +Q+ +   QP        GIPADLIRNRPDIR  E++LA +VA I
Sbjct: 243 IATLLGMPADSLVMELQRGAR--QPVARTIPRTGIPADLIRNRPDIRVAERQLAAAVADI 300

Query: 293 GIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G+A++ LYPS++L+GSI  +     N   G +  W FGP + LPI D G++++ +   +S
Sbjct: 301 GVAEAQLYPSITLSGSITPSFTKISNGASGTSNGWGFGPSITLPILDGGRLRAGVDIQKS 360

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
            A+EQY+ W+ TVLNA++EVENALT++N D++ V+  +  V  +++++SL+  +YR G  
Sbjct: 361 VAREQYLAWKATVLNAVEEVENALTALNRDQQTVSAYRRTVSSYQEALSLATASYRDGAS 420

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           SLLD+LD +R  +  +  L+ A +Q A+ YV L +A+G GY
Sbjct: 421 SLLDVLDAQRNVSDAQSQLATAIQQAAQDYVALSVALGGGY 461


>gi|116254733|ref|YP_770569.1| nodulation protein NodT [Rhizobium leguminosarum bv. viciae 3841]
 gi|115259381|emb|CAK10516.1| putative outer membrane protein, similar to nodulation protein NodT
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 484

 Score =  365 bits (936), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 190/460 (41%), Positives = 286/460 (62%), Gaps = 16/460 (3%)

Query: 4   LRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNK 63
           LR   S   +LLAGC  GP++  P MPL P +F  G SK+  ++   +WW ++ D  L+ 
Sbjct: 12  LRYAASAITLLLAGCVSGPDHAPPQMPL-PAKFQEGGSKSNGDVVAAQWWTAYRDKQLDG 70

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH---------RFIPNLKT 114
           LV   L +NL +LQA ERIN+A  N+    A   PS     SH         R     K 
Sbjct: 71  LVAHGLSENLDVLQALERINSASANVTVAGAGGLPSLDVGASHTVYGEKGSQRTTIGTKN 130

Query: 115 NSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
            + G+    W +D FGQ RR  ES++A+L +AYA  D AKL  +  L+ SY+DAR++++R
Sbjct: 131 TTGGEASLSWLLDFFGQYRRSKESAIASLGAAYATADDAKLTFLKDLVSSYVDARYYQQR 190

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
           I+++   L   ++  EL+ L+   GA S+L +V+ E  ++S ++DIP LE+SF ++ H+I
Sbjct: 191 IALSQANLKSRQETYELTQLQLKAGAASRLDVVQAEGLVQSTKADIPGLEQSFTVSAHHI 250

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
           + LLG PA   ++ +Q+ +   QP     I  GIPADLIRNRPDIR  E+ LA +VA IG
Sbjct: 251 ALLLGMPAASLMNELQRSTG--QPVFRGDIRAGIPADLIRNRPDIRKAERDLAAAVADIG 308

Query: 294 IAKSDLYPSLSLNGSIA---LTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESS 350
            A++ LYPS+SL+GSI+   +    +  G  T WSFGP L LPIFD GK+++N+   +S 
Sbjct: 309 AAEAQLYPSISLSGSISPSWVKSSGASGGTMTSWSFGPTLNLPIFDGGKLRANVDIEKSD 368

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
           A+ QY+ W+E VLN ++EVENAL+++  D + +  L+  V+  ++S++LS  +Y+ G  S
Sbjct: 369 AKAQYLAWKEAVLNGVEEVENALSAVRRDTQTLAPLRRQVQTAEESLALSTTSYKDGASS 428

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           LLD+LD +R+ +  +  L+   +++AK YVDLY+AIG+GY
Sbjct: 429 LLDVLDAQRSVSDAQASLAATVQEVAKDYVDLYVAIGAGY 468


>gi|241206136|ref|YP_002977232.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240860026|gb|ACS57693.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 477

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 188/464 (40%), Positives = 287/464 (61%), Gaps = 15/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M  LR      ++LL+GC VGP++  P MPL P +F  G +K+  ++ T+ WW +F D  
Sbjct: 1   MVSLRFATPALLLLLSGCVVGPDHVPPEMPL-PAKFGEGGTKSDGDVTTVAWWSAFRDRK 59

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH---------RFIPN 111
           L+ LV+  L QNL++ QA ERINAA  N+    A   P+     SH         R   +
Sbjct: 60  LDGLVQSGLDQNLSVQQAIERINAASANVTVAGAGALPNLTVGASHTVSGQKGELRTQFD 119

Query: 112 LKTNSTGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
            +  S G+    W +D+FG  +R+ ES+LA+LDSAYA  D+AKL ++  L+ SYID R++
Sbjct: 120 TRNTSGGEAQLTWLLDIFGLYKRNTESALASLDSAYASADVAKLTLVQDLVSSYIDVRYY 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           ++R++++   L   ++  EL+  +   GA S+L +V+ E  ++S  ++IP LE + R++ 
Sbjct: 180 QQRLALSKANLKSRQETYELTKFQLEAGAASRLDVVQAEGLVQSTLAEIPGLETNIRISA 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           H+I+TLLG PA   +  + K     QP     I  GIPADLIRNRPDIR  E+ LA + A
Sbjct: 240 HHIATLLGLPAATLVDDLLKGYG--QPVFRGGITSGIPADLIRNRPDIRVAERDLAAATA 297

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDN--SFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
           +IG+A++ LYPS+SL+GSI+  + N     G  T WSFGP L LPIFD G +++ ++ A+
Sbjct: 298 QIGVAQAQLYPSISLSGSISPAYINQRGIHGGLTPWSFGPTLNLPIFDGGTLRAGVKTAQ 357

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           S+A   Y+ W+ TVL AI++VENAL+++  D + V+ LQ  V+  ++++ LS  +Y+ G 
Sbjct: 358 SNAAAAYLNWKSTVLTAIEQVENALSAVRRDARTVSALQAQVKTTQETLELSTASYKDGA 417

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            SLLD+LD +R  +  +  L+ A +Q+AK YV L IA+G G+ P
Sbjct: 418 SSLLDVLDAQRQVSLAQASLAAAVQQMAKDYVSLNIAVGGGFAP 461


>gi|116253616|ref|YP_769454.1| nodulation protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115258264|emb|CAK09366.1| putative exported nodulation like protein [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 477

 Score =  360 bits (923), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 188/464 (40%), Positives = 287/464 (61%), Gaps = 15/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M  LR      ++LL+GC VGP++  P MPL P +F  G +K+  ++ T+ WW +F D  
Sbjct: 1   MVSLRFATPALLLLLSGCVVGPDHVPPEMPL-PAKFGEGGTKSDGDVTTVAWWSAFKDRK 59

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH---------RFIPN 111
           L+ LV+  L QNL++ QA ERIN+A  N+    A   P+     SH         R   +
Sbjct: 60  LDGLVQSGLDQNLSVQQAIERINSASANVTVAGAGALPNLTVGASHTVSGQKGELRTQFD 119

Query: 112 LKTNSTGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
            +  S G+    W +D+FG  +R+ ES+LA+LDSAYA  D+AKL ++  L+ SYID R++
Sbjct: 120 TRNTSGGEAQLTWLLDIFGLYKRNTESALASLDSAYASADVAKLTLVQDLVSSYIDVRYY 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           ++R++++   L   ++  EL+  +   GA S+L +V+ E  ++S  ++IP LE + R++ 
Sbjct: 180 QQRLALSKANLKSRQETYELTKFQLEAGAASRLDVVQAEGLVQSTLAEIPGLETNIRISA 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           H+I+TLLG PA   +  + K     QP     I  GIPADLIRNRPDIR  E+ LA + A
Sbjct: 240 HHIATLLGLPAATLVDDLLKGYG--QPVFRGGITSGIPADLIRNRPDIRVAERDLAAATA 297

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDN--SFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
           +IG+A++ LYPS+SL+GSI+  + N     G  T WSFGP L LPIFD G +++ ++ A+
Sbjct: 298 QIGVAQAQLYPSISLSGSISPAYINQRGIHGGLTPWSFGPTLNLPIFDGGTLRAGVKTAQ 357

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           S+A   Y+ W+ TVL AI++VENAL+++  D + V+ LQ  V+  ++++ LS  +Y+ G 
Sbjct: 358 SNAAAAYLNWKSTVLTAIEQVENALSAVRRDARTVSALQAQVKTTQETLELSTASYKDGA 417

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            SLLD+LD +R  +  +  L+ A +Q+AK YV L IAIG G+ P
Sbjct: 418 SSLLDVLDAQRQVSLAQASLAAAVQQMAKDYVSLNIAIGGGFAP 461


>gi|450923|emb|CAA54418.1| unnamed protein product [Rhizobium leguminosarum]
          Length = 471

 Score =  355 bits (911), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 190/464 (40%), Positives = 282/464 (60%), Gaps = 17/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M  LR      ++LL+GC VGP+   P MPL P +F  G +K+  ++ T  WW +F D+ 
Sbjct: 1   MVSLRFATPALLLLLSGCVVGPDLVPPEMPL-PAKFGEGGTKSDGDVATAAWWTAFKDSR 59

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH---------RFIPN 111
           LN  VK  L QNLT+ QA ERINAA  N+ +  A   PS     S          R   +
Sbjct: 60  LNGYVKAGLDQNLTVQQAIERINAASANVTTAGAGGLPSLTVGASQTVSGQKAELRTQLD 119

Query: 112 LKTNSTGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
            +  S G +   W +DLFG  +R+ ES+LA+LDSAYA  D+A+L +I  L+ SYID R +
Sbjct: 120 TRNTSAGDVSLSWLLDLFGLYKRNTESALASLDSAYASADVARLTLIQDLVSSYIDVRFY 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           ++R++++   L   ++  EL+  +   GA   L +V+ E  ++S  ++IP LE + R++ 
Sbjct: 180 QQRLAVSKANLKSRQETYELTKFQLEAGA-RPLDVVQAEGLVQSTLAEIPGLETNIRISA 238

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           H+I+TLLG PA+  +  + K S   QP     I  GIPADLIRNRPDIR +E+ LA + A
Sbjct: 239 HHIATLLGLPASRLVDELLKGSG--QPVFRGGITSGIPADLIRNRPDIRSRERDLAAATA 296

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDN--SFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
            IG+A++ LYPS+SL+GSI+  H N     G    WSFGP L LPIFD G++++N++ A+
Sbjct: 297 NIGVAQAQLYPSISLSGSISPLHVNQRGIHGGLDRWSFGPTLNLPIFDGGRLRANVKSAQ 356

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           S A   Y+ W+ TVL A+++VENAL+++  D + V  LQ  V+   +++ LS  +Y+ G 
Sbjct: 357 SDAATAYLNWKSTVLTAVEQVENALSAVRRDAQTVAALQAQVKTTTETLELSTASYKDGA 416

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            SLLD+LD ++ +   +  L+ + +Q+AK YV L IAIG G+ P
Sbjct: 417 SSLLDVLDAQQVSL-AQASLAASVQQMAKDYVSLNIAIGGGFAP 459


>gi|241554290|ref|YP_002979503.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240863596|gb|ACS61258.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 477

 Score =  354 bits (909), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 191/465 (41%), Positives = 287/465 (61%), Gaps = 18/465 (3%)

Query: 1   MNI--LRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFND 58
           MN+  LR   S   +LLAGC  GP +  P MPL P +F  G++K+  ++   +WW ++ D
Sbjct: 1   MNLSSLRYAASAVTLLLAGCVSGPNHVPPEMPL-PAKFKEGSTKSNGDVVAAQWWTAYRD 59

Query: 59  TSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH---------RFI 109
             L+ LV     +NL +LQA ERIN+A  N+    A   PS     SH         R  
Sbjct: 60  KRLDGLVAHGRSENLDVLQALERINSASANVTVAAAGGLPSLDVGASHTVSGEKGSERTT 119

Query: 110 PNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
                 + G+    W +D+FGQ RR  ES++A+L +AYA  D AKL  +  L+ SYIDAR
Sbjct: 120 IGTTNETGGEASLSWLLDIFGQYRRSKESAIASLGAAYATADNAKLTFLKDLVESYIDAR 179

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
           ++++RI+++   L   ++  EL+ L+   GA S+L +V+ E  ++S +SDIP LE+SF  
Sbjct: 180 YYQQRIALSQANLKSRQQTYELTQLQLKAGAASRLDVVQAEGLVQSTKSDIPGLEQSFTE 239

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
           + H+I+TLLG PA   +  +QK +   QP     I  GIPADLIRNRPDIR  E++LA +
Sbjct: 240 SGHHIATLLGMPAASLMGELQKSAG--QPVFRGDIRAGIPADLIRNRPDIRKAERELAAA 297

Query: 289 VAKIGIAKSDLYPSLSLNGSIA---LTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
           VA IG A++ LYPS+SL+GSI+   +    +  G  T W+FGP L LPIFD GK+++N+ 
Sbjct: 298 VADIGAAEAQLYPSISLSGSISPSWVKSSGASGGTLTSWTFGPTLNLPIFDGGKLRANVD 357

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
             +S A+ QY+ W+  VLN ++EVENAL+++  D + +  L+  V+  ++S++LS  +Y+
Sbjct: 358 IEKSDARTQYLAWKAAVLNGVEEVENALSAVRRDTQTLEPLRRQVQTAQESLALSTTSYK 417

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            G  SLLD+L+ +R+ +  +  L+   +Q+AK YVDLY+AIG+GY
Sbjct: 418 DGASSLLDVLEAQRSVSDAQESLADTVQQVAKDYVDLYVAIGAGY 462


>gi|209546453|ref|YP_002278371.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209537697|gb|ACI57631.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 483

 Score =  353 bits (907), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 192/463 (41%), Positives = 284/463 (61%), Gaps = 16/463 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           ++ LR   S   +LL GC  GP++  P MPL P +F  G +K+  N+ T++WW ++ D  
Sbjct: 9   LSSLRYAASALTLLLTGCVSGPDHVPPQMPL-PAKFEEGGNKSNGNVVTVEWWTAYRDKR 67

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH---------RFIPN 111
           L+ LV   L +NL +LQA E INAA  N+    A   PS     SH         R    
Sbjct: 68  LDGLVAHGLSENLDVLQALESINAASANVTVAGAGGLPSLTVDASHTLSGEKGRLRTTVG 127

Query: 112 LKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
               + G+    W +D FGQ RR  ES++A+L +AYA  D AKL  +  L+ SYIDAR++
Sbjct: 128 TTNTTGGEASLSWLLDFFGQYRRSKESAIASLGAAYATADNAKLTFLKDLVESYIDARYY 187

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           +ERI+++   +   ++  EL+ L+   GA S+L +V+ E  ++S ++DIP LEKSF  + 
Sbjct: 188 QERIALSQASVKSRQQTYELTLLQLKAGAASRLDVVQAEGLVQSTKADIPGLEKSFTESA 247

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           H+I+TLLG PA+  +  +QK +   QP     +  GIPADLIRNRPDIR  E+ LA +VA
Sbjct: 248 HHIATLLGMPASSLMGELQKSAG--QPVFRGDMRAGIPADLIRNRPDIRKAERDLAAAVA 305

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNSFPGYN---THWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++ LYPS+SL+GSI+ +   S        T WSFGP L LPIFD G +++N+   
Sbjct: 306 DIGAAEAQLYPSISLSGSISPSWVKSSGAKGASLTSWSFGPSLNLPIFDGGTLRANVDIE 365

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           +S A+ QY+ W+  VLN ++EVENALT++  D + +  L+  V+  ++S++LS  +Y+ G
Sbjct: 366 KSDAKTQYLAWKAEVLNGVEEVENALTAVRRDTQTLEPLRRQVQTSQESLALSTASYKDG 425

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             SLLD+L+ +R+ +  E  L+   +Q+AK YVDLY+AIG+GY
Sbjct: 426 ASSLLDVLEAQRSVSDAEASLAATVQQVAKDYVDLYVAIGAGY 468


>gi|222084360|ref|YP_002542889.1| nodulation protein (outer membrane efflux protein) [Agrobacterium
           radiobacter K84]
 gi|221721808|gb|ACM24964.1| nodulation protein (outer membrane efflux protein) [Agrobacterium
           radiobacter K84]
          Length = 484

 Score =  349 bits (895), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 178/448 (39%), Positives = 279/448 (62%), Gaps = 15/448 (3%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTIL 76
           GC  GP++  P MPL P +FS G +K   ++   +WW +F D+ LN      L +NL I 
Sbjct: 17  GCVSGPDHKPPEMPL-PAKFSEGGTKINGDLAGSQWWTAFGDSKLNAFAAQGLAENLNIQ 75

Query: 77  QATERINAAKENILSVRADLFPSSYASISH---------RFIPNLKTNSTGQLDSDWKID 127
           QA ERIN A+  +++  A   PS  AS  H         R     + ++TG     W +D
Sbjct: 76  QALERINQAQAAVITAGAGGLPSLTASGDHTTNGQKGSLRTQSETQNSTTGGASVSWLLD 135

Query: 128 LFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKK 186
           L+GQ RR  E ++A+LD+AY+ VD A+L  +  L  SY++AR+++ RISIA   L   ++
Sbjct: 136 LWGQYRRAKEGAVASLDAAYSSVDTARLTYLQDLANSYVNARYYQARISIAQDNLKSRRE 195

Query: 187 NIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLH 246
            + L+  +   GA S+L +V+ E  + S  S++P LE S+R +VH+I+TLL   +   + 
Sbjct: 196 TLALTKFQLEAGAASRLDVVQAEGLVNSTLSEVPGLEISYRQSVHHIATLLNVSSATVIA 255

Query: 247 YMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLN 306
            MQ      QP     +N GIPADLIRNRPDIR  E+ LA++ A+IG+A++ L+P+++L+
Sbjct: 256 QMQ--GGGRQPVFRGRVNSGIPADLIRNRPDIRVAERNLANATAQIGVAEAQLFPTITLS 313

Query: 307 GSIALT--HDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLN 364
           G+I+ +  H +S  G  T WSFGP L LPIFD G +++N++ AESS++E YI WQ+TV +
Sbjct: 314 GAISPSYVHTSSRSGSLTTWSFGPTLTLPIFDGGALRANVKTAESSSRELYIVWQQTVRS 373

Query: 365 AIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKV 424
           A+++VENAL++++ D + V+ L+  V+ +++++ LS  +Y+ G  SLLD+LD +R  +  
Sbjct: 374 AVEDVENALSAVSRDAQTVSALRAQVKSYQEALQLSTASYKDGASSLLDVLDAQRNVSTA 433

Query: 425 EVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           +  L+ A +Q A  Y+ L + IG+GY P
Sbjct: 434 QESLATAIQQSAIDYISLNVNIGAGYVP 461


>gi|86360104|ref|YP_471993.1| nodulation protein [Rhizobium etli CFN 42]
 gi|86284206|gb|ABC93266.1| nodulation protein [Rhizobium etli CFN 42]
          Length = 483

 Score =  348 bits (893), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 184/447 (41%), Positives = 276/447 (61%), Gaps = 16/447 (3%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTIL 76
           GC  GP++  P MPL P  F  G  K+  ++ T +WW ++ D  L+ LV   L++NL +L
Sbjct: 25  GCVSGPDHVPPQMPL-PANFEEGGKKSNGHVVTAEWWTAYRDKPLDGLVTHGLRENLDVL 83

Query: 77  QATERINAAKENILSVRADLFPSSYASISH---------RFIPNLKTNSTGQLDSDWKID 127
           QA E IN+A  N+    A   PS     SH         R        S G+    W +D
Sbjct: 84  QALENINSASANVTIAGAGGLPSLTVGASHTLSGEKGRLRTTVGTTNTSGGEASLSWLLD 143

Query: 128 LFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKK 186
            FGQ RR  ES++A+L +AYA  D AKL  +  L+ SYIDAR+++ERI+++   L   ++
Sbjct: 144 FFGQYRRSRESAIASLGAAYATADNAKLTFLKDLVESYIDARYYQERIALSQANLKSRQQ 203

Query: 187 NIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLH 246
             EL+ L+   GA S+  +V+ E  +KS +S+IP L++SF  + H+I+TL+G PA+  + 
Sbjct: 204 TYELTQLQLRAGAASRPDVVQAEGLVKSTKSEIPGLQQSFTESAHHIATLIGMPASSLMG 263

Query: 247 YMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLN 306
            +QK++   QP     +  GIPADLIRNRPDIR  E++LA +VA IG A++ LYPS++L+
Sbjct: 264 ELQKRAG--QPVFRGDLRAGIPADLIRNRPDIRMAERELAAAVADIGAAEAQLYPSITLS 321

Query: 307 GSIA---LTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVL 363
           GSI+   +    +  G  T WSFGP L LPIFD G +++N+   +S A+ QY+ W+  VL
Sbjct: 322 GSISPSWVKSSGASGGSLTSWSFGPSLNLPIFDGGTLRANVEIEKSDAKAQYLAWKAAVL 381

Query: 364 NAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAK 423
           N ++EVENALT++  D + +  L+  V+  ++S++LS  +Y+ G  SLLDILD +R+ + 
Sbjct: 382 NGVEEVENALTAVRRDTQTLEPLRRQVQTAQESLALSTTSYKDGASSLLDILDAQRSVSD 441

Query: 424 VEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            +  L+   +Q+AK YVDLY+AIG+GY
Sbjct: 442 AQASLAATVQQVAKDYVDLYVAIGAGY 468


>gi|222106969|ref|YP_002547760.1| nodulation protein T precursor [Agrobacterium vitis S4]
 gi|221738148|gb|ACM39044.1| nodulation protein T precursor [Agrobacterium vitis S4]
          Length = 483

 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 184/465 (39%), Positives = 289/465 (62%), Gaps = 21/465 (4%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M  +R      ++LL+GC +GPE++ P   L P +F+ G +K+  +  T++WW +FND  
Sbjct: 1   MVSVRLAAPFAMLLLSGCVMGPEHSPPQTAL-PAKFTEGGTKSAQDTTTVQWWTAFNDAR 59

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTN----- 115
           LN L+   + QNL +LQA ERI  A+  +++  A   PS   + S       +TN     
Sbjct: 60  LNTLINQGVNQNLDVLQALERIEQARATVVTSSAGGLPSLTGTASES---GSQTNGGYNS 116

Query: 116 ------STGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
                 S G+L + W +DL+GQ RR  +S+ A+LD+AYA VD ++L  +S L  +YIDAR
Sbjct: 117 QPRAWESKGELSASWLLDLWGQYRRAKQSATASLDAAYASVDTSRLTYLSDLATAYIDAR 176

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
           +++ RI+IA++ +   ++ + L+ L+   GA S+L +V+ E  + S  +DIP  E +F  
Sbjct: 177 YYQARIAIANEAVKSRRETLALTKLQLEAGAASRLDVVQSEGLVNSQLADIPGFEANFYS 236

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
           N ++ISTLLG PA+  ++ ++K +   QP     +  GIPADLIRNRPDIR  E+ LA +
Sbjct: 237 NAYHISTLLGLPASTLINDLKKHAP--QPVARRVVLSGIPADLIRNRPDIRKAERDLAAA 294

Query: 289 VAKIGIAKSDLYPSLSLNGSIA--LTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           V  IG A++ L PS++L+GSI+    H N+    NT WSFGP L LPIFD G +++N++ 
Sbjct: 295 VYDIGNAQAQLLPSITLSGSISPSYVHSNTHGTANT-WSFGPSLNLPIFDGGTLRANVKN 353

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
           A+S A+E+Y+ W++TVLN +++VE+AL + N D + V   +  V+ +K+++ LS  +Y+ 
Sbjct: 354 AQSVAREKYLAWKQTVLNGVEDVESALAAYNRDARAVAANRAYVKSYKEALELSTASYKD 413

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           G  SLLD+LD +R     +  L+ + +Q+A  YV L +AIG GYN
Sbjct: 414 GASSLLDVLDAQRELTTAQASLAESIQQMANDYVTLNVAIGGGYN 458


>gi|128491|sp|P24145|NODT_RHILT RecName: Full=Nodulation protein T; Flags: Precursor
 gi|46245|emb|CAA35773.1| nodT protein (AA 1-467) [Rhizobium leguminosarum]
          Length = 467

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 186/464 (40%), Positives = 283/464 (60%), Gaps = 15/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M   R     F +LL+GC VGP Y  P MPL P +FS G   +  ++  + WW +FND  
Sbjct: 1   MRFTRYTTPFFSLLLSGCVVGPNYAPPEMPL-PAKFSEGGVTSNGDVTVVAWWTAFNDPM 59

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH---------RFIPN 111
           L   V+  + QNL + QA ERI+ A  N+    A   P    S SH         R    
Sbjct: 60  LTSYVEQGISQNLDVQQAIERIDLAAANVTIAEASALPDLTLSGSHTVSGQKGKLRKQTY 119

Query: 112 LKTNSTGQLDSDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
               STG+L   W +D    +R+ ES+ A LD+AYA VD+AKL  I+ +I SY+DAR+++
Sbjct: 120 TSNTSTGELSLSWLLDFGVYKRNTESAEAALDAAYASVDMAKLAFINDIISSYVDARYYQ 179

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
            R++++   L   ++  EL+  KF  GA +++ +V+ E  ++S  ++IP+L+ +FR++ H
Sbjct: 180 RRLALSQANLKSRRETFELTKSKFAAGAVARMDVVRAEGLVQSTLAEIPSLDANFRISAH 239

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
            I+TLLG PA   +  + K SN  QP     +N+GIPAD+IRNRPDIR  E+ LADS A+
Sbjct: 240 RIATLLGKPAGSMVEEIAKGSN--QPAFRADVNVGIPADIIRNRPDIRKAERDLADSTAQ 297

Query: 292 IGIAKSDLYPSLSLNGSIALT---HDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
           IG+A++ L+PS++L+GSI+ +   ++    G  T WSFGPKL LPI D G +++++  A+
Sbjct: 298 IGVAEAKLFPSITLSGSISPSGGINERGVYGNLTPWSFGPKLKLPILDGGGLRADVDSAK 357

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           S A   Y+ W+  VLNAI++VENAL ++  + + V  L+  VE+ ++++ LS  +Y+ G 
Sbjct: 358 SKATVSYLKWKSRVLNAIEQVENALVAMQREGRTVRALKREVEIAQETLRLSTSSYKDGA 417

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            SLLD+L+ +R+ +  +  L+ A ++ AK Y  L IAIGSGYNP
Sbjct: 418 SSLLDLLEAQRSLSVTQASLARAVQEWAKLYAVLNIAIGSGYNP 461


>gi|327190840|gb|EGE57905.1| nodulation protein [Rhizobium etli CNPAF512]
          Length = 447

 Score =  338 bits (866), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 187/435 (42%), Positives = 274/435 (62%), Gaps = 16/435 (3%)

Query: 29  MPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKEN 88
           MPL P +F    S +  N+   +WW ++ D  LN LV   L++NL +LQA E IN+A  N
Sbjct: 1   MPL-PAKFEESGSTSNGNVVNDEWWTAYRDKQLNGLVTHGLRENLDVLQALESINSASAN 59

Query: 89  ILSVRADLFPSSYASISH-------RFIPNL-KTNSTGQLDS-DWKIDLFGQ-RRHIESS 138
           +    A   PS     SH       R   ++  TN+TG   S  W +D FGQ RR  ES+
Sbjct: 60  VTVAGAGGLPSLTVGASHTLSGEKGRLRTSVGATNTTGGEASLSWLLDFFGQYRRSRESA 119

Query: 139 LANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQG 198
           +A+L +AYA  D AKL  +  L+ SYIDAR+++ERI+++   L   ++  EL+ L+   G
Sbjct: 120 IASLGAAYATADNAKLTFLKDLVESYIDARYYQERIALSRASLKSRQQTYELTQLQLKAG 179

Query: 199 ATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPN 258
           A S+L +V+ E  ++S +SDIP LEKSF  + H+I+TL+G PA+  +  +QK +   QP 
Sbjct: 180 AASRLDVVQAEGLVQSTKSDIPGLEKSFTESAHHIATLIGMPASSLMGELQKSAG--QPV 237

Query: 259 LYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFP 318
               +  GIPADLIRNRPDIR  E++LA +VA IG A++ LYPS+SL+GSI+ +   S  
Sbjct: 238 FRSDLRAGIPADLIRNRPDIRKAERELAAAVANIGAAEAQLYPSISLSGSISPSWVKSSG 297

Query: 319 GYN---THWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTS 375
                 T WSFGP L LPIFD GK++SN+   +S A+ QY+ W+  VLN ++EVENALT+
Sbjct: 298 AKGASLTSWSFGPSLNLPIFDGGKLRSNVDIEKSDARTQYLAWKAAVLNGVEEVENALTA 357

Query: 376 INEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQL 435
           +  D + +  L+  V+  ++S++LS ++Y+ G  SLLD+LD +R+ +  +  L+   +Q+
Sbjct: 358 VRRDTQALEPLRRQVQTAQESLALSTVSYKDGASSLLDVLDAQRSVSDAQASLATTVQQV 417

Query: 436 AKSYVDLYIAIGSGY 450
           AK YVDLY+AIG+GY
Sbjct: 418 AKDYVDLYVAIGAGY 432


>gi|71040804|gb|AAZ20314.1| putative outer membrane protein NodTpc [Rhizobium etli]
          Length = 483

 Score =  335 bits (859), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 181/447 (40%), Positives = 268/447 (59%), Gaps = 16/447 (3%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTIL 76
           GC  GP++  P MPL P  F  G  K+  ++ T +WW ++ D  L+ LV   L++NL +L
Sbjct: 25  GCVTGPDHVPPQMPL-PANFEEGGKKSNGHVVTAEWWTAYRDKPLDGLVTHGLRENLDVL 83

Query: 77  QATERINAAKENILSVRADLFPSSYASISH---------RFIPNLKTNSTGQLDSDWKID 127
           QA E IN+A  N+    A   PS     SH         R        S G+    W +D
Sbjct: 84  QALENINSASANVTIAGAGGLPSLTVGASHTLSGEKGRLRTTVGTTNTSGGEPSLSWLLD 143

Query: 128 LFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKK 186
            FGQ RR  ES++A+L +AYA  D AKL  +  L+ SYIDAR+++ERI+++   L   ++
Sbjct: 144 FFGQYRRSRESAIASLGAAYATADNAKLTFLKDLVESYIDARYYQERIALSQANLKSRQQ 203

Query: 187 NIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLH 246
             EL+ L+   GA S+  +V+ E  +KS +S+IP L++SF  + H+I+TL+G PA+  + 
Sbjct: 204 TYELTQLQLRAGAASRPDVVQAEGLVKSTKSEIPGLQQSFTESAHHIATLIGMPASSLMG 263

Query: 247 YMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLN 306
            +QK++   QP     +  GIPADLIRNRPDIR  E++LA +VA IG A++ LYPS++L+
Sbjct: 264 ELQKRAG--QPVFRGDLRAGIPADLIRNRPDIRMAERELAAAVADIGAAEAQLYPSITLS 321

Query: 307 GSIA---LTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVL 363
           GSI+   +    +  G  T WSFGP L LPIFD G +++N+   +S A+ QY+ W+  VL
Sbjct: 322 GSISPSWVKSSGASGGSLTSWSFGPSLNLPIFDGGTLRANVEIEKSDAKAQYLAWKAAVL 381

Query: 364 NAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAK 423
           N ++EVENALT++  D +       A       ++LS  +Y+ G  SLLDILD +R+ + 
Sbjct: 382 NGVEEVENALTAVRRDTQTAGAAAPAGADGAGIVALSTTSYKDGASSLLDILDAQRSVSD 441

Query: 424 VEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            +  L+   +Q+AK YVDLY+ IG+GY
Sbjct: 442 AQASLAATVQQVAKDYVDLYVPIGAGY 468


>gi|218462910|ref|ZP_03503001.1| nodulation protein (outer membrane efflux protein) [Rhizobium etli
           Kim 5]
          Length = 478

 Score =  315 bits (807), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 161/398 (40%), Positives = 244/398 (61%), Gaps = 15/398 (3%)

Query: 29  MPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKEN 88
           MPL P +F  G +K++ ++ T  WW +FND  LN  V+  L+QNLT+ QA ERINAA  N
Sbjct: 1   MPL-PAKFGEGGTKSVGDVATAAWWTAFNDPKLNGYVQAGLEQNLTVQQAIERINAASAN 59

Query: 89  ILSVRADLFPSSYASISH---------RFIPNLKTNSTGQLDSDWKIDLFG-QRRHIESS 138
           +    A   PS     SH         R   + +  S G +   W +DLFG  +R  ES+
Sbjct: 60  VTIAGAGGLPSLNVGASHTISGQKGELRTQFDTRNTSAGDVQLSWLLDLFGLYKRSTESA 119

Query: 139 LANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQG 198
            A+LDSAYA  D+AKL ++  L+ SYID R +++R++++   L   ++  EL+  +   G
Sbjct: 120 AASLDSAYASADVAKLTLVQDLVSSYIDVRFYQQRLALSRANLKSRQETFELTKFQLEAG 179

Query: 199 ATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPN 258
           A S+L +V+ E  ++S  ++IP LE + R++ H+I+TLLG PA+  ++ + +     QP 
Sbjct: 180 AASRLDVVQAEGLVQSTLAEIPGLETNIRVSAHHIATLLGLPASALVNELLRGGG--QPV 237

Query: 259 LYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDN--S 316
               IN GIPADLIRNRPDIR  E+ LA + A IG+A++ LYPS+SL+GSI+ ++ N   
Sbjct: 238 YRGGINSGIPADLIRNRPDIRVAERDLAAATANIGVAEAQLYPSISLSGSISPSYINQRG 297

Query: 317 FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSI 376
             G  T WSFGP L LPI D G++++N++ A+S A   Y+ W+ TVL A+++VENA  ++
Sbjct: 298 VHGALTPWSFGPTLNLPILDGGRLRANVKSAQSEAATAYLNWKSTVLTAVEQVENAFAAV 357

Query: 377 NEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDI 414
             D + V  L+  V+  ++++ LS  +Y  G  SLLD+
Sbjct: 358 RRDARTVAALRAQVKTTQETLELSTASYNDGASSLLDV 395


>gi|116254620|ref|YP_770456.1| putative nodulation protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|462727|sp|P15727|NODT_RHILV RecName: Full=Nodulation protein T; Flags: Precursor
 gi|581512|emb|CAA35177.1| unnamed protein product [Rhizobium leguminosarum]
 gi|115259268|emb|CAK10402.1| putative nodulation protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 482

 Score =  311 bits (796), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 174/458 (37%), Positives = 279/458 (60%), Gaps = 11/458 (2%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M+  R   ++  +LL+ C +GP++  P  PL P +FS G  ++  ++    WW+SF+D +
Sbjct: 1   MHSFRLAAAVLPLLLSSCMLGPDHAPPETPL-PEKFSEGAKQSAGDVAVSAWWDSFSDRT 59

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF-----IPNLKTN 115
           LN+ V   L +NL++ QA ER+NAA  ++    A   P +  + S        I + +  
Sbjct: 60  LNQYVASGLDENLSVQQALERVNAAAADVTIAGAGGLPKASHTTSGEIGKGGDITSTQNI 119

Query: 116 STGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
           S+ QL   W +D+FGQ RR  ES+LA+LDSA+A VD AKL +I  L+ SYIDAR++++R+
Sbjct: 120 SSVQLSLTWLLDVFGQYRRSTESALASLDSAHAAVDAAKLALIKDLVSSYIDARYYQQRV 179

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
           SI+   L   ++  + ++L+   GA S+  +++ E  ++S  ++IP LE +FR++ H+I+
Sbjct: 180 SISRANLKSRQETYDFTNLQVEAGAASRQDVLQAEGLVRSTIAEIPRLELNFRVSAHHIA 239

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
            LL  P+   +  +QK     QP     IN GIPADLIRNR DIR  E+ LA + A+IG+
Sbjct: 240 ALLALPSETVIKQLQKSEG--QPVYRGKINAGIPADLIRNRFDIRQAERDLAAATAQIGV 297

Query: 295 AKSDLYPSLSLNGSIALTH--DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQ 352
           A++ LYP+++L+GSI  ++       G    WSFGP L LPI D G++++N+  ++S A 
Sbjct: 298 AEAQLYPAITLSGSITPSYIKQRGRHGGILKWSFGPSLDLPILDGGRLRANVETSKSDAA 357

Query: 353 EQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLL 412
             YI+W+ TVL A++EVE+ALT++  D       +  VE  ++++ LS  +Y  G  SLL
Sbjct: 358 AAYISWKLTVLTAVQEVEDALTAVRRDVHTENSRRRQVETIEEALKLSTASYTDGASSLL 417

Query: 413 DILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           D+L+ +R  +  +  L+ A +QLAK +V L +AI  G+
Sbjct: 418 DVLEAQRQVSSAQASLAAAIQQLAKDHVRLNVAIRGGF 455


>gi|260425364|ref|ZP_05779344.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Citreicella sp. SE45]
 gi|260423304|gb|EEX16554.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Citreicella sp. SE45]
          Length = 620

 Score =  247 bits (630), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 140/461 (30%), Positives = 244/461 (52%), Gaps = 25/461 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M   R +    ++ L+ C VGP++  P  P+    F+ G+++ +       WW S+ND  
Sbjct: 161 MKPTRLVLVPMVLALSACAVGPDFRSPSQPVA-ANFAEGSAQPIGEASAQYWWRSYNDAM 219

Query: 61  LNKLVKIALQQNLTILQATERINAAKENIL----------SVRADLFPSSYASISHRFIP 110
           LN+LV+  L QNL I  A  R+  A+              SV  D   +   +IS     
Sbjct: 220 LNELVQTGLSQNLDIKTAISRVAEAQAAARATGLPAMISGSVSGDSIRAGGEAIS----- 274

Query: 111 NLKTNSTGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
              T S    +    +DLFG +RR  E++LA+L SA   V  A+L  +S+L+ SYID R+
Sbjct: 275 GTTTTSGASFNPSLVLDLFGGERRSREAALASLQSAELSVGAARLTFLSQLVSSYIDLRY 334

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
           ++  ++I  Q L   ++ + L   +   GA + L   + +A +    + +P+LE  F  +
Sbjct: 335 YQNALTITRQTLGTRRETLSLVQSQREAGAATALDEAQAQAALDESLASLPSLESGFYAS 394

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            + I+TLL  P       +Q+ +   QP      + G+PADL+RNRPD+R  E+  A +V
Sbjct: 395 SYAIATLLAQPVQTIEARLQRGAA--QPRPGGNASAGVPADLLRNRPDVRAAERDYAAAV 452

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           A +G++++ +YPS+SL G+++ +           WSFGPK+ LP+ ++G + +   +A +
Sbjct: 453 ANVGVSEAQMYPSVSLGGTVSTSEGVG------SWSFGPKVSLPVLNQGVLAAKRDQAIA 506

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
            A++  + W+ +VL A++EV+ + +    +++ V   Q +V  +++ +SLS   Y  G  
Sbjct: 507 QAEQAELGWRSSVLGAVEEVQASQSDYIRNQRAVAAYQRSVNSYERVVSLSRETYNGGTT 566

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +LLD LD++R+ A   + L+ + R LA S+  L +A G G+
Sbjct: 567 TLLDFLDVQRSLASSRLTLASSVRDLAASWATLQVAAGKGW 607


>gi|118591601|ref|ZP_01548998.1| RND efflux system, outer membrane lipoprotein, NodT [Stappia
           aggregata IAM 12614]
 gi|118435929|gb|EAV42573.1| RND efflux system, outer membrane lipoprotein, NodT [Stappia
           aggregata IAM 12614]
          Length = 501

 Score =  246 bits (629), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 141/452 (31%), Positives = 241/452 (53%), Gaps = 13/452 (2%)

Query: 10  LFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK-WWESFNDTSLNKLVKIA 68
           +   LL+ C+VGP+Y +P + + P ++     +   ++  L  WW    D  LN L+ +A
Sbjct: 30  MAATLLSACSVGPDYQRPDISV-PGKWRNATGETPASVPQLANWWTQLGDAQLNSLIALA 88

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL-----DSD 123
           +Q NL +  A  ++  A+ +     + LFPS   +       +  ++S G L     D+ 
Sbjct: 89  VQNNLDVRTAKAKVREARASYKQASSSLFPSLDGAAGVTRSKSSGSDSVGTLWNGGFDAA 148

Query: 124 WKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILD 182
           W+ID+FG  RR  E++   LD+A   +  + L +I  L  +Y++AR  ++R+ +A     
Sbjct: 149 WEIDIFGANRRAREAAKYGLDAAEEDLRASLLTLIGDLATNYVEARGLQQRLKLAQDTAR 208

Query: 183 LYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPAT 242
             + + +L   +F  G++S L +   E +  S E++IP L+ +   ++H +S L G   T
Sbjct: 209 SQQSSADLIRKRFQAGSSSGLDVANAEGQAASTEANIPALKTALAASMHRLSVLTGQQPT 268

Query: 243 EFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPS 302
                 Q  ++N  P   +PI +GIPA ++  RPD+R  E++LA + AKIG A +  YPS
Sbjct: 269 ALTD--QLLASNRIPTPKLPIPVGIPASILLTRPDVRLAERQLAQATAKIGQATAARYPS 326

Query: 303 LSLNGSIALTH-DNSFPGYNTH--WSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQ 359
           +SL GSI     D    G N+   W+FGP L +PIF+ GK+ + +  AE+   + ++ +Q
Sbjct: 327 VSLTGSIGTAAADFGDLGKNSSISWAFGPSLSVPIFNAGKLAAGVEIAEAQRDQYFLAYQ 386

Query: 360 ETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIER 419
            +VL A+++VENAL    +++K V   + + E +K +  LS   Y+ G  S LD LD ER
Sbjct: 387 ASVLTALEDVENALVGFTQERKRVASQRRSAESYKSAAELSRSLYQTGAASFLDALDAER 446

Query: 420 ATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +T   +  L  ++ +L   Y+ L  A+G G+ 
Sbjct: 447 STYSAQDTLIQSRVRLTTYYIALQKALGGGWT 478


>gi|146342522|ref|YP_001207570.1| multidrug efflux system outer membrane subunit [Bradyrhizobium sp.
           ORS278]
 gi|146195328|emb|CAL79353.1| putative multidrug efflux system, outer membrane subunit (efflux
           pump component) (TolC family) [Bradyrhizobium sp.
           ORS278]
          Length = 495

 Score =  239 bits (611), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 143/458 (31%), Positives = 234/458 (51%), Gaps = 26/458 (5%)

Query: 14  LLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNL 73
           LLAGC VGP+Y  P     P ++S   ++    +   +WW +  D  L++L+  A+  NL
Sbjct: 18  LLAGCAVGPDYVTPDFGT-PARWSSDRNQPAQQLRLAQWWRNLGDAPLDQLIGEAVSGNL 76

Query: 74  TILQATERINAAKENILSVRADLFP---------------SSYASISHRFIPNLKTNSTG 118
            +  A  RI  A+         LFP               S+ A I+    P   +    
Sbjct: 77  DVAAAKARIREARATQRQAVGALFPTVSGTSSATETRSAGSTTAGIA--IAPTTSSQFQA 134

Query: 119 QLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIA 177
             DS W++DLFG  RR +E++   +D+A   +    L +I  +  +YIDAR ++ R+++A
Sbjct: 135 GFDSSWELDLFGANRRAVEAASYGVDAAKDDLRATLLTLIGDVASNYIDARAYQARVALA 194

Query: 178 HQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLL 237
            +     ++   L+  K   G+ S +   K  A   S E+ IPT E S++  +H +  LL
Sbjct: 195 QRTAASQRETAALTARKQEAGSASAVDTAKASALAASTEATIPTYESSYQQALHRLGVLL 254

Query: 238 GYPATEFLHYMQKQSNNFQ-PNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
           G   T      Q+ S +   P    P+  GIPAD++  RPDIR  E++LA   AKIG A 
Sbjct: 255 GRDPTAL---SQRLSRSLPIPAPRRPLPKGIPADVLVMRPDIRKAERQLAQFTAKIGQAT 311

Query: 297 SDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQE 353
           + LYP +SL G++   AL   +        WS GP L +PIF+ GK+++ +  AE+   E
Sbjct: 312 AALYPDISLTGTVSTSALKLGDLGKSSTIGWSIGPSLSVPIFNGGKLQAAVEVAEAQRDE 371

Query: 354 QYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLD 413
            ++ W+  VL+A+++VENA+ ++ +++  +  L  +   + ++  LS   Y+ G  + LD
Sbjct: 372 YHVAWRSAVLSALEDVENAIVNLGQERLRIRSLTESARRYNEAARLSRGLYQTGSSTFLD 431

Query: 414 ILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +LD ER+    E  L  ++  LAK+YV L  A+G G++
Sbjct: 432 VLDAERSQFTAEDSLLASRAALAKNYVALAKALGGGWS 469


>gi|90423378|ref|YP_531748.1| RND efflux system, outer membrane lipoprotein, NodT
           [Rhodopseudomonas palustris BisB18]
 gi|90105392|gb|ABD87429.1| RND efflux system, outer membrane lipoprotein, NodT
           [Rhodopseudomonas palustris BisB18]
          Length = 509

 Score =  236 bits (603), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 137/467 (29%), Positives = 242/467 (51%), Gaps = 26/467 (5%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINI----DTLKWWESFNDTSL 61
           A   +   +LAGC VGP+Y  P + L PT ++  N+K         D  +WW   ND  L
Sbjct: 25  ATLVVAATMLAGCAVGPDYGPPGIEL-PTAWA--NAKPPRTAPPVADLRQWWRRLNDPLL 81

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFP-------------SSYASISHRF 108
           ++L++ A++ NL++  A  RI  A+         LFP             S+ ++ S + 
Sbjct: 82  SRLIEEAVESNLSVASAKARIREARATRRQAIGALFPLLNGTGSATRNQVSASSTTSGQA 141

Query: 109 IPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
           + +         D+ W++D+FG  RR +E++   +D+A   +    L ++  +   Y +A
Sbjct: 142 LTSTYNQFQAGFDASWELDIFGANRRGVEATSYGVDAAEDDLRATLLTLVGDVAAYYAEA 201

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
           R ++ RI++A +     ++   L+  KF  G++S + + K  A+  + E++IPT +  + 
Sbjct: 202 RGYQARIALARRTAASQRETAALTQRKFDAGSSSAVDVAKASAQAATTEANIPTYQVGYS 261

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
             VH +  LLG   T     + + +    P L  P+  GIPAD++  RPD+R  E++LA 
Sbjct: 262 EAVHRLGVLLGREPTALEQQLARGTAIPSPRL--PLPKGIPADVLVMRPDVRKAERQLAQ 319

Query: 288 SVAKIGIAKSDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNI 344
             AKIG A++ LYPS+SL GS+   AL   +        WS GP L +PIF+ G++++ +
Sbjct: 320 YTAKIGQAEAALYPSVSLTGSVSTSALKIGDLAKNSTIGWSVGPTLSVPIFNGGQLRAAV 379

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
             +E+   + Y+ W+  VL A+++VENA+ ++ +++  +  L  A   ++ +  LS   Y
Sbjct: 380 EISEAQRDQYYVAWRSAVLTALEDVENAIVALAQEQLRIRSLAEASRRYRDAARLSRSLY 439

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             G  S LD+LD ER+    E  L  ++  +A S++ L   +G G++
Sbjct: 440 ETGSSSFLDVLDAERSLYTAEDSLLQSRVTVATSFIALAKGLGGGWD 486


>gi|319407782|emb|CBI81433.1| putative outer membrane protein [Bartonella sp. 1-1C]
          Length = 494

 Score =  235 bits (599), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 147/461 (31%), Positives = 247/461 (53%), Gaps = 24/461 (5%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQFS---IGNSKNLINID----TLK-WWESFNDT 59
           F LF  +L GC VGP+Y K       T FS   I   ++ +       TL  WW++FND 
Sbjct: 18  FCLFFFVLPGCVVGPDYHK-------TSFSVPEIWGQESFVQTSERPATLAGWWKNFNDP 70

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASI----SHRFIPNLKTN 115
            L+KL+  A+  N +I  A  R+  A+ ++      L PS  +SI    S R      + 
Sbjct: 71  ILDKLIHDAIAANNSIAVAKARVREARASLGQSIGRLSPSVSSSIVGTHSSRQSDTSLSQ 130

Query: 116 STGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
             G  D+ W++DLFG  +R +E++   LD+A   +    + ++  +  +YI+ R +++++
Sbjct: 131 YRGGFDASWELDLFGGHKRAVEAARYGLDAAVEDLRATMVTLLGDIATNYIEMRGWQQKL 190

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
           SIAH I    +K  +L   K   G  S+L     +A++ + E+DI  +E +  M++H +S
Sbjct: 191 SIAHSIAASQRKTAQLIEAKLEAGDISELDNSNAQAQMINTEADILQMEVNLSMSIHRLS 250

Query: 235 TLLGYPATEFLHYMQKQSNNFQ-PNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
            L G        ++QK +   Q P    PI++GIPAD++  RPD+R  E++ A + A+IG
Sbjct: 251 VLTGCVPIALQDFLQKSAKKKQIPRPKWPISVGIPADILLTRPDLRRAERQYAQATARIG 310

Query: 294 IAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESS 350
             +++ YPSLSL G+I+ T ++      G    WSFGP +  P F+ G++ ++I  A + 
Sbjct: 311 QREAERYPSLSLTGNISTTAESMGQLAKGSTIGWSFGPSIRFPFFNGGQVVASIAVARAQ 370

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
             + +I ++  VL A++EVENAL  + ++++ + KL  A   +  S+ LS   +  G  S
Sbjct: 371 RDQAFIAYRAAVLGALEEVENALVRLYKEQQRLKKLLAANAAYSHSLKLSKDLFESGNTS 430

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            L++L+  R+    ++ LS +   LAK YV L  A+G G+N
Sbjct: 431 FLELLNAYRSYYSSQMSLSDSYIALAKHYVALMKALGGGWN 471


>gi|148257444|ref|YP_001242029.1| multidrug efflux system outer membrane subunit [Bradyrhizobium sp.
           BTAi1]
 gi|146409617|gb|ABQ38123.1| putative multidrug efflux system, outer membrane subunit (efflux
           pump component) (TolC family) [Bradyrhizobium sp. BTAi1]
          Length = 504

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 137/452 (30%), Positives = 230/452 (50%), Gaps = 20/452 (4%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTIL 76
           GC VGP+Y  P   + P  +S    +    +   +WW +  D  L++L+  A+  NL + 
Sbjct: 17  GCAVGPDYVTPDFGV-PNSWSSDRGRPAPALKLAQWWHNLADPQLDQLITEAVGGNLDVA 75

Query: 77  QATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTG-------------QLDSD 123
            A  RI  A+         LFPS   + S     +  +++ G               DS 
Sbjct: 76  SAKARIREARATQRQAIGALFPSISGTGSATETRSASSSTGGVAIGPTTYSQYQAGFDSS 135

Query: 124 WKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILD 182
           W++DLFG  RR +E++   +D+A   +    L +I  +  +YIDAR ++ R+++A +   
Sbjct: 136 WELDLFGANRRAVEAASYGVDAADDDLRATLLTLIGDVASNYIDARAYQARVALAKRTAA 195

Query: 183 LYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPAT 242
             ++   L+  K   G+ S +   K  A   S E+ IPT E S++  VH +  LLG   T
Sbjct: 196 SQRETAALTERKQNAGSASAVDTAKANALAASTEATIPTYESSYQQAVHRLGVLLGRDPT 255

Query: 243 EFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPS 302
                + + +    P+  +P+  GIPAD++  RPD+R  E++LA   AKIG A + LYP 
Sbjct: 256 ALSLRLSRAT--VIPSPRLPLPKGIPADVLVMRPDVRKAERQLAQYTAKIGQATAALYPD 313

Query: 303 LSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQ 359
           +SL+G++   AL   +        WS GP L +PIF+ GK+++ +  AE+   + ++ WQ
Sbjct: 314 VSLSGTVSTSALKLGDLGKNSTIGWSIGPSLSVPIFNGGKLQAAVEVAEAQRDQYHVAWQ 373

Query: 360 ETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIER 419
             VL+A+++VENA+ ++ +++  +  L  +   + ++  LS   Y  G  + LD+LD ER
Sbjct: 374 SAVLSALEDVENAIVNLAQERIRIRSLTESARRYSEAARLSRSLYETGSSTFLDVLDAER 433

Query: 420 ATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +    E  L  ++  LAK YV L  A+G G+ 
Sbjct: 434 SQFTAEDSLLASRATLAKDYVALAKALGGGWT 465


>gi|192290998|ref|YP_001991603.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhodopseudomonas palustris TIE-1]
 gi|192284747|gb|ACF01128.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhodopseudomonas palustris TIE-1]
          Length = 501

 Score =  231 bits (590), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 138/470 (29%), Positives = 236/470 (50%), Gaps = 31/470 (6%)

Query: 10  LFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIAL 69
           L  V+L GC VGP+Y  P +   P Q+S             +WW    D +L++LV  A+
Sbjct: 5   LVAVMLGGCAVGPDYRTPLL-ATPAQWSGAGVATPAAPVLPRWWARLRDPTLDRLVVEAV 63

Query: 70  QQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI------------PNLKTNST 117
             NL +  A+ R+  A+ +       L P+   + S R              PNL   S+
Sbjct: 64  DGNLDVATASARVREARASYRQAVGALLPTIANTESARLAKGTGVASAAPGRPNLGGPSS 123

Query: 118 ------------GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSY 164
                          D+ W++DLFG  RR +E++   +D++   +    L ++  +  SY
Sbjct: 124 VVGSDGTSGLYQAGFDASWELDLFGANRRAVEAAAYGIDASDENLRAVLLTLVGDVASSY 183

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           ++AR ++ RI++A +      +  +++  +   G  S + L     +  +  + IPTLE 
Sbjct: 184 VEARGYQARIALARRTATSQDETTKITRNRLAAGTGSAVDLATATGQAAATRAAIPTLET 243

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
           ++   VH +S L G P +     + +      P L  P+  GIPAD++  RPD+R  E++
Sbjct: 244 AYAQTVHRLSVLTGRPPSALSALLARPKPIPAPKL--PVPAGIPADVLLTRPDVRLAERR 301

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIALTHDN-SFPGYNTH--WSFGPKLYLPIFDKGKIK 341
            A S A+IG A++ LYPS+SL G+IA +       G N+   WS GP L +PIF+ GK++
Sbjct: 302 YAQSTARIGQAEAALYPSVSLAGNIATSGTKLGDLGRNSSISWSLGPTLTVPIFNGGKLR 361

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           + +  AE+   +Q++ +Q +VL A+K+VE+AL S++ +      L  +   ++++ SLS 
Sbjct: 362 AAVEIAEAQRDQQFLAYQASVLTALKDVEDALVSLSNEHSRSRILATSTTAYRQAASLSQ 421

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             YR G  S LD+L  ER+    E  L  ++ ++   Y+ L  A+G G++
Sbjct: 422 SLYRSGSSSFLDVLTAERSLYSAEDALLQSRVKIVSDYIALNKALGGGWD 471


>gi|319782575|ref|YP_004142051.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317168463|gb|ADV12001.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 496

 Score =  231 bits (589), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 139/456 (30%), Positives = 238/456 (52%), Gaps = 17/456 (3%)

Query: 10  LFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL-KWWESFNDTSLNKLVKIA 68
           L  VLLAGC VGP+Y  P +  +P  +S            L KWW+   D  LN LV+ A
Sbjct: 19  LTAVLLAGCVVGPDYQTPIL-AMPANWSGQKPTKPAQPARLSKWWQRLRDPELNTLVEEA 77

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST---------GQ 119
           +  NL +  A  +I  A+ +       L PS+  S S     + +T S            
Sbjct: 78  VAGNLDVATAKAKIREARASYRQSAGTLLPSADGSGSASRNKSAETTSGSDATYSEYQAG 137

Query: 120 LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAH 178
            D+ W++DLFG  RR +E++   L+++  ++    L ++  +   Y  AR ++ RI++A 
Sbjct: 138 FDASWELDLFGANRRGVEAARYGLNASQEELRSTLLTLVGDVASYYTQARGYQARIALAR 197

Query: 179 QILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG 238
           +     ++  EL+      G  +   + K   +  S E+ +PTLE S+   VH ++ L G
Sbjct: 198 RSAASQRQTAELTRTMAQAGTATAADVAKAMGQAASTEAAVPTLEASYAQAVHRLAVLAG 257

Query: 239 YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSD 298
            P       +++ +    P L  P+  GIPADL+ +RPD+R  E++ A   AKIG A++ 
Sbjct: 258 RPPASLNERLKRVAPIPAPRL--PMPTGIPADLLLSRPDLRMAERQYAQYTAKIGQAEAA 315

Query: 299 LYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQY 355
            YPS+SL G I   AL   +     +  WSFGP L +P+F+ G++++ +  A++   + +
Sbjct: 316 RYPSVSLTGDISTAALKLGDLGKNSSIGWSFGPTLSVPLFNAGQLQAAVEFAKAQRDQYF 375

Query: 356 ITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDIL 415
           I ++ +VL A+++VENAL  +++++  + KL  + + + ++ SL    Y+ G  SLLD+L
Sbjct: 376 IAYRSSVLTALEDVENALVLLSQERIRIGKLASSAKSYGEAASLEGTLYKAGETSLLDVL 435

Query: 416 DIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           D +R+    E  L  ++  LA +Y+ L  A+G G++
Sbjct: 436 DAQRSLYSAEDSLLQSRVLLATNYIALNKALGGGWD 471


>gi|83943997|ref|ZP_00956454.1| hypothetical protein EE36_10140 [Sulfitobacter sp. EE-36]
 gi|83845244|gb|EAP83124.1| hypothetical protein EE36_10140 [Sulfitobacter sp. EE-36]
          Length = 452

 Score =  231 bits (589), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 139/445 (31%), Positives = 252/445 (56%), Gaps = 19/445 (4%)

Query: 13  VLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQN 72
           +L+AGC VG +Y +P + +  T+F  GN++ +  + T +WW ++ D++L  LV   L QN
Sbjct: 10  LLVAGCAVGTDYQRPEVAM-ETRFVGGNAEQIGAVATQQWWLNYKDSNLTSLVTRGLAQN 68

Query: 73  LTILQATERINAAKENI--LSVRADLFPSSYASISHRFIPNLKTNST---GQLDSDWKID 127
           L ++ A ERI  A+  +    V A    S   S++          ST   G L +   ID
Sbjct: 69  LDVIAAGERIRQAQAELRTTGVNAAADGSLTGSVTTSGGDGTSGTSTVESGSLGASLVID 128

Query: 128 LFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKK 186
           LFG  RR  E+++A+L +A A+ +  +L  +++LI +Y DAR+++E +++    +   ++
Sbjct: 129 LFGGIRREREAAVASLTAARAEEETVRLAWLAELIAAYSDARYYQEAMALTRTAIATREE 188

Query: 187 NIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLH 246
            + ++  +F  GA ++  + + +A + +  +D+P     F  NV+ I+TLL  PA     
Sbjct: 189 TVSITRSQFNAGAATEYEVAEAQALLSTARADLPQFAALFDANVYAIATLLNEPAGPIKA 248

Query: 247 YMQKQSNNFQPNLYIP--INIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLS 304
            MQK +    P L  P     G+PADL+RNRPD+R  E  LA +VA +G+A++ LYP+LS
Sbjct: 249 QMQKGA----PQLSSPGDARTGVPADLLRNRPDVRSAEADLAAAVANVGVAEAALYPALS 304

Query: 305 LNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLN 364
           L+G++  T           WSFGP+L LP+F++G +K++     S A++  I W+ ++  
Sbjct: 305 LSGTVGRTDATD------AWSFGPQLSLPVFNQGLLKASRDAQLSVARQAEIAWRASINE 358

Query: 365 AIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKV 424
           A+++V+   ++++  ++    L+ A   + ++++L+  NYR G  +LL++L+ +R T   
Sbjct: 359 AVEDVQVTQSNLSRARQRAQLLRTAASDYSRALTLAQENYRNGAITLLNLLETDRNTNAA 418

Query: 425 EVDLSIAKRQLAKSYVDLYIAIGSG 449
            +  + A  + A+++  L IA G+G
Sbjct: 419 RISAASATNEAAQAWATLKIATGAG 443


>gi|222082588|ref|YP_002541953.1| nodulation protein (outer membrane efflux protein) [Agrobacterium
           radiobacter K84]
 gi|221727267|gb|ACM30356.1| nodulation protein (outer membrane efflux protein) [Agrobacterium
           radiobacter K84]
          Length = 502

 Score =  230 bits (587), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 136/464 (29%), Positives = 241/464 (51%), Gaps = 33/464 (7%)

Query: 10  LFIVLLAGCTVGPEYTKPHMPLLPTQFSI-GNSKNLINIDTLKWWESFNDTSLNKLVKIA 68
               +L  C VGP+Y KP++  LP+++S   +SK   + +  +WW+ F D +LN L++ A
Sbjct: 27  CCTTILTSCVVGPDYEKPNV-ALPSRWSGQASSKTATSPNLTEWWKQFRDPTLNALIEEA 85

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPS-----------------SYASISHRFIPN 111
           +Q NL +  A  +I  A+      +  L P+                 + AS+ + F P 
Sbjct: 86  VQTNLDVATAKAKIREARATYREQKGTLLPTVEGTASATRNRVAASDGAAASVYNEFQPG 145

Query: 112 LKTNSTGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                    D+ W++DLFG  +R  E++   +D+A   +    + ++  +   Y+ AR +
Sbjct: 146 F--------DASWELDLFGGNKRSAEAARYGVDAAEEDLRDTLVTLVGDVTTYYVQAREY 197

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           +    +A +     +K   L+  +F  G  + +       E  S E+DIPT + S+  +V
Sbjct: 198 QALRDLAKRTAVSQRKTAALTQEEFAAGTVTGVDAANANGEASSTEADIPTYQISYAQSV 257

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           H ++ LLG P       ++  +   QP L +  + GIPA+++ +RPD+R  E++LA   A
Sbjct: 258 HKLAVLLGKPPAALDERLKATAAIPQPPLKV--STGIPANILTSRPDVRLAERQLAQYTA 315

Query: 291 KIGIAKSDLYPSLSLNGSIALTH-DNSFPGYNT--HWSFGPKLYLPIFDKGKIKSNIRRA 347
           KIG+A+++ YPS+SL GSI  +  D +  G  +   W+FGP L +PIF  G++K+ +  A
Sbjct: 316 KIGVAEANRYPSISLTGSITSSATDLADLGRKSTIGWAFGPTLTVPIFQGGQLKAAVDVA 375

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           ++   + YI +Q  VL A+++VENA+ S+ ++K    KL  +   ++ +  LS    + G
Sbjct: 376 KAERDQYYIAYQAAVLTAMQDVENAIVSLTQEKIKNAKLVSSASSYRTAADLSRQLNKAG 435

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
               L++LD ER+    E  L  +K  +A  Y+ L+ A+G G++
Sbjct: 436 ATDFLNVLDAERSLYSAESSLIQSKAAIATDYISLHKALGGGWD 479


>gi|312114769|ref|YP_004012365.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311219898|gb|ADP71266.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 512

 Score =  229 bits (584), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 140/457 (30%), Positives = 238/457 (52%), Gaps = 20/457 (4%)

Query: 10  LFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIAL 69
           L +  L  C VGP+Y +   PL P+ ++  + +    +   +WW  FND  L+ L++ A+
Sbjct: 36  LLVSTLGACAVGPDY-QFSAPLTPSHWANASDRKAPRLS--RWWTRFNDRILDALMEEAV 92

Query: 70  QQNLTILQATERINAAKENILSVRADLFP----SSYASISHRFIPNLKTNS--TGQL--- 120
             NL +  A  +I  A+         LFP    S  A+ S   + +  T+S   G L   
Sbjct: 93  AGNLDVATAKAKIREARATYRQTFGSLFPTLTNSESATRSQTSVASSGTSSPAVGSLYQA 152

Query: 121 --DSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIA 177
             D+ W++DLFG  RR +E++   +D+A   +    L ++  +   Y+ AR ++ RI++A
Sbjct: 153 GFDASWELDLFGANRRAVEAAAYGVDAAEENLQATLLTLVGDVASYYVQARGYQARIALA 212

Query: 178 HQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLL 237
            +     ++  +++  KF  G+TS + +     +  S  + IPT E S+   VH++S LL
Sbjct: 213 RRTATSQEETAQITRNKFAAGSTSAVDVANATGQAASTRATIPTFETSYAEVVHSLSILL 272

Query: 238 GYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKS 297
           G P       +        P L +P   GIPAD++ NRPD+R  E++ A   AK+G A++
Sbjct: 273 GKPPAALNERLAVVRPIPAPRLTVPA--GIPADVLLNRPDVRLAERQYAQYTAKVGQAEA 330

Query: 298 DLYPSLSLNGSIALTHDNSF---PGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQ 354
             YPS SL GSI+ +   +       +  WSFGP L +PIF+ G++++ +  AE+   + 
Sbjct: 331 ARYPSASLTGSISTSAAKTGDLGKSSSIGWSFGPTLTVPIFNAGQLEAAVAVAEAQRDQY 390

Query: 355 YITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDI 414
           +I ++  VLNA+ +VENAL S+ ++K+    L  +   ++++ SLS   Y+ G    LD+
Sbjct: 391 FIAYKSAVLNALGDVENALVSLAKEKRRTQSLDLSASSYRQASSLSRSLYQSGAAGFLDV 450

Query: 415 LDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           L  ER+    E  L  ++  +A  Y+ L  A+G G+N
Sbjct: 451 LTAERSAFSAEDALIQSRVLIATDYIALNKALGGGWN 487


>gi|319409385|emb|CBI83029.1| putative outer membrane protein [Bartonella schoenbuchensis R1]
          Length = 482

 Score =  229 bits (583), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 140/461 (30%), Positives = 240/461 (52%), Gaps = 24/461 (5%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSI----GNSKNLIN---IDTLKWWESFNDTS 60
           F    ++L+GC VGP+Y K       T FS+    G     I+   +    WW  FND  
Sbjct: 16  FLCVFLMLSGCAVGPDYHK-------TSFSVPAVWGRKSAQISDHSVALAGWWRRFNDPV 68

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS-HRFI--PNLK-TNS 116
           LN+L+  A+  N  +  A  R+  A+ ++      L PS   SIS +RF   P++  +  
Sbjct: 69  LNELIDDAISGNNNVAVAKARVREARASVGQTAGYLAPSVSGSISGNRFSEQPDVSLSQY 128

Query: 117 TGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERIS 175
            G  D+ W++DLFG  +R +E++   LDS    +    + ++  +  +Y++ R +++++ 
Sbjct: 129 RGGFDASWELDLFGGHKRAVEAARYGLDSTVEDMRATMVTLLGDVATNYVEMRGWQQKLL 188

Query: 176 IAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIST 235
           IA +I+   +K  EL   K   G  S+L     +A++ + E+DI  +E S  M++H +S 
Sbjct: 189 IARRIVVSQRKTFELMRTKLAAGEASELDFSNAQAQMANTEADIFQIEASLAMSIHRLSV 248

Query: 236 LLGYPATEFLHYMQKQSNNFQ--PNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
           L G   T    ++QK +      P    PI +GIPAD++  RPD+R  E++ A + A+IG
Sbjct: 249 LTGRVPTALEAFLQKSAKKEGAIPQPQWPIPVGIPADILLTRPDLRRAERQYAQATARIG 308

Query: 294 IAKSDLYPSLSLNGSIALTHDN-SFPGYNT--HWSFGPKLYLPIFDKGKIKSNIRRAESS 350
             ++D YPSL+L G I+ T       G ++   WSFGP L  P FD G+  +++  A + 
Sbjct: 309 QREADRYPSLTLTGRISTTATQIGHLGESSTIGWSFGPGLQFPFFDGGQRAASVEMARAQ 368

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
             + +IT++  VL A+++VENAL  + ++ + + KL  A     +S+ LS + +  G  S
Sbjct: 369 RDQAFITYRAEVLGALEDVENALVRLYKEHQRLEKLTVANTAALRSLKLSQLLFENGDIS 428

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             + LD  R+    ++ L  +   +A  Y+ L  A+G G++
Sbjct: 429 FFEFLDARRSYYSAQMALKNSYVNVALQYIALMKALGGGWD 469


>gi|114764657|ref|ZP_01443842.1| nodulation protein [Pelagibaca bermudensis HTCC2601]
 gi|114542857|gb|EAU45878.1| nodulation protein [Roseovarius sp. HTCC2601]
          Length = 453

 Score =  228 bits (581), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 139/452 (30%), Positives = 252/452 (55%), Gaps = 27/452 (5%)

Query: 12  IVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQ 71
           ++ L  CTVGP++  P  PL  T F+ G+++ + +     WW S++D  L++LV+  L+Q
Sbjct: 10  VLALCACTVGPDHEPPIQPLAAT-FAEGDAQPVGDAALQSWWRSYDDALLSELVQAGLRQ 68

Query: 72  NLTILQATERINAAKENIL----------SVRADLFPSSYASISHRFIPNLKTNSTGQL- 120
           NL I  A  R+  A+               + AD   +    IS        TN++G + 
Sbjct: 69  NLDIRTALSRVAEAQAAARATGLPAQVSGGLTADTIRAGGEEISG------TTNTSGAIF 122

Query: 121 DSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQ 179
                +DLFG +RR  E++LA+L +A   V  A+L ++S L+ +YID R+++  ++I+ +
Sbjct: 123 APALMLDLFGGERRSREAALADLQAAELGVGTARLALLSALVSNYIDLRYYQNALAISRE 182

Query: 180 ILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGY 239
            +   +  + L   +   GA + L   + +A +   ++ +P LE+ +    + I+TLL  
Sbjct: 183 TVATRRDTLSLVQSQREAGAATALDEAQAQAALDEAQATLPGLEQGYYAATYAIATLLAQ 242

Query: 240 PATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDL 299
           PA      +Q+     QP      + G+PADL+RNRPD+R  E +LA + A+IG++++ L
Sbjct: 243 PAQGLEARLQR--GAAQPRPGSSASAGVPADLLRNRPDLRAAEAELAAATARIGVSEAQL 300

Query: 300 YPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQ 359
           YPSL L G++     ++F G N+ WS+GP+L +P+ ++G +++N   A + AQ+  + W+
Sbjct: 301 YPSLRLGGTV-----STFEGVNS-WSYGPQLSIPVLNQGVLRANRDAAVAQAQQAELGWR 354

Query: 360 ETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIER 419
             VL A++EV+ A + +  D++ V   + +V   +++++LS   Y  G  +LLD L+++R
Sbjct: 355 GAVLGAVEEVQAAQSDVLRDRRAVAGYRRSVASFERAVALSRTTYEGGTTTLLDYLEVQR 414

Query: 420 ATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           + A   + L+ + R LA S+  L +A G G++
Sbjct: 415 SLAAARLTLASSVRDLAASWARLQVAAGKGWS 446


>gi|49476203|ref|YP_034244.1| hypothetical protein BH15480 [Bartonella henselae str. Houston-1]
 gi|49239011|emb|CAF28311.1| hypothetical protein BH15480 [Bartonella henselae str. Houston-1]
          Length = 494

 Score =  226 bits (577), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 132/457 (28%), Positives = 240/457 (52%), Gaps = 16/457 (3%)

Query: 7   IFSLFIVLLAGCTVGPEYTKP--HMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKL 64
           +F  FI   +GC VGP Y K    +P +  + S   S  ++ +    WW   ND  LN L
Sbjct: 19  LFCFFI--FSGCMVGPNYQKTSFRVPAVWGEQSEKTSGRMVTL--AGWWRHLNDPVLNAL 74

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST-----GQ 119
           +  A+  N  +  A  R+  A+  +      L PS  +SIS     + +++++       
Sbjct: 75  MNDAISGNNNVAVAKARVREARAGLGQTVGSLLPSVSSSISGTRNGSEQSDASLSQYRSG 134

Query: 120 LDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAH 178
            D+ W++D FG  +R +E++   L++A   +    + ++  +  +Y+  R +++++ I  
Sbjct: 135 FDASWELDFFGGHKRAVEAAHYGLEAAVEDMRATMVTLLGDVATNYVQVRGWQQKLLIVR 194

Query: 179 QILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG 238
           QI    +K  EL   K T G  S+L +   +A++ + E+DI  +E +  M++H +S L G
Sbjct: 195 QIAASQRKTYELMRAKLTAGDASELDISNAQAQVANTEADIAQMEANLAMSIHRLSVLTG 254

Query: 239 YPATEFLHYMQKQSNNFQ-PNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKS 297
           +  T     +QK +   + P  + PI  GIPAD++  RPD+R  E++ A + A+IG  ++
Sbjct: 255 HVPTALRDLLQKNAKQAKIPQPHWPIPAGIPADILLTRPDLRRAERQYAQATARIGQREA 314

Query: 298 DLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQ 354
           + YPSL+L GSI   A   D  +      WSFGP L  P F+ G+I +++  A +   + 
Sbjct: 315 ERYPSLTLTGSISTAATAIDQLWKNSTIGWSFGPGLRFPFFNGGQIVASVAVARAQRDQA 374

Query: 355 YITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDI 414
           +IT++  VL A+++VENAL  + ++ + + KL  A +  ++S+ LS   +  G  S L++
Sbjct: 375 FITYRAAVLGALEDVENALVRLTKEHQRLEKLIIANKAFQRSLQLSRSLFENGNTSFLEL 434

Query: 415 LDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           L+ +R+    ++ L  ++  L   Y+ L  A+G G++
Sbjct: 435 LNADRSYYSAQMALKDSRISLVTQYIALMKALGGGWD 471


>gi|227819849|ref|YP_002823820.1| NodT, RND efflux system, outer membrane lipoprotein [Sinorhizobium
           fredii NGR234]
 gi|227338848|gb|ACP23067.1| putative NodT, RND efflux system, outer membrane lipoprotein
           [Sinorhizobium fredii NGR234]
          Length = 515

 Score =  226 bits (576), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 133/450 (29%), Positives = 230/450 (51%), Gaps = 18/450 (4%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL-KWWESFNDTSLNKLVKIALQQNLTI 75
           GC VGP+Y +P    LPT +     +       L +WW  F D  L+ L+  A++ NL +
Sbjct: 40  GCVVGPDYEQPRF-ALPTHWGSKEEQKPARPPELSQWWRQFRDPLLDTLIAEAVEGNLDV 98

Query: 76  LQATERINAAKENILSVRADLFPSSYASISHRFI----------PNLKTNSTGQLDSDWK 125
             A  +I  A+      +  L PS   S S              P++     G  D+ W+
Sbjct: 99  ALAKAKIREARATYREQQGTLLPSVDGSASATRTRSTSSVAGSEPSVYNQYQGGFDASWE 158

Query: 126 IDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLY 184
           +DLFG  RR +E++    ++A  ++    + ++  +   YI AR ++  +++A +     
Sbjct: 159 LDLFGGNRRGLEAARYGAEAAEEELRDTLVTLVGDVTSYYIQAREYQSLLALARRSAASQ 218

Query: 185 KKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEF 244
           ++  +L+  +   G  + +   K +A+  S E+DIPT + S+   VH +S L+G P    
Sbjct: 219 RETAKLTREQLAAGEATGVDDAKADAQATSTEADIPTYQISYAQTVHRLSILIGQPPAAL 278

Query: 245 LHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLS 304
              ++K      P    P+  GIPADL+ NRPD+R  E++LA S AKIG A+++ YPS+S
Sbjct: 279 EGRLKK--GGAVPLPKSPVAAGIPADLLVNRPDVRLAERQLAQSTAKIGQAEANRYPSIS 336

Query: 305 LNGSIA---LTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQET 361
           L G  A   L+  +     +  WSFGP L +PIF+ G++K+ +  A++   + Y  +Q  
Sbjct: 337 LTGDTATSALSTSDLGKKSSIGWSFGPTLTVPIFNGGQLKATVDVAKAQRDQYYAAYQAA 396

Query: 362 VLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERAT 421
           VL+A+++VENA+ S+++ +    KL  +   ++++  LS      G    LD+LD ER+ 
Sbjct: 397 VLSAMEDVENAIVSLSQTRARYAKLTSSTASYRRAAELSRTLNEAGAVDFLDVLDAERSL 456

Query: 422 AKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
              E  L  ++  +A  ++ L  A+G G++
Sbjct: 457 YTAEEALIRSRADIAIYFIALNKALGGGWD 486


>gi|163869206|ref|YP_001610458.1| putative outer membrane protein [Bartonella tribocorum CIP 105476]
 gi|161018905|emb|CAK02463.1| putative outer membrane protein [Bartonella tribocorum CIP 105476]
          Length = 492

 Score =  226 bits (575), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 137/458 (29%), Positives = 242/458 (52%), Gaps = 23/458 (5%)

Query: 10  LFIVLLAGCTVGPEYTKPHMPLLPTQFSI----GNSKNLIN---IDTLKWWESFNDTSLN 62
           +   LL+GC VGP Y K       T FS+    G     I+   I    WW S ND  LN
Sbjct: 19  MLCFLLSGCMVGPNYHK-------TSFSVPARWGQQSAQISGHSIALAGWWRSLNDPVLN 71

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQ--- 119
            L+  A+  N  +  A  RI  A+ ++  V   L P++  +IS     + ++++  Q   
Sbjct: 72  TLMDEAVSGNNDVAVAKARIREARASLGQVVGSLLPNASNTISGTRSGSKQSDALNQYRS 131

Query: 120 -LDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIA 177
            LD+ W++D FG  +R +E++   L++A   +    + ++ ++  +Y+  R +++++ I 
Sbjct: 132 GLDASWELDFFGGHKRGVEAAQYGLEAAVEDMRATMVILLGEVATNYVQMRGWQQKLLIV 191

Query: 178 HQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLL 237
            QI    +K  EL   K T G  S+L +   +A++ + E+DI  +E +  M++H +S L 
Sbjct: 192 RQIAATQRKTYELMQTKLTAGDISELDVSNAKAQMANTEADISQMEANVAMSMHRLSVLT 251

Query: 238 GYPATEFLHYMQKQSNNFQ-PNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
           G+  T     +QK + + + P    PI  GIPAD++  RPD+R  E++ A + A+IG  +
Sbjct: 252 GHVPTALKDLLQKNAKHVKIPQPQWPIPAGIPADILLTRPDLRRAERQYAQATARIGQRE 311

Query: 297 SDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQE 353
           ++ YPSL+L G+I   A   D  +      WSFGP L  P F+ G+I +++  A +   +
Sbjct: 312 AERYPSLTLTGNISTAATAMDQLWKSSTIGWSFGPNLRFPFFNGGQIVASVAMARAQRDQ 371

Query: 354 QYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLD 413
            +IT++  VL A+++VENAL  + ++ + + KL  A +    S+ LS   +  G  S L+
Sbjct: 372 AFITYRAAVLGALEDVENALVRLTKEHQRLEKLVVANKAFLHSLQLSRSLFENGNTSFLE 431

Query: 414 ILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +L+ +R+    ++ L  ++  LA  Y+ L  A+G G++
Sbjct: 432 LLNADRSYYSAQMALKDSRIALATQYIALMKALGGGWD 469


>gi|260466898|ref|ZP_05813081.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Mesorhizobium opportunistum WSM2075]
 gi|259029294|gb|EEW30587.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Mesorhizobium opportunistum WSM2075]
          Length = 497

 Score =  225 bits (574), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 135/453 (29%), Positives = 237/453 (52%), Gaps = 17/453 (3%)

Query: 13  VLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL-KWWESFNDTSLNKLVKIALQQ 71
           VLLAGC VGP+Y  P +  +P  +S       +    L +WW+   D  L+ LV+ A+  
Sbjct: 22  VLLAGCVVGPDYRTPIL-AMPANWSGERPTKSVQPAQLSRWWQRLRDPQLDTLVEEAVAG 80

Query: 72  NLTILQATERINAAKENILSVRADLFPS--SYASISHRFIPNLKTNSTGQ-------LDS 122
           NL +  A  +I  A+ +     A L PS     S++     +  T S           D+
Sbjct: 81  NLDVATAKAKIREARASYRQTAATLLPSVDGSGSVTRNKSADTTTGSNATYTEYQAGFDA 140

Query: 123 DWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQIL 181
            W++DLFG  RR +E++   +D++  ++    L ++  +  +Y  AR ++ RI++A +  
Sbjct: 141 SWELDLFGANRRGLEAARYGVDASEQELRSTLLTLVGDVASTYTQARGYQARIALARRSA 200

Query: 182 DLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPA 241
              ++  EL+      G+ +   + K   +  S E+ +PTLE S+   VH +S L G P 
Sbjct: 201 VSQRQTAELTRTMALAGSATAADVAKAMGQAASTEASVPTLEASYAEAVHRLSVLTGRPP 260

Query: 242 TEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYP 301
                 +++      P L  P+  GIPAD++ +RPD+   E++ A   AK+G A++  YP
Sbjct: 261 AALSERLKRSKPIPSPRL--PMPTGIPADILLSRPDVLMAERQYAQYTAKVGQAEAARYP 318

Query: 302 SLSLNGSIALTH-DNSFPGYNTH--WSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITW 358
           S+SL G+I+    D    G N+   WSFGP L +P+F+ G++++    A +   + +I +
Sbjct: 319 SVSLTGNISTAALDLGDLGKNSSIGWSFGPTLSVPLFNAGQLQAAADVARAQRDQYFIAY 378

Query: 359 QETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIE 418
           + +VL A+++VENAL  + +++  + KL  + + + ++ SL    Y+ G  SLLD+LD +
Sbjct: 379 RASVLTALEDVENALVLMAQERIRIGKLASSAKSYGEAASLEGTLYKAGETSLLDVLDAQ 438

Query: 419 RATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           R+    E  L  ++  LA +Y+ L  A+G G++
Sbjct: 439 RSLYSAEDSLLQSRVLLATNYIALNKALGGGWD 471


>gi|86749360|ref|YP_485856.1| RND efflux system, outer membrane lipoprotein, NodT
           [Rhodopseudomonas palustris HaA2]
 gi|86572388|gb|ABD06945.1| RND efflux system, outer membrane lipoprotein, NodT
           [Rhodopseudomonas palustris HaA2]
          Length = 518

 Score =  224 bits (570), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 144/468 (30%), Positives = 234/468 (50%), Gaps = 29/468 (6%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL-KWWESFNDTSLNKL 64
           A+  L    L+GC VGP+Y  P + L     +    K    +  L +WW   ND  LN+L
Sbjct: 33  AVLLLCATALSGCAVGPDYVVPGIELPTAWRNARPPKTPPAVPQLSEWWRRLNDQLLNRL 92

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS-------------HRFIPN 111
           ++ A+  NL +  A  RI  A+         LFP+   S S                I  
Sbjct: 93  IEEAVASNLDVASAKARIREARATRRQAIGALFPTLDGSGSATRNQVSASSTSGGSAITT 152

Query: 112 LKTNSTGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                 G  DS W++D+FG  RR++E++   +D A   +    L +I  +   Y  AR +
Sbjct: 153 YNQFQAG-FDSSWELDIFGANRRNVEATTYGVDVAEDDLRATLLTLIGDVTSYYAQARGY 211

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           + RI++A +     ++   L+  KF  G++S + + K  A+  S E++IPT E S+  +V
Sbjct: 212 QARIALARRTAASQRETAALTQRKFDAGSSSAVDVAKAAAQAASTEANIPTFEISYAESV 271

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           H +  LLG   +     +        P L  P+  GIPAD++  RPD+R  E++LA   A
Sbjct: 272 HRLGVLLGREPSALSPLLAGVKPIPAPRL--PLPKGIPADVLVMRPDVRKAERQLAQYTA 329

Query: 291 KIGIAKSDLYPSLSLNGSIALT-------HDNSFPGYNTHWSFGPKLYLPIFDKGKIKSN 343
            IG A++ LYPS+SL GS++ T         NS  G    WS GP L +PIF+ G++++ 
Sbjct: 330 LIGKAEAALYPSVSLTGSVSTTALKIGDLGKNSTIG----WSIGPSLSVPIFNGGQLRAA 385

Query: 344 IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
           +  +E+   + Y+ W+  VL+A+++VENA+ S+++ +K +  L  +   + ++  LS   
Sbjct: 386 VEISEAQRDQYYVAWRAAVLSALEDVENAIVSLSQQRKRIGNLSESARRYAEAARLSRSL 445

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           Y  G  S LD+LD ER+    E  L   +  +A SY+ L   +G G++
Sbjct: 446 YETGSSSFLDVLDAERSLYTAEDSLLDTRVSVATSYIALAKGLGGGWD 493


>gi|319899427|ref|YP_004159524.1| outer membrane protein [Bartonella clarridgeiae 73]
 gi|319403395|emb|CBI76963.1| putative outer membrane protein [Bartonella clarridgeiae 73]
          Length = 494

 Score =  223 bits (569), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 142/466 (30%), Positives = 251/466 (53%), Gaps = 23/466 (4%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPH--MPLLPTQ-FSIGNSKNLINIDTLKWWESFND 58
            +L   FS+F VL  GC VGP+Y K    +P +  Q FS+  S++ + +    WW +FND
Sbjct: 13  GLLYPFFSVFFVL-PGCVVGPDYHKTSFSVPAIWGQHFSVQTSEHPVAL--AGWWRNFND 69

Query: 59  TSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS-- 116
             L++L+  A+  N ++  A  R+  A+ ++      L PS    +S   + N  ++   
Sbjct: 70  LVLDELINDAIAANNSVAVAKARVREARASLGQATGYLSPS----VSSLILGNHSSSQPD 125

Query: 117 ------TGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                  G  D+ W++DLFG  +R +E++   LD+    +    + ++  +  +Y++ R 
Sbjct: 126 ISLRQYRGGFDASWELDLFGGHKRAVEAAGYGLDATVEDLRATMVTLLGDIATNYVEMRG 185

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
           +++++SIA  I  L  K  +L   K   G  S+L     +A++ + E+DI  +E +  M+
Sbjct: 186 WQQKLSIARSIAALQHKTAKLMGAKLEAGDISELDNSNAQAQMINTEADILQMEANLSMS 245

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQ-PNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
           +H +S L G        ++QK +   Q P    PI++GIPAD++  RPD+R  E++ A +
Sbjct: 246 IHRLSVLTGRVPLALQDFLQKGAKKKQIPQPKWPISVGIPADILLTRPDLRRAERQYAQA 305

Query: 289 VAKIGIAKSDLYPSLSLNGSIALTHD--NSFPGYNT-HWSFGPKLYLPIFDKGKIKSNIR 345
            A+IG  ++D YPSLSL G+I+ T +        +T  WSFGP L  P F+ G++ +++ 
Sbjct: 306 TARIGQREADRYPSLSLTGNISTTAESIGQLAKSSTIGWSFGPNLRFPFFNGGQVVASVA 365

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
            A +   + +IT++  VL A++EVENAL  + ++++ + KL  A   +  S+ LS   + 
Sbjct: 366 VARAQRDQAFITYRAAVLGALEEVENALVQLYKEQQRLKKLLAANSAYSHSLQLSQGLFE 425

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            G  S L++L+  R+    ++ L  ++  LAK Y+ L  A+G G+N
Sbjct: 426 SGNTSFLELLNAYRSYYSSQMSLRDSRIALAKHYIALMKALGGGWN 471


>gi|319404822|emb|CBI78423.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 494

 Score =  223 bits (569), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 142/456 (31%), Positives = 243/456 (53%), Gaps = 14/456 (3%)

Query: 8   FSLFIVLLAGCTVGPEYTKPH--MPLLPTQFSIGNSKNLINIDTLK-WWESFNDTSLNKL 64
           F LF  +L GC VGP+Y K    +P +  Q S  + + L +  TL  WW +FND  L+ L
Sbjct: 18  FCLFFFVLPGCVVGPDYRKTSFSVPAIWGQHS--SVQTLEHSATLAGWWRNFNDPILDAL 75

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS----TGQL 120
           +  A+  N +I  A  R+  A+ ++      L PS  +SI      +    S     G  
Sbjct: 76  IHDAIAANNSIAVAKARVREARASLGQSIGHLSPSISSSIVGTHGSSQSDTSLSQYRGGF 135

Query: 121 DSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQ 179
           D+ W++DLFG  +R +E++   LD+A   +    + ++  +  +Y++ R +++++SIA  
Sbjct: 136 DASWELDLFGGHKRAVEAARYGLDAAVEDLRATMVTLLGDIATNYVEMRGWQQKLSIARS 195

Query: 180 ILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGY 239
           I    +K  +L   K   G  S+L      A++ + E+DI  +E +  M++H +S L G 
Sbjct: 196 IAASQRKTAQLIEAKLKAGDISELDNSNARAQMINTEADILQMEVNLSMSIHRLSVLTGR 255

Query: 240 PATEFLHYMQKQSNNFQ-PNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSD 298
                  ++QK +   Q P    PI++GIPAD++  RPD+R  E++ A + A+IG  +++
Sbjct: 256 VPIALQDFLQKSAKKKQIPKPKWPISVGIPADILLTRPDLRRAERQYAQATARIGQREAE 315

Query: 299 LYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQY 355
            YPSLSL G+I+ T ++      G    WSFGP +  P F+ G++ ++I  A +   + +
Sbjct: 316 RYPSLSLTGNISTTAESVGQLAKGSTIGWSFGPNIRFPFFNGGQVVASIAVARAQRDQAF 375

Query: 356 ITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDIL 415
           I ++  VL A++EVENAL  + ++++   KL  A   +  S+ LS   +  G  S L++L
Sbjct: 376 IAYRAAVLGALEEVENALVRLYKEQQRFKKLLAANAAYSHSLKLSQDLFESGNTSFLELL 435

Query: 416 DIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +  R+    ++ LS +   LAK Y+ L  A+G G+N
Sbjct: 436 NAYRSYYSSQMSLSDSSITLAKHYIALMKALGGGWN 471


>gi|316934461|ref|YP_004109443.1| RND efflux system outer membrane lipoprotein [Rhodopseudomonas
           palustris DX-1]
 gi|315602175|gb|ADU44710.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhodopseudomonas palustris DX-1]
          Length = 554

 Score =  223 bits (568), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 138/470 (29%), Positives = 236/470 (50%), Gaps = 31/470 (6%)

Query: 10  LFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIAL 69
           L  VLL GC VGP+Y  P +   P Q+S   +         +WW    D +L++LV  A+
Sbjct: 58  LAAVLLGGCAVGPDYRTPLL-ATPAQWSRAGASTPAPPVLPRWWTRLRDPTLDRLVVEAV 116

Query: 70  QQNLTILQATERINAAKENILSVRADLFP----SSYASISHRFI--------PNLKTNST 117
             NL +  A+ R+  A+ +       L P    S  AS++            PNL + S+
Sbjct: 117 DGNLDVATASARVREARASYRQAVGALLPAITNSDSASLAKGMGVPSAAPGRPNLSSPSS 176

Query: 118 ------------GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSY 164
                          D+ W++DLFG  RR +E++   +D++   +    L ++  +  SY
Sbjct: 177 VAGSEGTSGLYKAGFDASWELDLFGANRRAVEAAAYGIDASDENLRAVLLTLVGDVASSY 236

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           ++AR ++ RI++AH+      +   ++  +   G  S + L     +  +  + IP LE 
Sbjct: 237 VEARAYQARIALAHRTALSQDETTTITRNRLAAGTASAVDLATATGQAAATRAAIPALET 296

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
           ++   VH +S L G P       + +      P L  P+  GIPAD++  RPD+R  E++
Sbjct: 297 AYAQTVHRLSVLTGRPPAALSALLARPKPVPTPKL--PVPAGIPADVLLTRPDVRLAERR 354

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIALTHDN-SFPGYNTH--WSFGPKLYLPIFDKGKIK 341
            A S A+IG A++ LYPS+SL G+IA +       G N+   WS GP L +PIF+ GK++
Sbjct: 355 YAQSTARIGQAEAALYPSVSLAGNIATSGTRLGDLGRNSSISWSLGPTLTMPIFNGGKLR 414

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           + +  A++    Q++ +Q +VL A+K+VE+AL +++ ++     L  +   ++++ SLS 
Sbjct: 415 AAVEIAQAQRDAQFLAYQASVLTALKDVEDALVALSNERVRGRILATSTTAYRQAASLSQ 474

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             YR G  S LD+L  ER+    E  L  ++ ++   Y+ L  A G G++
Sbjct: 475 SLYRSGSSSFLDVLTAERSLYSAEDALLQSRVRIVSDYIALNKAFGGGWD 524


>gi|218507899|ref|ZP_03505777.1| nodulation protein [Rhizobium etli Brasil 5]
          Length = 339

 Score =  223 bits (568), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 134/315 (42%), Positives = 190/315 (60%), Gaps = 16/315 (5%)

Query: 29  MPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKEN 88
           MPL P +F    S +  N+   +WW ++ D  LN LV   L++NL +LQA E IN+A  N
Sbjct: 1   MPL-PAKFEESGSTSNGNVVNDEWWTAYRDKQLNGLVTHGLRENLDVLQALESINSASAN 59

Query: 89  ILSVRADLFPSSYASISH-------RFIPNLK-TNSTGQLDS-DWKIDLFGQ-RRHIESS 138
           +    A   PS     SH       R   ++  TN+TG   S  W +D FGQ RR  ES+
Sbjct: 60  VTVAGAGGLPSLTVGASHTLSGEKGRLRTSVGATNTTGGEASLSWLLDFFGQYRRSRESA 119

Query: 139 LANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQG 198
           +A+L +AYA  D AKL  +  L+ SYIDAR+++ERI+++   L   ++  EL+ L+   G
Sbjct: 120 IASLGAAYATADNAKLTFLKDLVESYIDARYYQERIALSRASLKSRQQTYELTQLQLKAG 179

Query: 199 ATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPN 258
           A S+L +V+ E  ++S +SDIP LEKSF  + H+I+TL+G PA+  +  +QK +   QP 
Sbjct: 180 AASRLDVVQAEGLVQSTKSDIPGLEKSFTESAHHIATLIGMPASSLMGELQKSAG--QPV 237

Query: 259 LYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIA---LTHDN 315
               I  GIPADLIRNRPDIR  E++LA +VA IG A++ LYPS++L+GSI+   +    
Sbjct: 238 FRGDIRAGIPADLIRNRPDIRKAERELAAAVADIGAAEAQLYPSMTLSGSISPSWVKSSC 297

Query: 316 SFPGYNTHWSFGPKL 330
           +  G  T WSFGP L
Sbjct: 298 ASGGSLTSWSFGPSL 312


>gi|319406307|emb|CBI79944.1| putative outer membrane protein [Bartonella sp. AR 15-3]
          Length = 470

 Score =  223 bits (567), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 134/448 (29%), Positives = 238/448 (53%), Gaps = 12/448 (2%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLIN--IDTLKWWESFNDTSLNKLVKIALQQN 72
           + GC VGP+Y K    + PT +   +S  +         WW +FND  L++L+  A+  N
Sbjct: 1   MPGCVVGPDYRKTSFSV-PTLWGQHSSAQISEHPAALAGWWRNFNDPVLDQLINDAIVAN 59

Query: 73  LTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS----TGQLDSDWKIDL 128
             I  A  R+  A+ ++  V   L PS  +SI      +    S     G  D+ W++DL
Sbjct: 60  NNIALAKARVREARASLGQVIGHLLPSVSSSILGNHSSSQSDTSLRQYRGGFDASWELDL 119

Query: 129 FG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKN 187
           FG  +R +E++  +LD+    +    + ++  +  +YI+ R +++++ IAH I  L +K 
Sbjct: 120 FGGHKRAVEAARYDLDATVEDLRATMVTLLGDIATNYIEMRGWQKKLLIAHSIAALQRKT 179

Query: 188 IELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHY 247
            +L   K   G  S+L     +A++ + E+DI  +E +  M++H +S L G        +
Sbjct: 180 AQLIKAKLEAGDISELDNSNAQAQMINTEADIIQMEVNLSMSIHRLSVLTGRVPVALQDF 239

Query: 248 MQKQSNNFQ-PNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLN 306
           +QK +   Q P    PI++GIPAD++  RPD+R  E++ A + A++G  +++ YPSLSL 
Sbjct: 240 LQKSAEKKQLPKPKWPISVGIPADILLTRPDLRRAERQYAQATARVGQREAERYPSLSLT 299

Query: 307 GSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVL 363
           G+I+ T ++      G    WSFGP L  P F+ G++ +++    +   + +I ++  VL
Sbjct: 300 GNISTTAESIGQLAKGSTIGWSFGPNLRFPFFNGGQVVASVAVGRAQRDQAFIAYRAAVL 359

Query: 364 NAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAK 423
            A++EVENAL  + ++++ + KL  A   +  S+ LS   +  G  S L++L+  R+   
Sbjct: 360 GALEEVENALVRLYKEQQRLKKLLAANAAYSHSLQLSQGLFESGNISFLELLNAYRSYYS 419

Query: 424 VEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            ++ LS +   LAK Y+ L  A+G G++
Sbjct: 420 SQMSLSDSHIVLAKHYIALMKALGGGWD 447


>gi|77920683|ref|YP_358498.1| outer membrane protein [Pelobacter carbinolicus DSM 2380]
 gi|77546766|gb|ABA90328.1| outer membrane protein [Pelobacter carbinolicus DSM 2380]
          Length = 503

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 130/453 (28%), Positives = 244/453 (53%), Gaps = 21/453 (4%)

Query: 18  C-TVGPEYTKPHMPLLPTQFSIGNSKNLINID--TLKWWESFNDTSLNKLVKIALQQNLT 74
           C  VGP+Y  P +   P  +  G    L+     T+ WW +F D  L++ ++ A + NL 
Sbjct: 36  CIAVGPDYAPPDIKT-PDDWRSGQDPALVPDQSVTVDWWATFEDPLLDQYIEQAGRNNLD 94

Query: 75  ILQATERINAAKENILSVRADLFPSSYA---SISHRFIPNLKTNSTGQ--------LDSD 123
           I QA  RI  A+ ++ + R   +P + A   +I  R   N   ++ G+        LD+ 
Sbjct: 95  IRQAVSRIREARASLGAARGAWWPEANAKGSAIRQRSSENGMYSTGGKTETLYNTGLDAS 154

Query: 124 WKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILD 182
           W+IDLFG+ RR +E++ A+  ++        ++V +++  +Y D R ++ R++ A   ++
Sbjct: 155 WEIDLFGRIRRSVEAAQADYQASEEDRRDVLISVFAEVARTYFDIRTYQARLAAAQGNIE 214

Query: 183 LYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPAT 242
             ++ ++L+  +F  G  + L + + E  + + +++IP L+     +V+ ++ LLG    
Sbjct: 215 SQQQVLKLTRSRFRNGLATGLDVAQAEQVLAASQAEIPPLQVGLTRSVNTLAVLLGQAPG 274

Query: 243 EFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPS 302
                ++K +    P   + +  G+PADL+R RPDIR  E++LA   A+IG+A +DLYPS
Sbjct: 275 SLSEQLEKPAPIPVPPARVAV--GVPADLLRQRPDIRRAERQLAAQTARIGVATADLYPS 332

Query: 303 LSLNGSIA---LTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQ 359
           LSL+G+ A   +   N   G +  + FGP L   +FD G++++ I   ++  ++  ++++
Sbjct: 333 LSLSGTFAFEAIDAGNLLKGSSRAFGFGPTLRWMLFDGGRVRAQIAVQDAKTEQALLSYE 392

Query: 360 ETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIER 419
           ++VL A+ EVENAL+     +  ++ L+ +V+  ++S+ L+   YR G     ++LD +R
Sbjct: 393 QSVLEALNEVENALSQYLNQRNRLSALERSVQAAQRSLKLATRLYRDGLVDFQNVLDAQR 452

Query: 420 ATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           +    E  L+ A+   +   V LY  +G G+NP
Sbjct: 453 SLFDNENQLAAARGDTSIYLVQLYKTLGGGWNP 485


>gi|310778926|ref|YP_003967259.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Ilyobacter polytropus DSM 2926]
 gi|309748249|gb|ADO82911.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Ilyobacter polytropus DSM 2926]
          Length = 482

 Score =  220 bits (560), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 136/462 (29%), Positives = 245/462 (53%), Gaps = 29/462 (6%)

Query: 12  IVLLAGCT-VGPEYTKPHMPLLPTQFSIGNSKNLINIDTL--KWWESFNDTSLNKLVKIA 68
           +++  GCT VGP+Y  P + + P +++   S N  N + L  +WWE F+D  L++L+K A
Sbjct: 21  VLVFTGCTAVGPDYVSPKVKV-PEKWNGEKSVNFNNENRLSEQWWELFDDPMLDELIKEA 79

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPS---------SYASISHRFIPNLKTNSTGQ 119
              NL + +A  R++  +  +  V  + +PS            S +  +     T     
Sbjct: 80  SVSNLDLKEAMARVDEYRSRLGVVTGERYPSIGVEGDLLRQKTSENAGYTGTTNTYKALG 139

Query: 120 LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAH 178
           L++ W+IDLFG+ RR IE++ AN +      +  ++++ S++  +YI  R ++ R+  ++
Sbjct: 140 LEAGWEIDLFGRVRRSIEAAKANYEVVQEDRNDVRISINSRIALNYIKIRTYQARLEASN 199

Query: 179 QILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG 238
             ++L ++ + ++  +F  G  + L + + E  + S E+ +P L       ++ ++ LLG
Sbjct: 200 SNIELQREVLRITESRFKYGLATALEVAQAEQALASSEATVPPLRIQLSEAINTMAVLLG 259

Query: 239 YPATEFLHYMQKQSNNFQPNLYIPI-----NIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
               E    M ++ +       IP+      IG+PAD++R RPDIR  E++LA   A++G
Sbjct: 260 RNPGELNQLMSEKKS-------IPVPPADAAIGVPADILRQRPDIRSAERQLAVETARVG 312

Query: 294 IAKSDLYPSLSLNGSIA---LTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESS 350
           IAK+DLYP  SL+GS     ++  N F     ++S GP L   IF  G I + I   ++ 
Sbjct: 313 IAKADLYPQFSLSGSFGYQSVSSGNLFSSGGNYFSIGPSLRWNIFSGGSILNQIDVQDAI 372

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
            +++ + ++  VLNA+ E EN +T+  ED   +  L+  VE  KK++ LS+  Y+QG   
Sbjct: 373 VRQKALQYESIVLNALNEAENTMTAYTEDSMRLKHLEKTVEASKKTVKLSLNLYKQGLVD 432

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
             ++L+ + +    E  L+ A+   A+ +V LY A+G G+NP
Sbjct: 433 FENVLNSQLSQFTSEDRLAQARGDSAEDFVRLYAALGGGWNP 474


>gi|90425980|ref|YP_534350.1| RND efflux system, outer membrane lipoprotein, NodT
           [Rhodopseudomonas palustris BisB18]
 gi|90107994|gb|ABD90031.1| RND efflux system, outer membrane lipoprotein, NodT
           [Rhodopseudomonas palustris BisB18]
          Length = 505

 Score =  218 bits (555), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 135/453 (29%), Positives = 236/453 (52%), Gaps = 17/453 (3%)

Query: 10  LFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIAL 69
           L +  LA C        P    LP +F+ G S N +      WW    +  L++L++  L
Sbjct: 15  LTVCALAACKTSDGRHPPEF-RLPDRFTTG-SVNPVPNPYQTWWRRVGNHELSQLIERGL 72

Query: 70  QQNLTILQATERINAAKENILSVRADLFPS--------SYASISHRFIPNLKTNSTGQLD 121
             NL I +A +RIN A + +    AD FP         S+ +I         T+S G L+
Sbjct: 73  ANNLDIARAVDRINVASQRVTIAGADAFPQVGVGATTQSFGTIPAGVTGTTSTHSAG-LN 131

Query: 122 SDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI 180
             W +D  G+  +   +S A L +A       +L  ++ LI +YID  +F   I++    
Sbjct: 132 VSWLLDFNGKIAKQKSASEAELRAAGYDFANVRLAYLADLIATYIDMNYFARTIAVTEGS 191

Query: 181 LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP 240
           +   +  + L       G +S+L + + +A++ ++ + +P L++   +  ++I+TL+G  
Sbjct: 192 IKNAEDTVTLVRNMKELGTSSELDIAQAQADLATLRASLPALQRDRTIAANHIATLIGVA 251

Query: 241 ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLY 300
           A        + S + +P L   +  GIPADLIRNRPDIR +E+ L  +  +IG+A++DL 
Sbjct: 252 AGSL---TLQGSRSLEPLLSADVGAGIPADLIRNRPDIRVKEQLLYAAAERIGVARADLL 308

Query: 301 PSLSLNGSIALTHDNSFPGY--NTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITW 358
           PS++LNG+I      +  G      W+F   +  P+FD  + ++ IR A++    +Y+ W
Sbjct: 309 PSVTLNGTINAALSPTIYGMLGGGTWAFASSILAPVFDGERRQATIRLAQADCHLRYLDW 368

Query: 359 QETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIE 418
           ++ VL A++EVEN LTSI   ++ +  L+ +V  ++KS+SL+      G   LL ++D +
Sbjct: 369 RQNVLVAVEEVENLLTSIKRGQRELASLRDSVAANEKSLSLTRAAMTGGTGILLGVIDAQ 428

Query: 419 RATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           R+  +  + L+ ++RQLA+  + L IAIG+G +
Sbjct: 429 RSLNRSRLALAQSQRQLARFQISLQIAIGAGAD 461


>gi|301064154|ref|ZP_07204601.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [delta proteobacterium NaphS2]
 gi|300441774|gb|EFK06092.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [delta proteobacterium NaphS2]
          Length = 518

 Score =  217 bits (552), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 132/462 (28%), Positives = 245/462 (53%), Gaps = 24/462 (5%)

Query: 10  LFIVLLAGCT-VGPEYTKPHMPLLPT-QFSIGN-SKNLINIDTLKWWESFNDTSLNKLVK 66
           + + +L+GC  +GP +  P  PL P  Q + G  +++       +WWE FND  LNKL++
Sbjct: 10  VVMAILSGCAMIGPNFNPPEAPLAPKWQETEGAYTRSDTKAYDSRWWEVFNDPVLNKLIE 69

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFPS-SYASISHRF--------IPNLKTNST 117
           +A QQNLT+  A  R+  A+  +  V   L+P    A+ S+ +         P     S 
Sbjct: 70  LAYQQNLTLQIAGLRVLEARAQLGVVVGSLYPQVQQATGSYSYNRASGGGAEPYFSGASI 129

Query: 118 GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISI 176
           G  D+ W++D +G+ RR I+S+ ANL +  A  D A + + +++  +Y+  R F+ERI +
Sbjct: 130 G-FDAGWELDFWGKFRRSIQSADANLMANMAGYDDALVTLTAEVARAYVQIRTFEERIRL 188

Query: 177 AHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL 236
           A + + + K+ +E+S  +F  GA S+L + +    + +  + +P  +   R   H +S L
Sbjct: 189 AEENIRIQKRALEISEARFKSGAVSELDVQQARTLLNTTRAAVPAFQILLRQTQHALSVL 248

Query: 237 LGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
           LG P  +    +  +     P+  + + +G+PADL++ RPDIR  E +     ++IG+AK
Sbjct: 249 LGMPPQDLDGLL--EGPRIIPDAPVQVAVGVPADLLKRRPDIRQAELQAVAQCSRIGVAK 306

Query: 297 SDLYPSLSLNGSIALTHDNS--------FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
           +DL+PS+SL GS+  +  ++        F   +  +S GP     +F+ G+I +++R  +
Sbjct: 307 ADLFPSISLLGSLGWSTTDAGRSSLGDLFQSSSFGFSVGPSFQWNLFNYGRITNSVRVQD 366

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           +  Q+    ++ TVLNA +EVE+A+T     K      + +V+  +++  +S+I Y  G 
Sbjct: 367 ARFQQTLTLYRNTVLNAAREVEDAMTGFMRSKIQAVYQEESVKAAQRTSEISLIQYTAGT 426

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            +   +L   ++ ++ +   +  K  +A + V +Y A+G G+
Sbjct: 427 IAYESVLTSTQSLSQQQDQYAQTKGNIALNLVAMYKALGGGW 468


>gi|87310416|ref|ZP_01092546.1| outer membrane efflux family protein [Blastopirellula marina DSM
           3645]
 gi|87286915|gb|EAQ78819.1| outer membrane efflux family protein [Blastopirellula marina DSM
           3645]
          Length = 530

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 135/457 (29%), Positives = 237/457 (51%), Gaps = 28/457 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGNSKNLINI--DTLKWWESFNDTSLNKLVKIALQQNLT 74
           GC +GP++  P  P LP  +S    + L +   D++ WW  FND  L++++    QQNLT
Sbjct: 15  GCLIGPDHCDPGAPFLP-HWSRPLPEGLTDEPNDSVAWWTKFNDPVLSEMMVRTAQQNLT 73

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFI---------------PNLKTNSTGQ 119
           + QA ERI  A+      R  LFP  +  +S+  I               P+    S   
Sbjct: 74  LGQAYERIAEARAQRAIARGGLFPDFFMDMSYSRIKSSNNGSPIGLTFQTPSFNYWSASL 133

Query: 120 LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAH 178
           +D+ W+ID++G  RR+++++ A++D A    +   +++   +  +Y+ AR  + RI IA 
Sbjct: 134 VDASWEIDVWGAVRRNLQAANADIDVAIEDHNAILVSLQGDVGANYVQARTLQHRILIAQ 193

Query: 179 QILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG 238
           + + L +++++++  K   G  SKL + +  + + S ES IP+L ++  +  + ++ L G
Sbjct: 194 RNVQLQRQSLQIAETKLEAGTVSKLDVYQARSNLYSTESLIPSLRQNLDIAYNRLAVLQG 253

Query: 239 YPATEFLHYMQKQSNNFQPNLYIPINI--GIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
            P  +  + +      F+    IP NI  G+P ++IR RPDIR  E++LA   ++IG+A 
Sbjct: 254 MPPQDLTNEVMGARQLFK----IPDNIAVGLPIEIIRQRPDIRMAERQLAAQASRIGVAM 309

Query: 297 SDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQE 353
           +D+ P  +LNG++   A + D  F G +  ++FGP     +   G++  NI    +  +E
Sbjct: 310 ADMLPRFTLNGTLGVNATSIDQWFTGDSLAYNFGPTARWNVLSFGRVWGNIEFQRARWRE 369

Query: 354 QYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLD 413
               +Q+TVL A +EVENA+ S    +    +L  AVE  + + ++S + Y  G      
Sbjct: 370 LVNNYQQTVLEASEEVENAMISYRFTQVRADQLYKAVEAAQGASAISEVQYEGGIIPFQT 429

Query: 414 ILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +LD +R  A +E     A+     S V+LY A+G G+
Sbjct: 430 LLDAQRFQADLEDQYVAARGDTYTSLVNLYKALGGGW 466


>gi|310815785|ref|YP_003963749.1| Nodulation protein T [Ketogulonicigenium vulgare Y25]
 gi|308754520|gb|ADO42449.1| Nodulation protein T [Ketogulonicigenium vulgare Y25]
          Length = 454

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 129/447 (28%), Positives = 242/447 (54%), Gaps = 21/447 (4%)

Query: 16  AGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           A C  VGP+      P +PT F  G+   L  +    +W  + D++L  ++   L QNL 
Sbjct: 18  AACVAVGPDPQSTPAPAVPTTFVGGDGAALPAVAQTAFWADYRDSTLTAIITRGLSQNLD 77

Query: 75  ILQATERIN--AAKENILSVRADLFPSSYAS----ISHRFIPNLKTNSTGQLDSDWKIDL 128
           +L A +RI+   A      + A    SS  +     S   I   + N T  L + +  DL
Sbjct: 78  VLAANQRIDAARAAAAATGIMASQGSSSLGTQRTRTSGDGIATTEAN-TSTLSAAFVFDL 136

Query: 129 F-GQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKN 187
           F GQ R  E++ A+L SA A     +L  ++++I +Y +AR+++E +++    +   ++ 
Sbjct: 137 FGGQLRAREAASASLMSAEAGAQTTRLAWLAEVISAYGNARYYQEAMTLTRNTIATRERT 196

Query: 188 IELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHY 247
           +E++  K   G  +   + ++EA + +  +D+PT E +F   + +++ LL  PA   +  
Sbjct: 197 VEVTRNKLNVGTATDFEVAQVEALLSASRADLPTQEAAFNAQIFSLAALLNEPAGPLMAQ 256

Query: 248 MQKQSNNFQPNLYIPI--NIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSL 305
           MQ+ ++     L +P    +G+PADL+RNRPD+R  E  L  ++A IG+A++ LYPSL+L
Sbjct: 257 MQRGAS----MLRVPAAPRVGVPADLLRNRPDVRAAEHDLVAAMADIGVAEASLYPSLTL 312

Query: 306 NGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNA 365
           +G+   T           +SFGP L LP+ ++G +++   +  + A +    W+ +V++A
Sbjct: 313 SGTATATSGTDV------FSFGPSLSLPLLNQGTLRATRDQRIALADQAQTAWRASVVSA 366

Query: 366 IKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVE 425
           I +V+   +++   ++ ++ L+ +V  + ++  L+  N+ +G  +LLD+L+++R+ A   
Sbjct: 367 IADVQTQNSNLQRYRQQLSALEASVAAYDRAFELAQRNFEEGSLALLDLLEVDRSLASAR 426

Query: 426 VDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           + L+ A+   A+S+  L IAIG+G NP
Sbjct: 427 LSLAAARNTAAQSWASLNIAIGAGANP 453


>gi|256829692|ref|YP_003158420.1| NodT family RND efflux system outer membrane lipoprotein
           [Desulfomicrobium baculatum DSM 4028]
 gi|256578868|gb|ACU90004.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfomicrobium baculatum DSM 4028]
          Length = 531

 Score =  213 bits (543), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 131/478 (27%), Positives = 242/478 (50%), Gaps = 34/478 (7%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK-NLINIDTLKWWESFNDTSLNKL 64
           AIFSL + ++AGC VGP+Y +P  P +       ++       +   WW+  ND  L++L
Sbjct: 16  AIFSLALAVIAGCAVGPDYVRPQAPQMQEWLEKDDAGLKHGPAELAAWWKRLNDPVLDRL 75

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSY---ASISHRFIPNLKTNSTGQ-- 119
           V +A ++N ++  A  RI  ++  +     + FP       S+S   +     N+T    
Sbjct: 76  VALAAERNPSLHVAALRILESRARLGIATGNQFPQLQQLQGSVSDTGLSRHNANTTPAID 135

Query: 120 ---------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                    LD+ W++D +G+ RR +ES   ++D+A A  D   + + +++   Y+  R 
Sbjct: 136 RYYATASVALDAAWELDFWGRFRRAVESGAWSVDAAMAGYDDLLVTLTAEVARVYVTLRT 195

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
            ++R+ IAH+ + L +++++++ +    G  ++L + +  A +   ++ IP LE   R +
Sbjct: 196 LEQRLFIAHENVALQERSLQIARVLHQGGDVTELDVTQAAALLAGTQASIPRLEAQLRQS 255

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            + +S LLG    E    +        P +   + +G+PA+L+R RPDIR  E ++A   
Sbjct: 256 KNGLSALLGMLPGEADRILGGPGPV--PQVPSEVAVGVPAELLRRRPDIRLAEAQMAAQC 313

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHDN---SFPGY-------------NTHWSFGPKLYLP 333
           A IG+A++DLYP  SL G+I L+  N   +F GY             +  +S G      
Sbjct: 314 ALIGVAQADLYPRFSLFGTIGLSASNAALTFAGYPGGSSLGDLWSGESLQYSGGLGFGWD 373

Query: 334 IFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELH 393
           IF+ G+I +N+R  ++  Q+    ++  VL A +E E+ALT+ +  ++ V  L+  V   
Sbjct: 374 IFNYGRITNNVRVQDARFQQLVEQYKNIVLTAARETEDALTAFSRSREEVAFLEQGVAAA 433

Query: 394 KKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            +S+ +SMI YR+G      +LD +R+  +V+  L+  +  +  + +  Y A+G G+ 
Sbjct: 434 TRSVEISMIQYREGLADFQRVLDTQRSKVQVQDQLTATQGSVLTNLIATYKALGGGWE 491


>gi|83956107|ref|ZP_00964589.1| hypothetical protein NAS141_02901 [Sulfitobacter sp. NAS-14.1]
 gi|83839673|gb|EAP78852.1| hypothetical protein NAS141_02901 [Sulfitobacter sp. NAS-14.1]
          Length = 435

 Score =  211 bits (538), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 138/440 (31%), Positives = 233/440 (52%), Gaps = 17/440 (3%)

Query: 18  CT-VGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTIL 76
           CT VGP+YT P  PL  T F IG    L  +   +WW+  ND  +N+LV   L QN+ I 
Sbjct: 4   CTAVGPDYTPPKTPL-ETSF-IGGGGALEEVARDEWWKRLNDRQMNRLVDRGLTQNIDIA 61

Query: 77  QATERINAAKENILSV-RADLFPSSYASISHRFIPNL---KTNSTGQLDSDWKIDLFGQ- 131
            A +RI AA  ++     A  F     + + R   N      + +    +++ +D+FG  
Sbjct: 62  TALQRIKAANTDLRQTGTAGQFSGGLDAQAQRNNGNPISGDPSESATFGANYILDIFGGV 121

Query: 132 RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELS 191
           RR  + + A +++A       +L ++S ++ +YIDAR+F+E +++  Q +   ++   L 
Sbjct: 122 RRDAQRAAAGVEAAKFDAGTVRLALVSGVVSNYIDARYFQEALALTRQNIASLRRTQSLI 181

Query: 192 HLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQ 251
             +  QGA S+L L +   ++ +  +D+P LE +F   V  I+TLL  PA   L  M   
Sbjct: 182 RAQVEQGALSELDLARSAGQLDTAIADLPPLEAAFEARVFAIATLLAEPAQPLLKQMI-- 239

Query: 252 SNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIAL 311
           +   QP      + G+PA+L+RNRPD+   E++LA +VA +G+A++ LYPS++L+GS+  
Sbjct: 240 AGAPQPYPRSKGSTGVPANLLRNRPDVLAAERRLAAAVAGVGVAEAKLYPSVTLSGSVTA 299

Query: 312 THDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVEN 371
            +        + WSFGP L LPI ++G +++    A  SA    + W+  VL A+++V+ 
Sbjct: 300 ANP-------SEWSFGPALSLPILNQGPLRARRDAAIISATTAELEWRAQVLAAVEDVQK 352

Query: 372 ALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIA 431
             +     ++ V  L+ A     +++ LS   + +G  +L D+LD ER      + L+ A
Sbjct: 353 TQSEFTRKQREVAALRAAQRSRDRTLQLSRKVFERGELNLPDLLDAERFANAARISLAAA 412

Query: 432 KRQLAKSYVDLYIAIGSGYN 451
            R LA+S+  L +A G G+ 
Sbjct: 413 VRDLAQSWSALMVATGRGWG 432


>gi|240851282|ref|YP_002972685.1| putative outer membrane efflux protein [Bartonella grahamii as4aup]
 gi|240268405|gb|ACS51993.1| putative outer membrane efflux protein [Bartonella grahamii as4aup]
          Length = 493

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 129/449 (28%), Positives = 232/449 (51%), Gaps = 18/449 (4%)

Query: 17  GCTVGPEYTKP--HMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           GC VGP Y K    +P +  + S   +   + +    WW   ND  L+ L+  A+  N  
Sbjct: 26  GCMVGPNYQKTSFRVPAVWGEKSAQTAGQPVAL--AGWWRRLNDPVLDALMDYAISGNNN 83

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS-----TGQLDSDWKIDLF 129
           +  A  R+  A+  +  V   L P+   SIS     + ++++         D+ W++D F
Sbjct: 84  VAVAKARVREARAGLGQVVGTLLPNVSNSISGTRSHSGQSDALLNQYRSGFDASWELDFF 143

Query: 130 G-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNI 188
           G  +R +E++   LD+A   +    + ++  +  +Y+  R +++++ I  QI    +K  
Sbjct: 144 GGHKRAVEAARYGLDAAVEDMRATMVTLLGDVATNYVQMRGWQQKLLIVRQIAVSQRKTY 203

Query: 189 ELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYM 248
           EL   + T G  S+L +   +A++ + E+DI  +E +  M+VH +S L G   T     +
Sbjct: 204 ELMRARLTAGDVSELDVSNAQAQMANTEADISQMEANLAMSVHRLSVLTGCVPTALKDLL 263

Query: 249 QKQSNNFQ-PNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNG 307
           QK + + + P    PI  GIPAD++  RPD+R  E++ A + A+IG  ++D YPSL+L G
Sbjct: 264 QKNAKHAKIPQPRWPIPAGIPADILLTRPDLRRAERQYAQATARIGQREADRYPSLTLTG 323

Query: 308 SI---ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLN 364
           +I   A   D  +      WSFGP L  P F+ G+++++I  A +   + +IT++  VL 
Sbjct: 324 NISTAATAIDQLWKNSTIGWSFGPGLRFPFFNGGQVEASIAVARAQRDQAFITYRAAVLG 383

Query: 365 AIKEVENALTSINEDKKIVTKL--QHAVELHKKSMSLSMINYRQGRYSLLDILDIERATA 422
           A+++VENAL  + ++ + + KL   +   LH  S+ LS   +  G  S L++L+ +R+  
Sbjct: 384 ALEDVENALVRLTKEYQRLEKLIIVNKASLH--SLKLSRSLFENGNTSFLELLNADRSYY 441

Query: 423 KVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             ++ L  ++  L   Y+ L  A+G G++
Sbjct: 442 SAQMALKDSRVSLVTQYITLMKALGGGWD 470


>gi|116751340|ref|YP_848027.1| outer membrane efflux protein [Syntrophobacter fumaroxidans MPOB]
 gi|116700404|gb|ABK19592.1| outer membrane efflux protein [Syntrophobacter fumaroxidans MPOB]
          Length = 569

 Score =  210 bits (534), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 133/481 (27%), Positives = 251/481 (52%), Gaps = 32/481 (6%)

Query: 1   MNILRAIFSLFIVL-LAGCT-VGPEYTKPHMPLLPTQFSIGNSK-NLINIDTLKWWESFN 57
           M  + A+  L   L  AGCT VGP++ KP  P+        NSK    + D  +WW  F 
Sbjct: 36  MRCVSALMLLAATLGAAGCTAVGPDFAKPSAPVAANWSEKDNSKVKTESGDYSQWWTVFE 95

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS-SYASISHRFIPNLK--T 114
           D  LN L++IA + N  +  A  RI  A+  +     + FP     + ++ +  N +   
Sbjct: 96  DEVLNNLIRIAYENNPDLQVAGLRILEARAQLGIALGNQFPQKQQGNAAYTYTRNSENAA 155

Query: 115 NSTGQ-----------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIP 162
           N+ G            +D+ W+ID +G+ +R IES+ A+L ++ A  D A +++   +  
Sbjct: 156 NTAGGGDLRYGAYNYGIDASWEIDFWGKYKRGIESADASLTASVADYDSALVSLAGNVAS 215

Query: 163 SYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTL 222
           +Y+  R ++ER+ +A + +++ K+++ L+ +++  GA ++L + +    +   ++ IP+L
Sbjct: 216 TYVQIRTYEERLKVARENVEIQKESLRLTEVRYRNGAVTELDVQQARTLLYDTQAQIPSL 275

Query: 223 EKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQE 282
           E S + + ++++ LLG P  +    +  +     P     + +GIPA+L+R RPDIR  E
Sbjct: 276 EISLQQSRNSLAVLLGMPPGDLAGLLGDKPGTI-PTPPAEVVLGIPAELLRRRPDIRSAE 334

Query: 283 KKLADSVAKIGIAKSDLYPSLSLNGSIAL---------THDNSFPGYNTHWSF----GPK 329
            + A   A+IG+AK++L+P +SL GS            T  + F    T  S+    GP 
Sbjct: 335 LQAAAQCAQIGVAKAELFPRISLLGSFGFLASDSRLTRTGGSGFTDLFTWSSYTMTTGPT 394

Query: 330 LYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHA 389
           +  PI + G+I +N+R  ++  ++  +T++ TVL A KEVE+AL      +     L+ +
Sbjct: 395 IEWPILNYGRITNNVRVQDARFEQLMVTYRNTVLGAAKEVEDALVGFLRSQDKTALLEES 454

Query: 390 VELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           V+  K+++ L+M+ YR+G      +L+ +++  + +  L+ ++  +  + V LY  +G G
Sbjct: 455 VKAAKRAVDLAMLQYREGAVDFTTVLNSQQSLVQEQDSLTQSRGAVPTNLVALYKGLGGG 514

Query: 450 Y 450
           +
Sbjct: 515 W 515


>gi|327393269|dbj|BAK10691.1| Nodulation protein T precursor NodT [Pantoea ananatis AJ13355]
          Length = 508

 Score =  209 bits (531), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 133/476 (27%), Positives = 241/476 (50%), Gaps = 38/476 (7%)

Query: 10  LFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL----KWWESFNDTSLNKLV 65
           + +  L GC+VGP+Y  P  P LP  +   +S+      T     +WW +F D  L+ L+
Sbjct: 15  MLLFALTGCSVGPDYQAPK-PQLPGSYHALDSQETSRPQTSAVDSRWWRNFGDPQLDSLI 73

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPS--SYASISHRFIPN---LKTNSTGQL 120
             A++ NL++ QA  RI  A+E +   +  LFPS    A ++ + +     LK N   QL
Sbjct: 74  ARAIEGNLSLQQAVLRIAGAREQLSQAQGGLFPSLNGSAKVTRQQLGLEGLLKANGADQL 133

Query: 121 DSD----------------------WKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVI 157
           DS+                      W++DL+G+ RR IES+ A   +A  Q + A +++ 
Sbjct: 134 DSNVASQLNGLTQPVTLYQGSFDASWELDLWGKVRRQIESANAQQQAAIEQRNDALVSLE 193

Query: 158 SKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIES 217
           ++++ +++  R  +  +    Q + +  +  +L+  +   G     ++    A++ S+++
Sbjct: 194 AEVVRAWLQLRGAQATVKTLQQQIAVADQTWQLTESQQRNGLAPVTNVENARAQLSSLQA 253

Query: 218 DIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPD 277
            +P  +   R  ++ ++ LLG         + +      P L   +++GIP+ L R RPD
Sbjct: 254 QLPQYQAQTRQAMNGLAVLLGKTPGALDAELSE--PKALPALPAFVSVGIPSTLARRRPD 311

Query: 278 IRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIAL--THDNSFPGYNTH-WSFGPKLYLPI 334
           IR  E  L    A+IG++ + L+PSLSL G + +  T  +    +++H +S GP L +PI
Sbjct: 312 IRQAEATLHAQTAEIGVSVAQLFPSLSLTGQLGVRNTDVSYLDNWSSHFYSVGPSLSIPI 371

Query: 335 FDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHK 394
           F  G++ S++R A +      + +++TVL A+++VENAL S   D++ VT L       +
Sbjct: 372 FQGGRLVSSVRLARAQQASAALNYRQTVLTALQDVENALVSYRADQQRVTALDETTGALQ 431

Query: 395 KSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           ++  L+  +YRQG  + L++LD +R  A+     + A+ Q     V LY A+G G+
Sbjct: 432 RTFDLASDSYRQGLSTFLEVLDAQRQLAQAREQATQARMQSGLDLVALYKALGGGW 487


>gi|119385668|ref|YP_916723.1| RND efflux system outer membrane lipoprotein [Paracoccus
           denitrificans PD1222]
 gi|119376263|gb|ABL71027.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Paracoccus denitrificans PD1222]
          Length = 482

 Score =  209 bits (531), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 121/404 (29%), Positives = 214/404 (52%), Gaps = 7/404 (1%)

Query: 52  WWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFP---SSYASISHRF 108
           WW +F D  L+ L+   L +NL +  A   I  A+ N   V A   P   +  A+  +R 
Sbjct: 55  WWAAFRDKRLDGLIAAGLNRNLDVQTAVATIREAQANARLVGASDLPQVEAQGAAARNRS 114

Query: 109 IPNLKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
              +  +S+  L   W +DLFGQ R   + + A LD+AY   ++A+L V S +  +Y+DA
Sbjct: 115 ETGIVESSSATLGVSWLVDLFGQNRAARQGASARLDAAYLSAEVARLTVASAIASAYVDA 174

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
           R+++E +++  Q L   K+ +E++  +   G+ S+L +++ E  +   E+ +P LE  F 
Sbjct: 175 RYYQEALALTRQSLTSRKRTLEMTRTQDAFGSVSRLEVLQAEQLVAQAEAALPGLEVGFD 234

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
            +V+ ++TL    + +    +++     QP      ++G+PAD++R RPD+R  E+ LA 
Sbjct: 235 QSVNRLATLTAGRSADLAAQLRQ--GGGQPRARYSASVGVPADVVRVRPDVRMAERNLAA 292

Query: 288 SVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
           + A +G A++  YP L+L+GSI  T+        +     P++ LP+F  G  ++ +  A
Sbjct: 293 AAADVGEAQAAFYPRLTLSGSITPTNIGGGGSSKSWGFG-PQISLPLFSGGANQAQLSAA 351

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           ++ A++  + WQ +VL A++EVENAL   N D + V      VE  +++++L+  +Y  G
Sbjct: 352 QARAEQARLAWQASVLGAVEEVENALAGYNRDARAVAAQSRLVENARETVNLTRSSYELG 411

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
                 +LD ER+      +L+ A RQ A ++V L  A   G  
Sbjct: 412 EADFFPVLDAERSLLSARQELAAAVRQQALNFVALSAASAGGVG 455


>gi|116750235|ref|YP_846922.1| RND efflux system outer membrane lipoprotein [Syntrophobacter
           fumaroxidans MPOB]
 gi|116699299|gb|ABK18487.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Syntrophobacter fumaroxidans MPOB]
          Length = 497

 Score =  208 bits (530), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 136/473 (28%), Positives = 238/473 (50%), Gaps = 43/473 (9%)

Query: 14  LLAGCTVGPEYTKPHM--PLLPTQFSIGNSKNLINIDT------LKWWESFNDTSLNKLV 65
           LLAGC VGP++ +P    P   T  + G ++   ++ T      + WW++F+D  L  L+
Sbjct: 28  LLAGCMVGPDFHRPKSDPPGAYTGVTAGATRE-PSVTTGEPARLIDWWKAFDDPVLTSLI 86

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL----- 120
           + A+  NL + QA  RI  A+       + LFP   A  S+    N    S G +     
Sbjct: 87  ERAITANLDVRQAQARIRQARATRGVAASGLFPEIDAGASY----NYSRGSPGTVSSSGG 142

Query: 121 -------------------DSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKL 160
                              D+ W++D FG  RR+IE+S A+L +A        +++ +++
Sbjct: 143 GTTAAGAAATPRELFQVGFDASWELDFFGGTRRNIEASDADLKAAVEDRRDVLVSMAAEV 202

Query: 161 IPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIP 220
              Y+  R  + ++ IA + L   K    ++  ++  G  S L +   +A+  + E+ IP
Sbjct: 203 GTEYVTLRGLQAQLLIARKNLASQKHTAGITRKRWQAGFVSALDVANADAQASTTEAQIP 262

Query: 221 TLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRY 280
            LE S R  ++++  LL  P    L  +    +   P +   + +G+P+DLIR RPDIR 
Sbjct: 263 ILESSIRATIYSLGLLLAQPPAALLDELS--DDGPIPPIPPEVPVGLPSDLIRRRPDIRR 320

Query: 281 QEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD--NSFPGY-NTHWSFGPKLYLPIFDK 337
            E ++  + A+IG+A +DL+P  +L GS+ L     N+     N  WS GP +  PIF  
Sbjct: 321 TEAQVHAATARIGVATADLFPKFALTGSMGLMSADLNTLANLSNRFWSLGPTVSWPIFTA 380

Query: 338 GKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSM 397
           G+I+ NI    +  ++  + + +T+L A+K+VE ALT+  ++++    L  AV  ++K++
Sbjct: 381 GRIQCNIEVQNAVQEQTLLAYDKTILTALKDVETALTAYAKEQEHNRSLTEAVAHNRKAV 440

Query: 398 SLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            LSM  Y  G+   L++L+ +R+    E  L+++ R L  + + LY A+G G+
Sbjct: 441 DLSMRLYLVGKIDFLNVLNAQRSLYLTEEGLALSNRTLTTNLIALYKALGGGW 493


>gi|254510865|ref|ZP_05122932.1| outer membrane efflux protein [Rhodobacteraceae bacterium KLH11]
 gi|221534576|gb|EEE37564.1| outer membrane efflux protein [Rhodobacteraceae bacterium KLH11]
          Length = 519

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 135/469 (28%), Positives = 244/469 (52%), Gaps = 35/469 (7%)

Query: 13  VLLAGCTVGPEYTKPHMPLL--------PTQFSIGNSKNLINIDTLKWWESFNDTSLNKL 64
           VL A   VGP++ +P+ P++        P+    G +    +   ++WWE+FND +LNKL
Sbjct: 18  VLTACAPVGPDFVRPNSPVVKQWIEVNSPSAGQSGLTSR--SAPVVRWWETFNDPTLNKL 75

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSYA--------SIS---------HR 107
           +  A  QNLT+  A  R+  A+  +     +L+P S A         IS          R
Sbjct: 76  IAEAYAQNLTLQVAGARVLQARAQLGIAFGELYPQSQAIGGSLERRQISDNLGPIADVRR 135

Query: 108 FIPNLKTNSTGQL--DSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSY 164
            IP     ST Q+  D+ W++DL+GQ RR ++++ +NL    A  D A + +   +   Y
Sbjct: 136 IIPLDTEFSTSQVGFDAQWELDLWGQQRRGVQAARSNLALQVANYDDALVTLTGDVAALY 195

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           I+ R  +E +S+A + +D+ + + +L+ L+F  G T++L + +  A + + ++ +P LE 
Sbjct: 196 INIRSLQEALSVARENIDIQQVSADLTQLRFNNGVTTELDVQESTALLNNTKALVPQLES 255

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
                 + ++ LLG   ++    +        P     I +G+PA+L+R RPD+R  E  
Sbjct: 256 DLAQAQNALAVLLGKTPSQMAGLLGNSGRI--PAARSNIAVGVPAELLRRRPDVRAAELA 313

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFG---PKLYLPIFDKGKIK 341
            A   A++GIA +DLYP   L+GSI L        ++++ + G     +   + + G+IK
Sbjct: 314 AATQSAQVGIALADLYPQFILSGSIGLQASGGRDLFSSNSTTGLASAGVVWNVLNYGRIK 373

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           +N+R  +++ Q     +Q TVL A  EVE+A+ +  + +K VT  Q +VE  +K+  +++
Sbjct: 374 NNVRAQDAAYQALIANYQNTVLTAYSEVESAMVAYAQARKQVTFYQRSVEASRKAADIAV 433

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             YR G  S   IL+ + A  + + +L  A+++++ + V +Y  +G G+
Sbjct: 434 DQYRDGIASYSRILNTQTALLRSQANLIEARQEVSSNLVAIYKGLGGGW 482


>gi|301057385|ref|ZP_07198502.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [delta proteobacterium NaphS2]
 gi|300448528|gb|EFK12176.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [delta proteobacterium NaphS2]
          Length = 514

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 136/472 (28%), Positives = 240/472 (50%), Gaps = 37/472 (7%)

Query: 4   LRAIFSLFIVLLAGCT-VGPEYTKPHMPLLPTQFSIGNSKNLINIDT-----LKWWESFN 57
           L+A+F   + LLA C  VGP+Y  P  P  P Q+       L+  D        WW +F+
Sbjct: 9   LKALF--LMTLLAACAPVGPDYVPPE-PDAPKQWDTPLKGGLVEKDNDNNALSTWWNAFD 65

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS--------HRFI 109
           D  L  LV+ A+  NL +  A  R+  A+       A L P+   + S         R+ 
Sbjct: 66  DPLLTDLVERAVSGNLDLKSARSRVREARAGRGISEAGLVPAVDVAASATRNRLSEDRYG 125

Query: 110 PNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
            +     +   D+ W+ID+FG  RR +E++ A+L++    +    ++++S++  +Y+D R
Sbjct: 126 GDEYNLYSAGFDAGWEIDVFGGIRRSVEAATADLEAEEETLRDVMVSLLSEVALNYLDVR 185

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
             +  I +A   L+  +++  L+  ++  G T++LS+ +    ++S  S IP L  +   
Sbjct: 186 TIQLGIEVAVHNLEAQERSYRLALSRYEAGLTNELSVQQARYNMESTRSQIPLLRTALAA 245

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPI-------NIGIPADLIRNRPDIRYQ 281
            ++ +S LLG         +Q  + N Q   + PI       ++G+PA+ +RNRPDIR  
Sbjct: 246 AMNRLSVLLG---------LQPGALNGQLKEHAPIPVPPLKVSVGVPAEALRNRPDIRRA 296

Query: 282 EKKLADSVAKIGIAKSDLYPSLSLNGSIAL---THDNSFPGYNTHWSFGPKLYLPIFDKG 338
           E++LA   A++G A +DLYP  SL GSI L   +  + F      +  GP +  P+FD G
Sbjct: 297 ERQLAAQTARVGTATADLYPKFSLVGSIGLETLSLGDVFSASGLAYLIGPSVTWPVFDAG 356

Query: 339 KIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMS 398
            I+SNI+      ++  I ++  +L A++EVENAL +  +++  +  L+ + +  ++++S
Sbjct: 357 AIRSNIQVQTERQKQALIQYEYAILAALEEVENALVAYADEQNRMKALEASTDAAERAVS 416

Query: 399 LSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           LS   YR G      +LD +R+    +  L+ +K  +  + V LY A+G G+
Sbjct: 417 LSQSQYRAGLTDFTSVLDAQRSLLSFQEQLAQSKGNVTSNLVRLYKALGGGW 468


>gi|78355447|ref|YP_386896.1| RND efflux system, outer membrane lipoprotein, NodT [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
 gi|78217852|gb|ABB37201.1| RND efflux system, outer membrane lipoprotein, NodT [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
          Length = 494

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 142/478 (29%), Positives = 242/478 (50%), Gaps = 41/478 (8%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHM--PLLPTQFSIGNSKNLINIDTL--KWWESFN 57
           N L A   L IV   GC VGP+YT P +  P       +   +   N  T   +WW+   
Sbjct: 13  NGLLASALLTIVFAGGCAVGPDYTAPELDSPAAWRTEDVSGLRQTRNATTALSQWWKVLE 72

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST 117
           D  L+ L++ A+  NL + +A  R+ AA+  +    ADL+P+  AS S          ST
Sbjct: 73  DPMLDSLMQRAVTGNLDLKEARARVRAARARLGISEADLYPTLDASGSL---------ST 123

Query: 118 GQ------------------LDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVIS 158
           GQ                   D+ W+ID+FG  RR +E++ A L+++ A +    +++++
Sbjct: 124 GQQSENAGYDGKERDLYKAGFDAGWEIDIFGGTRRAVEAAGAELEASEADLRDVYVSMLA 183

Query: 159 KLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESD 218
           ++  +Y+D R ++ R+S+A   L+  K+  E+   ++  G +  L + +    ++S  ++
Sbjct: 184 EIASTYVDVRTYQTRLSVAQANLEEQKETYEIVASRYDSGLSDALGVQQARYSLESTRAE 243

Query: 219 IPTLEKSFRMNVHNISTLLGY-PATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPD 277
           IP L+      ++ ++ LLG  P T     + ++     P   + + +GIPAD +RNRPD
Sbjct: 244 IPALQSKLDAAINRLALLLGQQPDTLHAELITRRPIPMPP---VSVAVGIPADALRNRPD 300

Query: 278 IRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIAL---THDNSFPGYNTHWSFGPKLYLPI 334
           IR  E+ LA   A++G+A ++LYP   L GSI L      + F   +  +SFGP +  PI
Sbjct: 301 IRMAERTLAARTAEVGVATAELYPKFRLVGSIGLESFAQSSLFESGSQVYSFGPGISWPI 360

Query: 335 FDKGKIKSNIRRAESSAQEQYI-TWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELH 393
           F  G I+ NI  AE + QEQY+  +Q TVL A+ E + A+T   +++     LQ A    
Sbjct: 361 FRAGAIRRNIDVAE-AVQEQYLHRYQHTVLAALNEAQTAMTDYAKEQNRRDALQAATLAA 419

Query: 394 KKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           ++++ L+   Y  G     D+L+  R+    E  L+++K  +  S V +Y ++G G+ 
Sbjct: 420 REALELAQDKYLNGLVDFSDVLEARRSLLSYEDQLAVSKGAVVDSLVRIYKSMGGGWQ 477


>gi|330987296|gb|EGH85399.1| outer membrane efflux protein [Pseudomonas syringae pv. lachrymans
           str. M301315]
          Length = 465

 Score =  206 bits (523), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 137/464 (29%), Positives = 239/464 (51%), Gaps = 30/464 (6%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL--INIDTLKWWESFNDTSLNKLVK 66
           SL ++ LA C VGP+Y  P     P Q +     N     +DT+ WW+ F D +LNKLV 
Sbjct: 10  SLLVMALAACAVGPDYKAPVTA--PAQLASAAQGNYDRSKVDTV-WWQQFEDPTLNKLVA 66

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL-KTNSTG------- 118
            +L  N  +  A  R+ AA+    ++R D+   +   I+ R   +L K    G       
Sbjct: 67  RSLDGNRDLRVAFARLKAAR----AIRDDVANDAMPVITSRASSDLGKGQQPGVTERRVN 122

Query: 119 ------QLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
                  LD  W++DLFG+ +R +E+S A+ ++A A +   ++ +I++++ +Y   R  +
Sbjct: 123 SERYDLGLDMAWEVDLFGRIQRQLEASDADQEAAEANLYQLQVTLIAEVVDAYGQLRGAQ 182

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
            R +IA   L   + + +++      G  ++L +V+ EA + ++E+ +P L+       +
Sbjct: 183 LREAIARDNLKNQQSSQDVTTQLRDAGVGNELDVVRAEARLAAVEATVPQLQAEQVRQRN 242

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
            I+TLLG         +   S +  P +   + IG P  ++RNRPDIR  E++LA S A+
Sbjct: 243 RIATLLGERPENLSVDL---SPSKLPAIAKALPIGDPTQVLRNRPDIRAAERQLAASTAR 299

Query: 292 IGIAKSDLYPSLSLNGSIALTHD-NSFPGYNTH--WSFGPKLYLPIFDKGKIKSNIRRAE 348
           IG+A +DL+P +SLNG +  T    S  G +    WS GP +    FD G +++ IR A+
Sbjct: 300 IGVATADLFPRVSLNGFLGFTAGRGSQIGSSAAKAWSLGPSITWAAFDLGSVRAQIRSAD 359

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           + A+     +++ VL A++E ENA +  ++ ++ +  L    +  + +  L+ + YR+G 
Sbjct: 360 ADAEGALANYEQQVLLALEESENAFSDYDKRQQRLVSLMRQSDASRSAARLASVQYREGT 419

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
              L +LD ER     E   + A+ +L +  V +Y A+G G+ P
Sbjct: 420 ADFLVLLDAERERLAAEDSQAQAEIELYRGIVAIYKALGGGWQP 463


>gi|39935443|ref|NP_947719.1| outer membrane protein [Rhodopseudomonas palustris CGA009]
 gi|39649295|emb|CAE27815.1| possible outer membrane protein [Rhodopseudomonas palustris CGA009]
          Length = 509

 Score =  206 bits (523), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 118/400 (29%), Positives = 203/400 (50%), Gaps = 31/400 (7%)

Query: 10  LFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIAL 69
           L  V+L GC VGP+Y +P +   P Q+S             +WW    D +L++LV  A+
Sbjct: 80  LVAVMLGGCAVGPDYRRPLL-ATPAQWSRAGVATPAPPVLPRWWTRLRDPTLDRLVVEAV 138

Query: 70  QQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI------------PNLKTNST 117
             NL +  A+ R+  A+ +       L P+   + S R              PNL   S+
Sbjct: 139 DGNLDVATASARVREARASYRQAVGALLPTIANTESARLAKGTGVASAAPGRPNLGGPSS 198

Query: 118 ------------GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSY 164
                          D+ W++DLFG  RR +E++   +D++   +    L ++  +  SY
Sbjct: 199 VVGSDGTSGLYQAGFDASWELDLFGANRRAVEAAAYGIDASDENLRAVLLTLVGDVASSY 258

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           ++AR ++ RI++A +      +  +++  +   G  S + L     +  +  + IPTLE 
Sbjct: 259 VEARGYQARIALARRTATSQDETTKITRNRLAAGTGSAVDLATATGQAAATRAAIPTLET 318

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
           ++   VH +S L G P +     + +      P L  P+  GIPAD++  RPD+R  E++
Sbjct: 319 AYAQTVHRLSVLTGRPPSALSALLARPKPIPAPKL--PVPAGIPADVLLTRPDVRLAERR 376

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIALTHDN-SFPGYNT--HWSFGPKLYLPIFDKGKIK 341
            A S A+IG A++ LYPS+SL G+IA +       G N+   WS GP L +PIF+ GK++
Sbjct: 377 YAQSTARIGQAEAALYPSVSLAGNIATSGTKLGDLGRNSSISWSLGPTLTVPIFNGGKLR 436

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKK 381
           + +  AE+   +Q++ +Q +VL A+K+VE+AL S++ + +
Sbjct: 437 AAVEIAEAQRDQQFLAYQASVLTALKDVEDALVSLSNEHR 476


>gi|154246392|ref|YP_001417350.1| RND efflux system outer membrane lipoprotein [Xanthobacter
           autotrophicus Py2]
 gi|154160477|gb|ABS67693.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Xanthobacter autotrophicus Py2]
          Length = 514

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 136/465 (29%), Positives = 229/465 (49%), Gaps = 22/465 (4%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIG-NSKNLINIDTLKWWESFNDTSLNKL 64
           A   L  ++L+GC VGP Y  P +  +P  +S G  ++  +     +WW    D  L+ L
Sbjct: 25  AAGPLAALVLSGCAVGPGYETPQL-AMPDHWSSGRGARAEVAPQLQRWWRRLGDGVLDGL 83

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQ----- 119
           ++ A+  NL +  A  ++ AA+         LFP    + S     N     +G      
Sbjct: 84  MEEAVAGNLDVATAKAKVRAARATYREQVGALFPQVTGNASATRGDNGGNVGSGGDVTVA 143

Query: 120 ---------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                    LD+ W+IDLFG  RR +E++    D+A   +D A + ++  +  +YIDAR 
Sbjct: 144 STYGQYQAGLDASWEIDLFGANRRGVEAAAYGSDAAVDDLDAALVTLVGDVATNYIDARG 203

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
           ++ RI++A +     ++   L+  K   G  S L       +  S E+DIP LE ++  +
Sbjct: 204 YQARIALARRTASAQRETAALTRRKLDAGGASALDAANAAGQAASTEADIPELEAAYAQS 263

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
           VH +S L G         +++      P L  P+  GIPA ++  RPD+R  E++L  S 
Sbjct: 264 VHRLSVLTGREPAALTGRLERPRAVPAPRL--PVPKGIPAQVLTARPDVRAAERRLGQST 321

Query: 290 AKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           A +G A ++ YPS+SL G++  T     +   G +  WSFGP L +PIF  G++K+    
Sbjct: 322 ALVGQATANRYPSISLAGTLNTTGTQLGDLARGSSISWSFGPTLTVPIFTGGQLKAAQEL 381

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
           AE+   + ++ ++  VL A+++VENA  S+ + +    +L  +   ++++  LS   Y  
Sbjct: 382 AEAERDQSFLAYRAAVLTALEDVENASVSLGKQRLKAGRLAASAASYREAGRLSHALYGA 441

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           G  S LD+L  ER+    E  L  ++  +A  YV L  A+G G++
Sbjct: 442 GSSSFLDVLTAERSLYAAETALIESRVAVATYYVALNKALGGGWD 486


>gi|217976817|ref|YP_002360964.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Methylocella silvestris BL2]
 gi|217502193|gb|ACK49602.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Methylocella silvestris BL2]
          Length = 569

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 128/459 (27%), Positives = 239/459 (52%), Gaps = 26/459 (5%)

Query: 18  CTVGPEYTKPHMPLLPTQFSIGN-SKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTIL 76
           C VGP++  P  P+ P      N + +    D   WW +F+D +L++L++IA QQNLT+L
Sbjct: 51  CAVGPDFVPPGAPVAPKYLESRNKAVDSSRQDYRDWWRAFHDPALDRLIEIAYQQNLTLL 110

Query: 77  QATERINAAKENILSVRADLFP--------SSYASISHRFI---PNLKTNSTGQ----LD 121
            A  R+  A+  +     +L+P        ++Y   SH      P L+ N+  Q    + 
Sbjct: 111 SAGTRVLQARAQLGVAIGELYPQQQQGLGLTTYNRPSHADAAANPQLQLNNFWQSQLGVR 170

Query: 122 SDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI 180
           + W++D +G+ RR +ES+ A   ++ A  D   + ++  +  +YI  R  ++RI+IA   
Sbjct: 171 AAWELDFWGKFRRGVESADAAYLASIASYDEVLVTLLGDVARTYIGVRTLEKRIAIARAN 230

Query: 181 LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP 240
           +   K+ ++++  +F  GA++KL + + E  +   E+ +P L +  +  ++ +  LLG  
Sbjct: 231 IVRQKEAVQVARDRFAGGASTKLDVYQAENVLGQTEASVPQLTQQLQQGLNALRVLLGL- 289

Query: 241 ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLY 300
             E +  + + S    P     I +GIPADL+R RPD+R  E + A   A+IG+A+++LY
Sbjct: 290 TPEPIESLLRGSTGKIPVAPPKIFVGIPADLLRRRPDVRAAELQAAAQSAQIGVAQAELY 349

Query: 301 PSLSLNGSIALTHD--------NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQ 352
           P+L+L G I  +          + F      +SFGP     I + G+I +N+R  +++ Q
Sbjct: 350 PALTLTGRIGGSASTINGAKLSSIFTPAGLAYSFGPSFQWNILNYGQITNNVRLQDATLQ 409

Query: 353 EQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLL 412
           +  + +Q TVL A ++VEN ++   + +     L+ +V     ++ +S++ Y+QG     
Sbjct: 410 QYLVDYQNTVLKAQQDVENGISGYLQSRLATAALRRSVAAANGALGISLLEYQQGTRDFT 469

Query: 413 DILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            +L  E+   + + DL+IA+  +  +   +Y A+G G+ 
Sbjct: 470 SVLTSEQNLLQAQNDLAIAEGDIPLAVTAVYAALGGGWQ 508


>gi|260434003|ref|ZP_05787974.1| outer membrane efflux protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417831|gb|EEX11090.1| outer membrane efflux protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 529

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 135/474 (28%), Positives = 249/474 (52%), Gaps = 35/474 (7%)

Query: 9   SLFIVLLAGCT-VGPEYTKPHMPLLPTQFSIGNSKNLINIDTL--------KWWESFNDT 59
           +L   LL  CT VGP++ +P+ P++  Q+   NS +      L        KWW+SFND 
Sbjct: 22  ALSAALLIACTPVGPDFVRPNSPVV-KQWMEANSPSASQTSGLTSRSAPVVKWWQSFNDP 80

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYA--------SIS------ 105
           +LNKLV  A  QNLT+  A  R+  A+  +     +L+P S A         IS      
Sbjct: 81  TLNKLVAEAYAQNLTLQVAGARVLQARAQLGIAFGELYPQSQAVGGALEQRRISDNLGPI 140

Query: 106 ---HRFIPNLKTNSTGQL--DSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISK 159
              +R IP     ST Q+  D+ W++D++G QRR ++++ +NL    A  D A + +   
Sbjct: 141 ADINRIIPLDTEFSTSQVGFDAQWELDVWGAQRRGVQAARSNLALQVANYDDALVTLTGD 200

Query: 160 LIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDI 219
           +   Y++ R  +E +++A + + L ++  +L+ L+F  G T++L + +  A + + ++ +
Sbjct: 201 VAALYMNIRALQESLAVARENIKLQQEANDLTQLRFKNGVTTELDVQESTALLNNTKALV 260

Query: 220 PTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIR 279
           PTLE   +   + ++ LLG   +     +   ++   P     + +G+PA+L+R RPD+R
Sbjct: 261 PTLESDLQQAKNALAVLLGTTPSRMTGLLG--TSGRIPVARSNVAVGVPAELLRRRPDVR 318

Query: 280 YQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFG---PKLYLPIFD 336
             E   A   A++GIA +DLYP   L+GSI L        ++++ + G     +   + +
Sbjct: 319 AAELAAATQSAQVGIAMADLYPQFILSGSIGLQASGGRDLFSSNSTTGLASAGVVWNVLN 378

Query: 337 KGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKS 396
            G+IK+N+R  +++ Q     +Q TVL A  EVE+A+ +  + +K VT  Q + +  +K+
Sbjct: 379 YGRIKNNVRAQDAAYQALIANYQNTVLTAYSEVESAMVAYAQARKQVTFYQRSADAARKA 438

Query: 397 MSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             +++  Y+ G      +L+ + A  + +V+L  A++Q++ + V +Y  +G G+
Sbjct: 439 ADIAVSQYQDGIADYSRVLNTQTALLRAQVNLIEARQQVSSNLVAIYKGLGGGW 492


>gi|71736781|ref|YP_274480.1| outer membrane efflux protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71557334|gb|AAZ36545.1| outer membrane efflux protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 465

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 144/476 (30%), Positives = 247/476 (51%), Gaps = 37/476 (7%)

Query: 1   MNILRAIF-SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL--INIDTLKWWESFN 57
           M+  +  F SL ++ LA C VGP+Y  P    +P Q +     N     +DT+ WW+ F 
Sbjct: 1   MSAFKLFFPSLLVMALAACAVGPDYKAPVT--VPAQLASAAQGNYDRSKVDTV-WWQQFE 57

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKE----------NILSVRA--DLFPSSYASIS 105
           D +LNKLV  +L  N  +  A  R+ AA+            +++ RA  DL       ++
Sbjct: 58  DPTLNKLVARSLDGNRDLRVAFARLKAARAIRDDVANDAMPVITSRASSDLGKGQQPGVT 117

Query: 106 HRFIPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSY 164
            R + N +    G LD  W++DLFG+ +R +E+S A+ ++A A +   ++ +I++++ +Y
Sbjct: 118 ERRV-NSERYDLG-LDMAWEVDLFGRIQRQLEASDADQEAAEANLYQLQVTLIAEVVDAY 175

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQ----GATSKLSLVKLEAEIKSIESDIP 220
              R  + R +IA   L    KN + S    TQ    G  ++L +V+ EA + ++E+ +P
Sbjct: 176 GQLRGAQLREAIARDNL----KNQQSSQDVTTQLRDAGVGNELDVVRAEARLAAVEATVP 231

Query: 221 TLEKSFRMNVHNISTLLG-YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIR 279
            L+       + I+TLLG  P    +      S +  P +   + IG P  ++RNRPDIR
Sbjct: 232 QLQAEQVRQRNRIATLLGERPGNLSVDL----SPSKLPAIAKALPIGDPTQVLRNRPDIR 287

Query: 280 YQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD-NSFPGYNTH--WSFGPKLYLPIFD 336
             E++LA S A+IG+A +DL+P +SL+G +  T    S  G +    WS GP +    FD
Sbjct: 288 AAERQLAASTARIGVATADLFPRVSLSGFLGFTAGRGSQIGSSAAKAWSLGPSITWAAFD 347

Query: 337 KGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKS 396
            G +++ IR A++ A+     +++ VL A++E ENA +  ++ ++ +  L    +  + +
Sbjct: 348 LGSVRAQIRSADADAEGALANYEQQVLLALEESENAFSDYDKRQQRLVSLMRQSDASRSA 407

Query: 397 MSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
             L+ + YR+G    L +LD ER     E   + A+ +L +  V +Y A+G G+ P
Sbjct: 408 ARLASVQYREGTADFLVLLDAERERLAAEDSQAQAEIELYRGIVAIYKALGGGWQP 463


>gi|282890149|ref|ZP_06298680.1| hypothetical protein pah_c013o060 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281500000|gb|EFB42288.1| hypothetical protein pah_c013o060 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 475

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 148/478 (30%), Positives = 237/478 (49%), Gaps = 38/478 (7%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQF--SIGNSKNLINIDTLKWWESFND 58
           M +++A+F L  V L GCTVGP+Y  P M + PTQ+  +     N   +D   WW+S ND
Sbjct: 1   MKMIKALFFL-SVFLGGCTVGPKYEPPGMEM-PTQWHSTTEEGMNAEPLDCFLWWKSLND 58

Query: 59  TSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS------------------- 99
             LN L++ A  QNL +  A  RI  A+     + A L+P                    
Sbjct: 59  PLLNSLIEQASLQNLDVQIAISRILEARAAKKGISAQLYPHIDGTINYGHVQYNNKILKD 118

Query: 100 --SYASISHRFIPNLKTNSTGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNV 156
               + I H    N+     G  D++W+IDLFG+  H + ++ A + S+   +    +++
Sbjct: 119 ILGASCIDHHRKRNVNFFEIG-FDAEWEIDLFGKTTHELNAARAEIGSSIESLRDLMVSL 177

Query: 157 ISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE 216
            +++  +YI+ R  +  + IA   +   K+   L+   F  G TS +   + E ++  +E
Sbjct: 178 TAEIAKNYIEIRGSQHLLDIAKSHIQTQKETTLLTTGLFEAGFTSIIDQWQTEEQLMLLE 237

Query: 217 SDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRP 276
           S+IP LE S    +H +S LLG P  E    +++  +  +   Y P+  GIP+ L+RNRP
Sbjct: 238 SEIPMLELSIEKGIHRLSILLGRPPAELFCVLREHHDLPELPHYKPL--GIPSALLRNRP 295

Query: 277 DIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIA--LTH--DNSFPGYNTHWSFGPKLYL 332
           DIR  E+ LA S  K+G A +DL+P  SL G I    TH   +SF      W  GP+L  
Sbjct: 296 DIRRAERNLAASTEKVGSAMADLFPRFSLRGFIGDVATHLSRSSFV-----WFAGPQLLA 350

Query: 333 PIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVEL 392
           PIF+   I+ +I   +   Q+    +Q+TVL A++E EN + S + + +   KL  A++ 
Sbjct: 351 PIFNSKLIQQDIDLNKIKTQQALYQYQKTVLEALEETENTIASYHHELEHNRKLFSAMQF 410

Query: 393 HKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             +S +     Y+ G    L++L  +R+    E     +K QL   Y+ LY A+G G+
Sbjct: 411 SGESYNQLFHLYQTGFKGYLEVLVSQRSLLSTENAFLKSKIQLLMHYISLYKALGGGW 468


>gi|330890399|gb|EGH23060.1| outer membrane efflux protein [Pseudomonas syringae pv. mori str.
           301020]
          Length = 465

 Score =  204 bits (518), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 136/462 (29%), Positives = 240/462 (51%), Gaps = 26/462 (5%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL--INIDTLKWWESFNDTSLNKLVK 66
           +L ++ LA C VGP+Y  P     P Q +     N     +DT+ WW+ F D +LNKLV 
Sbjct: 10  TLLVMALAACAVGPDYKAPVTA--PAQLASAAQGNYDRSKVDTV-WWQQFEDPNLNKLVA 66

Query: 67  IALQQNLTILQATERINAAKE----------NILSVRA--DLFPSSYASISHRFIPNLKT 114
            +L  N  +  A  R+ AA+            +++ RA  DL       ++ R + N + 
Sbjct: 67  RSLDGNRDLRVAFARLKAARAIRDDVANDAMPVITSRASSDLGKGQQPGVTERRV-NSER 125

Query: 115 NSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
              G LD  W++DLFG+ +R +E+S A+ ++A A +   ++ +I++++ +Y   R  + R
Sbjct: 126 YDLG-LDMAWEVDLFGRIQRQLEASNADQEAAEANLYQLQVTLIAEVVDAYGQLRGAQLR 184

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
            +IA   L   + + +++      G  ++L +V+ EA + ++E+ +P L+       + I
Sbjct: 185 EAIARDNLKNQQSSQDVTTQLRDAGVGNELDVVRAEARLAAVEATVPQLQAEQVRQRNRI 244

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
           +TLLG         +   S N  P +   + IG P  ++RNRPDIR  E++LA S A+IG
Sbjct: 245 ATLLGERPENLSVDL---SPNKLPAIAKALPIGDPTQVLRNRPDIRAAERQLAASTARIG 301

Query: 294 IAKSDLYPSLSLNGSIALTHD-NSFPGYNTH--WSFGPKLYLPIFDKGKIKSNIRRAESS 350
           +A +DL+P +SL+G +  T    S  G +    WS GP +    FD G +++ IR A++ 
Sbjct: 302 VAPADLFPRVSLSGFLGFTAGRGSQIGSSAAKAWSLGPSITWAAFDLGSVRAQIRSADAD 361

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
           A+     +++ VL A++E ENA +  ++ ++ +  L    +  + +  L+ + YR+G   
Sbjct: 362 AEGALANYEQQVLLALEESENAFSDYDKRQQRLVSLMRQSDASRSAARLASVQYREGTAD 421

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            L +LD ER     E   + A+ +L +  V +Y A+G G+ P
Sbjct: 422 FLVLLDAERERLAAEDSQAQAEIELYRGIVAIYKALGGGWQP 463


>gi|331010986|gb|EGH91042.1| outer membrane efflux protein [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 465

 Score =  204 bits (518), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 141/466 (30%), Positives = 241/466 (51%), Gaps = 34/466 (7%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL--INIDTLKWWESFNDTSLNKLVK 66
           SL ++ LA C VGP+Y  P     P Q +     N     +DT+ WW+ F D +LNKLV 
Sbjct: 10  SLLVMALAACAVGPDYKAPVTA--PAQLASAAQGNYDRSKVDTV-WWQQFEDPTLNKLVA 66

Query: 67  IALQQNLTILQATERINAAKE----------NILSVRA--DLFPSSYASISHRFIPNLKT 114
            +L  N  +  A  R+ AA+            +++ RA  DL       ++ R + N + 
Sbjct: 67  RSLDGNRDLRVAFARLKAARAIRDDVANDAMPVITSRASSDLGKGQQPGVTERRV-NSER 125

Query: 115 NSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
              G LD  W++DLFG+ +R +E+S A+ ++A A +   ++ +I++++ +Y   R  + R
Sbjct: 126 YDLG-LDMAWEVDLFGRIQRQLEASDADQEAAEANLYQLQVTLIAEVVDAYGQLRGAQLR 184

Query: 174 ISIAHQILDLYKKNIELSHLKFTQ----GATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
            +IA   L    KN + S    TQ    G  ++L +V+ EA + ++E+ +P L+      
Sbjct: 185 EAIARDNL----KNQQSSQDVTTQLRDAGVGNELDVVRAEARLAAVEATVPQLQAEQVRQ 240

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            + I+TLLG         +   S +  P +   + IG P  ++RNRPDIR  E++LA S 
Sbjct: 241 RNRIATLLGERPENLSVDL---SPSKLPAIAKALPIGDPTQVLRNRPDIRAAERQLAAST 297

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHD-NSFPGYNTH--WSFGPKLYLPIFDKGKIKSNIRR 346
           A+IG+A +DL+P +SL+G +  T    S  G +    WS GP +    FD G +++ IR 
Sbjct: 298 ARIGVATADLFPRVSLSGFLGFTAGRGSQIGSSAAKAWSLGPSITWAAFDLGSVRAQIRS 357

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
           A++ A+     +++ VL A++E ENA +  ++ ++ +  L    +  + +  L+ + YR+
Sbjct: 358 ADADAEGALANYEQQVLLALEESENAFSDYDKRQQRLVSLMRQSDASRSAARLASVQYRE 417

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           G    L +LD ER     E   + A+ +L +  V +Y A+G G+ P
Sbjct: 418 GTADFLVLLDAERERLAAEDSQAQAEIELYRGIVAIYKALGGGWQP 463


>gi|289646316|ref|ZP_06477659.1| outer membrane efflux protein [Pseudomonas syringae pv. aesculi
           str. 2250]
 gi|330869642|gb|EGH04351.1| outer membrane efflux protein [Pseudomonas syringae pv. aesculi
           str. 0893_23]
          Length = 465

 Score =  204 bits (518), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 136/462 (29%), Positives = 240/462 (51%), Gaps = 26/462 (5%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL--INIDTLKWWESFNDTSLNKLVK 66
           SL ++ LA C VGP+Y  P     P Q +     N     +DT+ WW+ F D +LNKLV 
Sbjct: 10  SLLVMALAACAVGPDYKAPVTA--PAQLASAAQGNYDRSKVDTV-WWQQFEDPTLNKLVA 66

Query: 67  IALQQNLTILQATERINAAKE----------NILSVRA--DLFPSSYASISHRFIPNLKT 114
            +L  N  +  A  R+ AA+            +++ RA  DL       ++ R + N + 
Sbjct: 67  RSLDGNRDLRVAFARLKAARAIRDDVANDAMPVITSRASSDLGKGQQPGVTERRV-NSER 125

Query: 115 NSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
              G LD  W++DLFG+ +R +E+S A+ ++A A +   ++ +I++++ +Y   R  + R
Sbjct: 126 YDLG-LDMAWEVDLFGRIQRQLEASNADQEAAEANLYQLQVTLIAEVVDAYGQLRGAQLR 184

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
            +IA   L   + + +++      G  ++L +V+ EA + ++E+ +P L+       + I
Sbjct: 185 EAIARDNLKNQQSSQDVTTQLRDAGVGNELDVVRAEARLAAVEATVPQLQAEQVRQRNRI 244

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
           +TLLG         +   S +  P +   + IG P  ++RNRPDIR  E++LA S A+IG
Sbjct: 245 ATLLGERPENLSVDL---SPSKLPAIAKALPIGDPTQVLRNRPDIRAAERQLAASTARIG 301

Query: 294 IAKSDLYPSLSLNGSIALTHD-NSFPGYNTH--WSFGPKLYLPIFDKGKIKSNIRRAESS 350
           +A +DL+P +SL+G +  T    S  G +    WS GP +    FD G +++ IR A++ 
Sbjct: 302 VATADLFPRVSLSGFLGFTAGRGSQIGSSAAKAWSLGPSITWAAFDLGSVRAQIRSADAD 361

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
           A+     +++ VL A++E ENA +  ++ ++ +  L    +  + +  L+ + YR+G   
Sbjct: 362 AEGALANYEQQVLLALEESENAFSDYDKRQQRLVSLMRQSDASRSAARLASVQYREGTAD 421

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            L +LD ER     E   + A+ +L +  V +Y A+G G+ P
Sbjct: 422 FLVLLDAERERLAAEDSQAQAEIELYRGIVAIYKALGGGWQP 463


>gi|49474725|ref|YP_032767.1| hypothetical protein BQ12400 [Bartonella quintana str. Toulouse]
 gi|49240229|emb|CAF26699.1| hypothetical protein BQ12400 [Bartonella quintana str. Toulouse]
          Length = 494

 Score =  203 bits (517), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 128/454 (28%), Positives = 229/454 (50%), Gaps = 14/454 (3%)

Query: 10  LFIVLLAGCTVGPEYTKP--HMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKI 67
           L   +L+GC VGP Y K    +P +  Q S   +++ + +    WW   +D  LN L+  
Sbjct: 20  LCFFILSGCMVGPNYHKTFFRVPAVWGQKSAQIAEHPVAL--AGWWWRLDDPVLNVLINY 77

Query: 68  ALQQNLTILQATERINAAKENILSVRADLFPSSYASISH-RFIPNLKTNSTGQ----LDS 122
           A+  N ++  A  R+  A+  +      L P+   SIS  R        S  Q     D+
Sbjct: 78  AISGNNSVAVAKARVREARAGLGQAVGFLLPNVSNSISGIRSASGQSDASLSQYRSGFDA 137

Query: 123 DWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQIL 181
            W++D FG  +R +E+S    ++    +    + ++  +  +Y+  R +++++ I  QI 
Sbjct: 138 SWELDFFGGHKRAVEASHYGFEATVEDMRATMVTLLGDVATNYVQMRGWQQKLLIVQQIA 197

Query: 182 DLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPA 241
              +K  EL   +   G  S+L +   +A++ + E+DI  +E +  M++H +S L G   
Sbjct: 198 LSQRKTYELMCARLKAGDVSELDVSNSQAQMANTEADISQMEANLEMSIHRLSVLTGRVP 257

Query: 242 TEFLHYMQKQSNNFQ-PNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLY 300
           T     +QK +   + P    PI  GIPAD++  RPD+R  E++ A + A+IG  ++D Y
Sbjct: 258 TALKDLLQKNAKQAKIPQPKWPIAAGIPADILLTRPDLRRAERQYAQATARIGQREADRY 317

Query: 301 PSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYIT 357
           PSL+L G+I   A   D  +      WSFGP L  P F+ G+I +++  A +   + +IT
Sbjct: 318 PSLTLTGTISTAATAIDQLWKNSTIGWSFGPGLRFPFFNGGQIVASVAVARAQRDQAFIT 377

Query: 358 WQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDI 417
           ++  VL A+++VENAL  +  + + + KL  A +    S+ L+   +  G  S L++L+ 
Sbjct: 378 YRAAVLGALEDVENALVKLKNEHQRLEKLIVANKASLHSLQLARRLFENGNTSFLELLNA 437

Query: 418 ERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +R+    ++ L  ++  L   Y+ L  A+G G++
Sbjct: 438 DRSYYSAQMALKDSRVSLVIQYIALMKALGGGWD 471


>gi|298486818|ref|ZP_07004874.1| Outer membrane protein of RND family multidrug efflux pump
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|298158685|gb|EFH99749.1| Outer membrane protein of RND family multidrug efflux pump
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
          Length = 465

 Score =  203 bits (517), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 136/462 (29%), Positives = 240/462 (51%), Gaps = 26/462 (5%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLIN--IDTLKWWESFNDTSLNKLVK 66
           SL ++ LA C VGP+Y  P     P Q +     N     +DT+ WW+ F D +LNKLV 
Sbjct: 10  SLLVMALAACAVGPDYKAPVTA--PAQLASAAQGNYDRGKVDTV-WWQQFEDPTLNKLVA 66

Query: 67  IALQQNLTILQATERINAAKE----------NILSVRA--DLFPSSYASISHRFIPNLKT 114
            +L  N  +  A  R+ AA+            +++ RA  DL       ++ R + N + 
Sbjct: 67  RSLDGNRDLRVAFARLKAARAIRDDVANDAMPVITSRASSDLGKGQQPGVTERRV-NSER 125

Query: 115 NSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
              G LD  W++DLFG+ +R +E+S A+ ++A A +   ++ +I++++ +Y   R  + R
Sbjct: 126 YDLG-LDMAWEVDLFGRIQRQLEASNADQEAAEANLYQLQVTLIAEVVDAYGQLRGAQLR 184

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
            +IA   L   + + +++      G  ++L +V+ EA + ++E+ +P L+       + I
Sbjct: 185 EAIARDNLKNQQSSQDVTTQLRDAGVGNELDVVRAEARLAAVEATVPQLQAEQVRQRNRI 244

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
           +TLLG         +   S +  P +   + IG P  ++RNRPDIR  E++LA S A+IG
Sbjct: 245 ATLLGERPENLSVDL---SPSKLPAIAKALPIGDPTQVLRNRPDIRAAERQLAASTARIG 301

Query: 294 IAKSDLYPSLSLNGSIALTHD-NSFPGYNTH--WSFGPKLYLPIFDKGKIKSNIRRAESS 350
           +A +DL+P +SL+G +  T    S  G +    WS GP +    FD G +++ IR A++ 
Sbjct: 302 VATADLFPRVSLSGFLGFTAGRGSQIGSSAAKAWSLGPSITWAAFDLGSVRAQIRSADAD 361

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
           A+     +++ VL A++E ENA +  ++ ++ +  L    +  + +  L+ + YR+G   
Sbjct: 362 AEGALANYEQQVLLALEESENAFSDYDKRQQRLVSLMRQSDASRSAARLASVQYREGTAD 421

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            L +LD ER     E   + A+ +L +  V +Y A+G G+ P
Sbjct: 422 FLVLLDAERERLAAEDSQAQAEIELYRGIVAIYKALGGGWQP 463


>gi|330959921|gb|EGH60181.1| RND efflux system outer membrane lipoprotein [Pseudomonas syringae
           pv. maculicola str. ES4326]
          Length = 469

 Score =  203 bits (516), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 129/471 (27%), Positives = 235/471 (49%), Gaps = 32/471 (6%)

Query: 5   RAIFSLFIVLLAGCTVGPEYTKPHMPLLPT--QFSIGNSKNLINIDTLKWWESFNDTSLN 62
           R +  + +  L  C+VGP++  P  P LP   Q +I     L      +WW+   D+ L 
Sbjct: 3   RTLLFMALACLGACSVGPDFHAPR-PELPETWQANIQPGSTLTGKADSQWWQQLGDSQLT 61

Query: 63  KLVKIALQQNLTILQATERINAAK--------ENILSVRADLFPSSYASISHRFIPNLKT 114
            LV+ A + N  +  A+ R+  ++        E +  V A+    +Y    +  + NL  
Sbjct: 62  TLVERAAKANFDVRMASNRLEQSRLMRQVTGSEQLPGVSAN---GAYKRARNSSVGNLDE 118

Query: 115 NS----------TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPS 163
           +           +G +D+ W++DL+G  RR+IE++ A +    AQ D   L++ ++   +
Sbjct: 119 SGLEGQAPFELWSGAIDASWELDLWGHVRRNIEAADAEVALTQAQRDGVLLSIAAETASN 178

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           YI  R  + R+ +A Q L++ +++ +L+  +F  G T+ L      A++ +IE+ +P L 
Sbjct: 179 YIRLRGVQARLGVARQNLEIARQSYQLTKTRFDNGVTTNLDTANSAAQVATIEAQLPVLG 238

Query: 224 KSFRMNVHNISTLLG-YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQE 282
                 ++ +S L+G  P       ++ ++    PN    + +G+P++L + RPDI+  E
Sbjct: 239 AQQDRLINVLSLLMGEAPRALRADLIEPKAI---PNPAPDVPVGLPSELAQRRPDIQQSE 295

Query: 283 KKLADSVAKIGIAKSDLYPSLSLNGSIA--LTHDNSFPGYNTH-WSFGPKLYLPIFDKGK 339
             L  + A IG+A++D YP +SL  SI     + +SF  + +  WS+GP LYLP+F  G+
Sbjct: 296 AALHRATAAIGVAQADFYPRISLGASIGSQALNGSSFGDWGSRMWSYGPSLYLPVFQGGR 355

Query: 340 IKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSL 399
           +   +   +   QE  I +Q  VLNA  EV+NA+T  + +++    L  AV  +  ++S 
Sbjct: 356 LTGTLELRKRQEQEAAIDYQRVVLNAWHEVDNAMTDYSAEQQHHIALAEAVRQNMIALST 415

Query: 400 SMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +   Y QG    +++L ++RA    + +L  +  Q A   V LY  +G  +
Sbjct: 416 ARDRYSQGAADFINVLGVQRALLATQSELVDSATQAALDRVQLYRVLGGSW 466


>gi|153010881|ref|YP_001372095.1| RND efflux system outer membrane lipoprotein [Ochrobactrum anthropi
           ATCC 49188]
 gi|151562769|gb|ABS16266.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Ochrobactrum anthropi ATCC 49188]
          Length = 493

 Score =  202 bits (515), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 135/457 (29%), Positives = 236/457 (51%), Gaps = 20/457 (4%)

Query: 7   IFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
           +    + LLA C TVGP+Y KP++ L P  ++    K    +    WW++  D  L++L+
Sbjct: 10  VLGSILPLLAACVTVGPDYQKPNV-LTPAGWNSKADKRAPQLG--DWWKNLKDPVLDQLI 66

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQ----LD 121
              +  +  +  A  ++   + N  S    L+P    S S     +  T ++ Q      
Sbjct: 67  ADGIAGSPDVATAKAKVRQTRANYTSAGGALYPQLDGSGSFTRSDSGTTLASNQSSMGFK 126

Query: 122 SDWKIDLF-GQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI 180
           + W++DLF G RR +E++  N++SA  Q+  A + +I  +  +Y + R  +  I+IA + 
Sbjct: 127 TQWELDLFGGNRRGVEAAYYNVESANEQLRAALITLIGDIATNYANLRGAQANIAIAQRN 186

Query: 181 LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP 240
               ++ + L+  +   G  S++ L+  E +  S E+ IP L  S+   ++ +S L G  
Sbjct: 187 AASQRQTVALTRSQLEAGQISQVDLLSAETQAASTEAQIPGLRISYAQYLNQLSVLTGRS 246

Query: 241 ATEFLHYMQKQSNNFQPNLYIP--INIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSD 298
           ++     + K     +P   IP  I+ G+PADL+ +RPDIR  E+  A S A IG  ++ 
Sbjct: 247 SSALASVLDKS----RPIPAIPRKISAGLPADLLLSRPDIRAAERDYASSTASIGQKQAL 302

Query: 299 LYPSLSLNGSIALTHDNSFPGYNT----HWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQ 354
           LYPS+SL G+I  T   +F          W+FGP L +P+F  G++ +++  A ++  + 
Sbjct: 303 LYPSVSLTGNIN-TGGANFGDLGKLSTISWAFGPSLSVPVFHGGQLNADVDAARAARDQA 361

Query: 355 YITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDI 414
           +I +++ +L A+ EVENA  S+N+++    +LQ  V   +K   L++  YR G  S +D+
Sbjct: 362 FIAYRKIILTALSEVENASVSLNQNRLRTAQLQKIVGNSRKINELTLEQYRAGTKSFVDV 421

Query: 415 LDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           L  +R     E +LS A+  L  +YV L  A+G G+N
Sbjct: 422 LTAQRDLLSAETNLSQARTDLVLNYVALQKALGGGWN 458


>gi|329295867|ref|ZP_08253203.1| RND efflux system outer membrane lipoprotein [Plautia stali
           symbiont]
          Length = 511

 Score =  202 bits (514), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 137/475 (28%), Positives = 243/475 (51%), Gaps = 49/475 (10%)

Query: 17  GCTVGPEYTKP--HMPL----LPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQ 70
           GC VGP+Y  P  H P     LP+Q +   SK L +     WW+SFND  L+ L++ A+ 
Sbjct: 28  GCAVGPDYQPPQAHTPGSYRDLPSQEA---SKPLASATNPSWWKSFNDPQLDSLIERAIA 84

Query: 71  QNLTILQATERINAAKENILSVRADLFPS--SYASISHRFIP------------------ 110
            NLT+ Q+  RI  A+E +   R  LFPS    A ++ + +                   
Sbjct: 85  GNLTLQQSVLRIAGAREQLAQARGGLFPSLNGSAKVTRQQLGLKGMLKSYGVYDQVDDDV 144

Query: 111 ----NLKTNST----GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLI 161
               N  T+S     G  D+ W++DL+G+ RR +E + A   +A  Q + A +++ +++ 
Sbjct: 145 ADQLNGLTHSVTLYQGSFDASWELDLWGKVRRQMEMADAQQQAAIEQRNDALVSLEAEVA 204

Query: 162 PSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPT 221
            +Y+  R  +  ++   Q +++ ++  EL   +   G      +    A++ S+ + +P 
Sbjct: 205 RTYLQLRGAQAVLATLQQQINVAQQTWELMQSQQRNGLAPLTDVENARAQLASLNAQLPP 264

Query: 222 LEKSFRMNVHNISTLLG-YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRY 280
            +   R  ++ ++ LLG  P +     M  ++    P L   + +GIP+ L R RPDIR 
Sbjct: 265 YQAQERQAMNGLAVLLGKTPGSLDNELMSSKALPALPKL---VAVGIPSTLARRRPDIRQ 321

Query: 281 QEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS--FPGYNTHW-SFGPKLYLPIFDK 337
            E  L    A IG++ ++L+PSLSL G + + + ++     +++H+ S GP L +PIF  
Sbjct: 322 AEANLHAQTANIGVSVANLFPSLSLTGQLGVRNTDASYLDDWSSHFFSIGPALSIPIFQG 381

Query: 338 GKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSM 397
           G++ S+++ A +      + +++TVL A+++VENAL S   D++ VT L       +++ 
Sbjct: 382 GRLVSSVKLARAQQASAALDYRQTVLTALQDVENALVSYRADQQQVTVLDETTGALQRAF 441

Query: 398 SLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            L+  +Y+QG  + L++LD +R  A+     + A+ Q A   V LY A+G G+ P
Sbjct: 442 DLASDSYKQGISTFLEVLDAQRQLAQS----TQARMQSALDLVALYKALGGGWEP 492


>gi|239833861|ref|ZP_04682189.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Ochrobactrum intermedium LMG 3301]
 gi|239821924|gb|EEQ93493.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Ochrobactrum intermedium LMG 3301]
          Length = 545

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 133/458 (29%), Positives = 238/458 (51%), Gaps = 22/458 (4%)

Query: 7   IFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK-WWESFNDTSLNKL 64
           +    + +LA C TVGP+Y  P++ + P  +   NS+    I  L  WW+   D  L++L
Sbjct: 62  VLGSILPMLAACVTVGPDYQTPNV-VTPAGW---NSRADSRIPQLGDWWKKLKDPVLDQL 117

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQ----L 120
           +   +  +  +  A  ++  A+ N  S    L+P      S++      T +T Q     
Sbjct: 118 IADGIAGSPDVATAKAKVRQARANYTSAGGALYPKLDGDGSYKRSDTPATFATNQSSMGF 177

Query: 121 DSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQ 179
           ++ W++DLFG  +R +E++  N++SA  Q+  A + +I  +  +Y   R  +  I+IA +
Sbjct: 178 NTTWELDLFGGNKRGVEAAYYNVESANEQLRAALVTLIGDIATNYARLRGAQADIAIAQR 237

Query: 180 ILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGY 239
                ++ + L+  +   G  S++ L+  E +    ES +P L  ++   ++ +S L G 
Sbjct: 238 NAASQRQTVALTRSQLEAGQISQVDLLNAETQASRTESQVPGLRINYAQYLNQLSVLTGR 297

Query: 240 PATEFLHYMQKQSNNFQPNLYIP--INIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKS 297
            ++     + K     +P   IP  I+ G+PADL+ +RPD+R  E+  A S A +G  ++
Sbjct: 298 SSSSLASVLDKP----RPVPAIPGKISAGLPADLLLSRPDVRAAERDYASSNASVGQKQA 353

Query: 298 DLYPSLSLNGSIALTHDNSFPGYNT----HWSFGPKLYLPIFDKGKIKSNIRRAESSAQE 353
            LYPS+SL G+I  T   +F          W+FGP L +PIF  G++ +++  A ++  +
Sbjct: 354 LLYPSVSLTGAIN-TGGANFGDLGKLSTISWNFGPSLTVPIFQGGRLSADVDAARAARDQ 412

Query: 354 QYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLD 413
            +I +++ +L A+ EVENA  S+N+++  V +LQ  V   +K   L++  YR G  S +D
Sbjct: 413 SFIAYRKVILTALSEVENASVSLNQNRLRVAQLQKIVSNSRKINELTLEQYRAGTKSFVD 472

Query: 414 ILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +L  +R     E +LS A+ +L  +YV L  A+G G+N
Sbjct: 473 VLTAQRDLLGAETELSQARTELVLNYVALQKALGGGWN 510


>gi|320324759|gb|EFW80833.1| outer membrane efflux protein [Pseudomonas syringae pv. glycinea
           str. B076]
 gi|320328866|gb|EFW84865.1| outer membrane efflux protein [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 465

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 142/475 (29%), Positives = 245/475 (51%), Gaps = 35/475 (7%)

Query: 1   MNILRAIF-SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL--INIDTLKWWESFN 57
           M+  +  F SL ++ LA C VGP+Y  P    +P Q +     N     +DT+ WW+ F 
Sbjct: 1   MSAFKLFFPSLLVMALAACAVGPDYKAPVT--VPAQLASAAQGNYDRSKVDTV-WWQQFE 57

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKE----------NILSVRA--DLFPSSYASIS 105
           D +LNKLV  +L  N  +  A  R+ AA+            +++ RA  DL       ++
Sbjct: 58  DPTLNKLVARSLDGNRDLRVAFARLKAARAIRDDVANDAMPVITSRASSDLGKGQQPGVT 117

Query: 106 HRFIPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSY 164
            R + N +    G LD  W++DLFG+ +R +E+S A+ ++A A +   ++ +I++++ +Y
Sbjct: 118 ERRV-NSERYDLG-LDMAWEVDLFGRIQRQLEASDADQEAAEANLYQLQVTLIAEVVDAY 175

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQ----GATSKLSLVKLEAEIKSIESDIP 220
              R  + R +IA   L    KN + S    TQ    G  ++L +V+ EA + ++E+ +P
Sbjct: 176 GQLRGAQLREAIARDNL----KNQQSSQDVTTQLRDAGVGNELDVVRAEARLAAVEATVP 231

Query: 221 TLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRY 280
            L+       + I+TLLG         +   S +  P +   + IG P  ++RNRPDIR 
Sbjct: 232 QLQAEQVRQRNRIATLLGERPENLSVDL---SPSKLPAIAKALPIGDPTQVLRNRPDIRA 288

Query: 281 QEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD-NSFPGYNTH--WSFGPKLYLPIFDK 337
            E++LA S A+IG+A +DL+P +SL+  +  T    S  G +    WS GP +    FD 
Sbjct: 289 AERQLAASTARIGVATADLFPRVSLSCFLGFTAGRGSQIGSSAAKAWSLGPSITWAAFDL 348

Query: 338 GKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSM 397
           G +++ IR A++ A+     +++ VL A++E ENA +  ++ ++ +  L    +  + + 
Sbjct: 349 GSVRAQIRSADADAEGALANYEQQVLLALEESENAFSDYDKRQQRLVSLMRQSDASRSAA 408

Query: 398 SLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            L+ + YR+G    L +LD ER     E   + A+ +L +  V +Y A+G G+ P
Sbjct: 409 RLASVQYREGTADFLVLLDAERERLAAEDSQAQAEIELYRGIVAIYKALGGGWQP 463


>gi|328954012|ref|YP_004371346.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfobacca acetoxidans DSM 11109]
 gi|328454336|gb|AEB10165.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfobacca acetoxidans DSM 11109]
          Length = 527

 Score =  201 bits (511), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 134/469 (28%), Positives = 233/469 (49%), Gaps = 26/469 (5%)

Query: 7   IFSLFIVLLAGCT-VGPEYTKPHMPLLPTQFSIGNSK-NLINIDTLKWWESFNDTSLNKL 64
           + +L  +L AGCT VGP+Y  P + +          K   +N +  +WW  FND +L++L
Sbjct: 13  VCALIAILAAGCTKVGPDYLTPPVQVTDNWLETDGRKITPVNEEHREWWRVFNDKALDRL 72

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS----HRFIPNLKTNSTGQL 120
           ++ A Q NLT+ QA  R+  AK  +     +L+P +  ++     +R      T     L
Sbjct: 73  IQQAYQDNLTLQQAGVRVLQAKAQLGIAIGELYPQTQQAVGSLEKNRLSAKGSTQGATAL 132

Query: 121 ---------DSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                    ++ W++D +G+ RR IES+ ANL +  A  D   +++ +++  +YI  R F
Sbjct: 133 NYTTSKLGAEATWELDFWGKLRRTIESADANLQATVAGYDSVLVSLTAEVANTYIVLRTF 192

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           ++R+ IA   + +  +++E++  +F  G TS   + +    + S E+ IP LE   R   
Sbjct: 193 EKRLDIARNNVQVQNESLEIARYRFEGGVTSMRDVEQALTVLGSTEATIPRLEALVRQAK 252

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +S LLG P  +    +        P     + +GIPADL+R RPD+R  E + A   A
Sbjct: 253 NALSVLLGRPPMQLPELLP--GYGTVPVPPPTVAVGIPADLLRRRPDLREAEWQAAAQCA 310

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDN--------SFPGYNTHWSFGPKLYLPIFDKGKIKS 342
           +IG+AK+DL+P+  L GS   T  +         F   +     GP     I + G+I +
Sbjct: 311 RIGVAKADLFPAFYLRGSFGFTAADVGNIALADMFQWRSREGFGGPSFRWNILNYGRITN 370

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            +R  ++  QE  + +Q  VL A +EVE+ L +  + +     L  +    ++S+ L+MI
Sbjct: 371 LVRVQDARFQELLLAYQNLVLKAQQEVEDNLIAFLKTEDQAKFLGESTAAAERSLKLAMI 430

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            YR+G      +L  ++     + +L+IA   +A+S V +Y A+G G+ 
Sbjct: 431 QYREGMTDFTTVLTAQQNLLSQQDNLAIALGDIARSLVGIYRALGGGWQ 479


>gi|254235826|ref|ZP_04929149.1| hypothetical protein PACG_01767 [Pseudomonas aeruginosa C3719]
 gi|126167757|gb|EAZ53268.1| hypothetical protein PACG_01767 [Pseudomonas aeruginosa C3719]
          Length = 479

 Score =  201 bits (510), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 121/462 (26%), Positives = 239/462 (51%), Gaps = 27/462 (5%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSI----GNSKNLINID-TLKWWESFNDTSLNKLVKIAL 69
           L  C++GP++T+P  P  P ++S+    GN  +L       +WW  F+D  LN L++   
Sbjct: 14  LGACSLGPDFTRPDRPA-PGEWSLQAAAGNPSHLAAAPLAAQWWTLFDDAQLNALLQRVQ 72

Query: 70  QQNLTILQATERINAAKENILSVRADLFPSSYASISHR---------FIPNLKTN----- 115
           + NL +  A  R+  ++    S+  D  PS  AS +++         F P+ K       
Sbjct: 73  RANLDLRSAAARLQQSRAIRRSLGGDALPSVDASGTYQRQRTTSAGLFDPSGKAGKGNYN 132

Query: 116 -STGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
            +    D+ W++D +G+ RR +E++ A ++++  ++   +++V+++    YI  R  + R
Sbjct: 133 HALAGFDASWELDFWGRVRRELEAADATVEASENELRDVQVSVLAEAARDYIQLRGEQNR 192

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
            +I    L+  ++++EL+  +   G  + L + +  A++ S+E+ +P +EK+    V+ +
Sbjct: 193 AAIIRDNLETARRSLELTRTRLANGVATDLEVAQALAQVASMEARLPEVEKNQAHLVNAL 252

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
             L+G      L  +       +P   +P+  G+P++L + RPDIR  E +L  + A IG
Sbjct: 253 GYLVGASPGSLLAELGPARAIPRPPGSVPV--GLPSELAQRRPDIRRAEARLHAATASIG 310

Query: 294 IAKSDLYPSLSLNGSIALT--HDNSFPGYN-THWSFGPKLYLPIFDKGKIKSNIRRAESS 350
           +AK+D YP ++LNG+        +S   ++   ++ GP   LPIF+ G+++  +   E+ 
Sbjct: 311 VAKADFYPRITLNGNFGFESLQLSSLGDWDHRQFAIGPAFSLPIFEGGRLRGRLELREAQ 370

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
            QE  I +Q TVL A +EV++A+     +++   +L  AV  +++++  +   YR G   
Sbjct: 371 QQEAAIDYQRTVLRAWQEVDDAMHDYAANQRRQERLGEAVAQNRRALQSAREQYRAGAVD 430

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            L +LD +R     +     +   ++ + V+LY A+G G++P
Sbjct: 431 FLSVLDSQRQLLDNQEQQVASDEAVSLTLVNLYKALGGGWSP 472


>gi|15598033|ref|NP_251527.1| outer membrane protein precursor [Pseudomonas aeruginosa PAO1]
 gi|9948923|gb|AAG06225.1|AE004710_7 probable outer membrane protein precursor [Pseudomonas aeruginosa
           PAO1]
          Length = 479

 Score =  200 bits (509), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 121/462 (26%), Positives = 239/462 (51%), Gaps = 27/462 (5%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSI----GNSKNLINID-TLKWWESFNDTSLNKLVKIAL 69
           L  C++GP++T+P  P  P ++S+    GN  +L       +WW  F+D  LN L++   
Sbjct: 14  LGACSLGPDFTRPDRPA-PGEWSLQAAAGNPSHLAAAPLAAQWWTLFDDAQLNALLQRVQ 72

Query: 70  QQNLTILQATERINAAKENILSVRADLFPSSYASISHR---------FIPNLKTN----- 115
           + NL +  A  R+  ++    S+  D  PS  AS +++         F P+ K       
Sbjct: 73  RANLDLRSAAARLQQSRAIRRSLGGDALPSVDASGNYQRQRTTSAGLFDPSGKAGKGNYN 132

Query: 116 -STGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
            +    D+ W++D +G+ RR +E++ A ++++  ++   +++V+++    YI  R  + R
Sbjct: 133 HALAGFDASWELDFWGRVRRELEAADATVEASENELRDVQVSVLAEAARDYIQLRGEQNR 192

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
            +I    L+  ++++EL+  +   G  + L + +  A++ S+E+ +P +EK+    V+ +
Sbjct: 193 AAIIRDNLETARRSLELTRTRLANGVATDLEVAQALAQVASMEARLPEVEKNQAHLVNAL 252

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
             L+G      L  +       +P   +P+  G+P++L + RPDIR  E +L  + A IG
Sbjct: 253 GYLVGASPGSLLAELGPARAIPRPPGSVPV--GLPSELAQRRPDIRRAEARLHAATASIG 310

Query: 294 IAKSDLYPSLSLNGSIALT--HDNSFPGYN-THWSFGPKLYLPIFDKGKIKSNIRRAESS 350
           +AK+D YP ++LNG+        +S   ++   ++ GP   LPIF+ G+++  +   E+ 
Sbjct: 311 VAKADFYPRITLNGNFGFESLQLSSLGDWDHRQFAIGPAFSLPIFEGGRLRGRLELREAQ 370

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
            QE  I +Q TVL A +EV++A+     +++   +L  AV  +++++  +   YR G   
Sbjct: 371 QQEAAIDYQRTVLRAWQEVDDAMHDYAANQRRQERLGEAVAQNRRALQSAREQYRAGAVD 430

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            L +LD +R     +     +   ++ + V+LY A+G G++P
Sbjct: 431 FLSVLDSQRQLLDNQEQQVASDEAVSLTLVNLYKALGGGWSP 472


>gi|53804056|ref|YP_114045.1| multidrug efflux system outer membrane subunit [Methylococcus
           capsulatus str. Bath]
 gi|53757817|gb|AAU92108.1| multidrug efflux system outer membrane subunit [Methylococcus
           capsulatus str. Bath]
          Length = 520

 Score =  200 bits (509), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 138/480 (28%), Positives = 237/480 (49%), Gaps = 43/480 (8%)

Query: 3   ILRAIFSLFIVLLAGCT-VGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK--WWESFNDT 59
           ILR   SL   +   C+ VGP+Y +P    +P ++           +T+   WW++F D 
Sbjct: 38  ILRLFASLLGAVFTACSPVGPDYRRPDT-TMPERWHEAEPPPAAPSETVGADWWKAFGDP 96

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFP--SSYASISHRFIPNLKTNST 117
            LN+L++ A+  NL + Q   RI AA+E  +   A+  P  S+  S+S R       N+ 
Sbjct: 97  VLNRLIREAMVANLDLKQTYTRIRAAREQRIVAIANGLPIVSNKESVSRRL------NNA 150

Query: 118 GQ----------------------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKL 154
           GQ                       D  W+IDLFG  RR IE++ ANL++         +
Sbjct: 151 GQSGAGGQPGGVGFGNNIDIFQLGFDVQWEIDLFGGIRRSIEAAEANLEAEVENSRAVLV 210

Query: 155 NVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKS 214
            ++  +  +YI+ R  +  ++++   L L  +   L  +++  G +  L  V+ EA    
Sbjct: 211 TLLGDVARAYIEMRSNQHLLNVSQANLKLQLETARLMRIRYQAGLSDSLEAVQAEALAAQ 270

Query: 215 IESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP--INIGIPADLI 272
            ++ +P  E + +  +H +  LLG P       +  +    QP    P  I + +P++L+
Sbjct: 271 TQAQLPVYETARKQAMHQLELLLGKPPGALQTLLDPE----QPVPSAPDRILLDLPSELL 326

Query: 273 RNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD--NSFPGYNTHWSFGPKL 330
           R RPDIR  E++LA + A++G+A +DLYP  ++   +   +         +  WS    L
Sbjct: 327 RRRPDIRLAERQLAAATAQVGVATADLYPKFNIAAFLGFQNMKITDVTALSKSWSAAGTL 386

Query: 331 YLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAV 390
             PIF+ G+I++NI   ++  ++ ++ +Q  VL A+K+VEN+L +  ++K     L+ AV
Sbjct: 387 TTPIFNWGRIRANIDAKKAQQEQSFLAYQSAVLGALKDVENSLVAYAQEKDRRAALEQAV 446

Query: 391 ELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           E ++ ++ LS   YR G  S L++LD ERA    E DL  ++  +A   V LY A+G G+
Sbjct: 447 ESNRLALKLSKERYRSGLTSFLNVLDSERAVYSAESDLVRSQASVAADLVSLYKALGGGW 506


>gi|308270628|emb|CBX27240.1| hypothetical protein N47_A12690 [uncultured Desulfobacterium sp.]
          Length = 485

 Score =  200 bits (509), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 142/453 (31%), Positives = 240/453 (52%), Gaps = 21/453 (4%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK----WWESFNDTSLNKLVKIALQQN 72
           GC VGP+Y KP    LP+ ++    K+  N  T K    WW +FND  L  LV  A++ N
Sbjct: 31  GCAVGPDY-KPIETTLPSTWAGPAPKSDTNTITEKDIACWWTAFNDPLLVSLVNRAIESN 89

Query: 73  LTILQATERINAAKENILSVRADLFPSSYASISHR--FIPNLKTNSTG--------QLDS 122
           L I QA  RI  A+       +   P   A  S+R    P     + G          D+
Sbjct: 90  LDIRQAEARIRQARAARGVSLSGFGPVLNAVSSYRRSHSPQSAAANDGITSSQYQAGFDA 149

Query: 123 DWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQIL 181
            W++D+FG  RR +E++ A+L+      +   + + +++  +YID R +++R++IA   L
Sbjct: 150 AWELDIFGGVRRSVEAADADLNVVIEGRNDVLVTLAAEVAVNYIDLRAYQQRLNIARNNL 209

Query: 182 DLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPA 241
              K   EL+H   T G  + L     +A+  +  + IP LE S   +++++S L+G   
Sbjct: 210 AAQKHTAELTHKIVTAGFANSLDAANADAQAATTAAQIPLLEASAEQSIYSLSLLIGREP 269

Query: 242 TEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYP 301
              L  +++ S+    +  +P+  G+P+DL+R RPDIR  E ++  + A+IG+A +DL+P
Sbjct: 270 AALLTELKESSDIPAASPLVPV--GVPSDLLRRRPDIRRAEAQIHAATARIGVATADLFP 327

Query: 302 SLSLNGSIALTHD--NSF-PGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITW 358
             S++GS    +D  NS+    N  WSFGP +   IF+ GK  SNI   ++  ++  IT+
Sbjct: 328 KFSISGSAGFQNDEFNSWMDRVNRFWSFGPSVSWQIFNTGKTISNIELQKALQEQSAITY 387

Query: 359 QETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIE 418
           ++T+L A+KEV+NAL +  ++++       AV  +KK++ L+   Y  G+   L++L  +
Sbjct: 388 KQTILTALKEVDNALIASTKEEERKKAFSDAVAANKKAVDLAKQLYIHGQTDFLNVLLAQ 447

Query: 419 RATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           R+    E  L+ + R ++ + V LY AIG G+ 
Sbjct: 448 RSLYASEDALAQSTRTVSTNLVALYKAIGGGWG 480


>gi|313107979|ref|ZP_07794148.1| putative outer membrane protein precursor [Pseudomonas aeruginosa
           39016]
 gi|310880650|gb|EFQ39244.1| putative outer membrane protein precursor [Pseudomonas aeruginosa
           39016]
          Length = 479

 Score =  200 bits (508), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 121/462 (26%), Positives = 238/462 (51%), Gaps = 27/462 (5%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSI----GNSKNLINID-TLKWWESFNDTSLNKLVKIAL 69
           L  C++GP++T+P  P  P  +S+    GN  +L       +WW  F+D  LN L++   
Sbjct: 14  LGACSLGPDFTRPDRPA-PGDWSLQAAAGNPSHLAAAPLAAQWWTLFDDAQLNALLQRVQ 72

Query: 70  QQNLTILQATERINAAKENILSVRADLFPSSYASISHR---------FIPNLKTN----- 115
           + NL +  A  R+  ++    S+  D  PS  AS +++         F P+ K       
Sbjct: 73  RANLDLRSAAARLQQSRAIRRSLGGDALPSVDASGNYQRQRTTSAGLFDPSGKAGKGNYN 132

Query: 116 -STGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
            +    D+ W++D +G+ RR +E++ A ++++  ++   +++V+++    YI  R  + R
Sbjct: 133 HALAGFDASWELDFWGRVRRELEAADATVEASENELRDVQVSVLAEAARDYIQLRGEQSR 192

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
            +I    L+  ++++EL+  +   G  + L + +  A++ S+E+ +P +EK+    V+ +
Sbjct: 193 AAIIRDNLETARRSLELTRTRLANGVATDLEVAQALAQVASMEARLPEVEKNQAHLVNAL 252

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
             L+G      L  +       +P   +P+  G+P++L + RPDIR  E +L  + A IG
Sbjct: 253 GYLVGASPGSLLAELGPAREIPRPPGSVPV--GLPSELAQRRPDIRRAEARLHAATASIG 310

Query: 294 IAKSDLYPSLSLNGSIALT--HDNSFPGYN-THWSFGPKLYLPIFDKGKIKSNIRRAESS 350
           +AK+D YP ++LNG+        +S   ++   ++ GP   LPIF+ G+++  +   E+ 
Sbjct: 311 VAKADFYPRITLNGNFGFESLQLSSLGDWDHRQFAIGPAFSLPIFEGGRLRGRLELREAQ 370

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
            QE  I +Q TVL A +EV++A+     +++   +L  AV  +++++  +   YR G   
Sbjct: 371 QQEAAIDYQRTVLRAWQEVDDAMHDYAANQRRQERLGEAVAQNRRALQSAREQYRAGAVD 430

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            L +LD +R     +     +   ++ + V+LY A+G G++P
Sbjct: 431 FLSVLDSQRQLLDNQEQQVASDEAVSLTLVNLYKALGGGWSP 472


>gi|218890965|ref|YP_002439831.1| putative outer membrane protein precursor [Pseudomonas aeruginosa
           LESB58]
 gi|218771190|emb|CAW26955.1| probable outer membrane protein precursor [Pseudomonas aeruginosa
           LESB58]
          Length = 479

 Score =  199 bits (507), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 121/462 (26%), Positives = 238/462 (51%), Gaps = 27/462 (5%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSI----GNSKNLINID-TLKWWESFNDTSLNKLVKIAL 69
           L  C++GP +T+P  P  P ++S+    GN  +L       +WW  F+D  LN L++   
Sbjct: 14  LGACSLGPNFTRPDRPA-PGEWSLQAAAGNPSHLAAAPLAAQWWTLFDDAQLNALLQRVQ 72

Query: 70  QQNLTILQATERINAAKENILSVRADLFPSSYASISHR---------FIPNLKTN----- 115
           + NL +  A  R+  ++    S+  D  PS  AS +++         F P+ K       
Sbjct: 73  RANLDLRSAAARLQQSRAIRRSLGGDALPSVDASGTYQRQRTTSAGLFDPSGKAGKGNYN 132

Query: 116 -STGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
            +    D+ W++D +G+ RR +E++ A ++++  ++   +++V+++    YI  R  + R
Sbjct: 133 HALAGFDASWELDFWGRVRRELEAADATVEASENELRDVQVSVLAEAARDYIQLRGEQNR 192

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
            +I    L+  ++++EL+  +   G  + L + +  A++ S+E+ +P +EK+    V+ +
Sbjct: 193 AAIIRDNLETARRSLELTRTRLANGVATDLEVAQALAQVASMEARLPEVEKNQAHLVNAL 252

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
             L+G      L  +       +P   +P+  G+P++L + RPDIR  E +L  + A IG
Sbjct: 253 GYLVGASPGSLLAELGPARAIPRPPGSVPV--GLPSELAQRRPDIRRAEARLHAATASIG 310

Query: 294 IAKSDLYPSLSLNGSIALT--HDNSFPGYN-THWSFGPKLYLPIFDKGKIKSNIRRAESS 350
           +AK+D YP ++LNG+        +S   ++   ++ GP   LPIF+ G+++  +   E+ 
Sbjct: 311 VAKADFYPRITLNGNFGFESLQLSSLGDWDHRQFAIGPAFSLPIFEGGRLRGRLELREAQ 370

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
            QE  I +Q TVL A +EV++A+     +++   +L  AV  +++++  +   YR G   
Sbjct: 371 QQEAAIDYQRTVLRAWQEVDDAMHDYAANQRRQERLGEAVAQNRRALQSAREQYRAGAVD 430

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            L +LD +R     +     +   ++ + V+LY A+G G++P
Sbjct: 431 FLSVLDSQRQLLDNQEQQVASDEAVSLTLVNLYKALGGGWSP 472


>gi|156934684|ref|YP_001438600.1| hypothetical protein ESA_02519 [Cronobacter sakazakii ATCC BAA-894]
 gi|156532938|gb|ABU77764.1| hypothetical protein ESA_02519 [Cronobacter sakazakii ATCC BAA-894]
          Length = 513

 Score =  199 bits (507), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 130/483 (26%), Positives = 240/483 (49%), Gaps = 54/483 (11%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDT--------LKWWESFNDTSLNKLVKIA 68
           GC VGP+Y +P  P+ P  F     +N  ++ +         +WW +F    L+ L++ A
Sbjct: 20  GCAVGPDYQRPE-PVTPGAFGETARQNAPDVASKARSTAPDPRWWRTFKSPQLDSLIERA 78

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPSSYASI--------------SHRFIPNLKT 114
           +  NL++ Q   RI  A+E I       FP+   ++              SH     L  
Sbjct: 79  IAGNLSLQQTVLRIAGAREQINQAGGAFFPAVNGNVRATRQQLGLEGELKSHDVYGQLDA 138

Query: 115 NST-----------------GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNV 156
                               G  D+ W+IDL+G+ RR +E++ A   +A  Q + A +++
Sbjct: 139 VDPQISSALGPLTQPINLYQGSFDAQWEIDLWGKVRRQVEAADAQQKAAIEQRNDALVSL 198

Query: 157 ISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE 216
            +++  +++  R  +  ++  +Q +   ++ +EL+  +   G + +L +    A++ +++
Sbjct: 199 EAEVARAWLQLRGAQSILATMNQQIASAQQTLELTESRQQSGLSPQLDVENARAQLGTLQ 258

Query: 217 SDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP--INIGIPADLIRN 274
           + +P  +   R  ++ ++ LLG P       +Q      QP   +P  + +GIP+ L R 
Sbjct: 259 AQLPQYQAQERQAMNGLAVLLGKPPGALDAELQA----AQPLPPLPEIVPVGIPSTLARR 314

Query: 275 RPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWS-----FGPK 329
           RPD+R  E +L  + A+IG++ + L+PSLSL+G   +   NS   Y T WS     FGP+
Sbjct: 315 RPDVREAEARLHAATAQIGVSVAQLFPSLSLSGQFGMR--NSETSYLTDWSSHFYSFGPQ 372

Query: 330 LYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHA 389
           + +PIF  G++ S+++ A +      + +++TVL A+ +VENAL S   D++    L+  
Sbjct: 373 VSIPIFQGGRLVSSVKLARAEQGAAALQYRQTVLTALSDVENALVSYRTDQQREAGLEKT 432

Query: 390 VELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           +E  + S  L+  +YR+G  + +D+LD +R  A+ E   + A+ Q +   V LY A+G G
Sbjct: 433 LEALQTSFDLASDSYRKGIATFIDVLDAQRQLAQAEQQRAQARVQSSLDLVALYKALGGG 492

Query: 450 YNP 452
           + P
Sbjct: 493 WEP 495


>gi|254241504|ref|ZP_04934826.1| hypothetical protein PA2G_02202 [Pseudomonas aeruginosa 2192]
 gi|126194882|gb|EAZ58945.1| hypothetical protein PA2G_02202 [Pseudomonas aeruginosa 2192]
          Length = 479

 Score =  199 bits (507), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 121/462 (26%), Positives = 238/462 (51%), Gaps = 27/462 (5%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSI----GNSKNLINID-TLKWWESFNDTSLNKLVKIAL 69
           L  C++GP++T+P  P  P  +S+    GN  +L       +WW  F+D  LN L++   
Sbjct: 14  LGACSLGPDFTRPDHPA-PGDWSLQAAAGNPSHLAAAPLAAQWWTLFDDAQLNALLQRVQ 72

Query: 70  QQNLTILQATERINAAKENILSVRADLFPSSYASISHR---------FIPNLKTN----- 115
           + NL +  A  R+  ++    S+  D  PS  AS +++         F P+ K       
Sbjct: 73  RANLDLRSAAARLQQSRAIRRSLGGDALPSVDASGNYQRQRTTSAGLFDPSGKAGKGNYN 132

Query: 116 -STGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
            +    D+ W++D +G+ RR +E++ A ++++  ++   +++V+++    YI  R  + R
Sbjct: 133 HALAGFDASWELDFWGRVRRELEAADATVEASENELRDVQVSVLAEAARDYIQLRGEQSR 192

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
            +I    L+  ++++EL+  +   G  + L + +  A++ S+E+ +P +EK+    V+ +
Sbjct: 193 AAIIRDNLETARRSLELTRTRLANGVATDLEVAQALAQVASMEARLPEVEKNQAHLVNAL 252

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
             L+G      L  +       +P   +P+  G+P++L + RPDIR  E +L  + A IG
Sbjct: 253 GYLVGASPGSLLAELGPAREIPRPPGSVPV--GLPSELAQRRPDIRRAEARLHAATASIG 310

Query: 294 IAKSDLYPSLSLNGSIALT--HDNSFPGYN-THWSFGPKLYLPIFDKGKIKSNIRRAESS 350
           +AK+D YP ++LNG+        +S   ++   ++ GP   LPIF+ G+++  +   E+ 
Sbjct: 311 VAKADFYPRITLNGNFGFESLQLSSLGDWDHRQFAIGPAFSLPIFEGGRLRGRLELREAQ 370

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
            QE  I +Q TVL A +EV++A+     +++   +L  AV  +++++  +   YR G   
Sbjct: 371 QQEAAIDYQRTVLRAWQEVDDAMHDYAANQRRQERLGEAVAQNRRALQSAREQYRAGAVD 430

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            L +LD +R     +     +   ++ + V+LY A+G G++P
Sbjct: 431 FLSVLDSQRQLLDNQEQQVASDEAVSLTLVNLYKALGGGWSP 472


>gi|307823718|ref|ZP_07653946.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Methylobacter tundripaludum SV96]
 gi|307735012|gb|EFO05861.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Methylobacter tundripaludum SV96]
          Length = 526

 Score =  199 bits (507), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 134/471 (28%), Positives = 238/471 (50%), Gaps = 32/471 (6%)

Query: 7   IFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK-NLINIDTLKWWESFNDTSLNKLV 65
           ++SL  +LL+ C VGP+Y +P            + + N  + +   WW+SFND  LN+L+
Sbjct: 13  VWSLAFLLLSSCMVGPDYVRPATETATQWLEAEDRRLNTTSANDQTWWKSFNDPVLNQLI 72

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFP-----------------SSYASISHRF 108
             A  +NL I  A  R+  A+  +     +++P                 +S A+ S  F
Sbjct: 73  DRAYLENLNIRIAGVRVLEARAQLGIAIGNIYPQNQQLTGSLSKVHLSERASQAAFSKIF 132

Query: 109 IPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
             +      G L + W+ID +G+ RR IES+ A   +A A  + A +++ + +  +YI  
Sbjct: 133 --DYAQTQLG-LTASWEIDFWGKFRRAIESADAGFQAAVADYNNALVSLTADVAHAYITI 189

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
           R  ++R+SIA Q +D  K+++ ++ +++  G TS+  + +    + + ++ IPTLE   R
Sbjct: 190 RTLEKRLSIARQNVDTQKESLNIAKIRYNGGTTSERDVEQARTVLANTQASIPTLEIGLR 249

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
              + +S LLG         +   +    P   + + +GIPA+L+R RPD+R+ E + A 
Sbjct: 250 QQQNALSVLLGAAPGRISGLLAGTAQIPAPP--VQVAVGIPAELLRRRPDVRHAEWQAAA 307

Query: 288 SVAKIGIAKSDLYPSLSLNGSIALTHDN--SFP-GYNTHW-----SFGPKLYLPIFDKGK 339
             A IG+ K+ LYP+LSL G+  L   +  SF  G    W     +FGP L   IF+ G+
Sbjct: 308 QSASIGVTKAALYPALSLTGTFGLLSSDVGSFALGDVFLWKSRTANFGPALQWNIFNYGQ 367

Query: 340 IKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSL 399
           I + +R  ++  Q   I++Q TVL+A +EVE+ L +    ++    L  +    ++S+ L
Sbjct: 368 ITNQVRVQDARLQGLLISYQNTVLSAQREVEDNLVAFLRSQERAQSLGESTAAAQRSLDL 427

Query: 400 SMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           + + YRQG      +L  ++A    +  L+     ++ + V +Y A+G G+
Sbjct: 428 ATLQYRQGITDFTTVLTAQQALLSEQDSLANTLGDISNNLVGVYRALGGGW 478


>gi|323530267|ref|YP_004232419.1| NodT family RND efflux system, outer membrane lipoprotein
           [Burkholderia sp. CCGE1001]
 gi|323387269|gb|ADX59359.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. CCGE1001]
          Length = 507

 Score =  199 bits (506), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 135/488 (27%), Positives = 239/488 (48%), Gaps = 49/488 (10%)

Query: 10  LFIVLLAGCTVGPEYTKPHMP----LLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
           L  V +AGCTVGP + +P          TQ +   SK +       WW  FND  LN L 
Sbjct: 16  LACVAMAGCTVGPNFERPQSATPDVFERTQAAQSPSKAVEAQFGPDWWTLFNDPILNDLE 75

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFP--------------------------- 98
           K    QNL++  A+ R+  ++     V A  +P                           
Sbjct: 76  KRLADQNLSVAAASARLLQSRAERRVVGAAEYPTLGGAASYNRERGSENGILSLLGVTPS 135

Query: 99  -------SSYASISHRFIPNLKTNST-----GQLDSDWKIDLFGQ-RRHIESSLANLDSA 145
                  S  A +    +P  K +          D+ W++DL+G+ RR +E+  A   ++
Sbjct: 136 QSQPLSASGSAPLGVAAMPGSKGSPAYNVYQAGFDASWELDLWGRVRRSVEAVTAQSQAS 195

Query: 146 YAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSL 205
           Y   +   L+  ++L   YI+ R  ++ + IA + L +    ++L+  +  +G T+ L +
Sbjct: 196 YEDRNAILLSARAELARDYIELRDTQDLLQIAKENLAIANGALKLTRDRAREGVTTDLDV 255

Query: 206 VKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINI 265
               A++++IES IPTLE      ++ I  LL          + +  +   P L   + I
Sbjct: 256 SNAAAQVENIESLIPTLESQSETTINAIGLLLAQEPGALRQTLAEPRD--VPPLPAQVPI 313

Query: 266 GIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALT--HDNSFPGYNT- 322
           G P++L++ RPDIR  E +L  + AKIGIAK+D YP ++LNGS  L     +S   + + 
Sbjct: 314 GFPSELVQRRPDIRKAEAELHAATAKIGIAKADFYPRITLNGSAGLQSLQLSSLGSWASG 373

Query: 323 HWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKI 382
            +  GP + LPIF+ G++K  ++  E+  QE  I +++TVLNA +EV++AL + + +++ 
Sbjct: 374 QFVAGPSITLPIFEGGRLKGMLQLREAQQQEAAIVYKQTVLNAWREVDDALVTYDGEQRR 433

Query: 383 VTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDL 442
             +L  AV +++++++++   Y+ G    LD+L+++R     + +L  +K   A + + L
Sbjct: 434 RDRLSLAVSMNERALAVARDRYKAGALDYLDVLNVQRQLLDAQSNLQKSKAAAATNLITL 493

Query: 443 YIAIGSGY 450
             A+G G+
Sbjct: 494 CKALGGGW 501


>gi|328952703|ref|YP_004370037.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfobacca acetoxidans DSM 11109]
 gi|328453027|gb|AEB08856.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfobacca acetoxidans DSM 11109]
          Length = 491

 Score =  199 bits (505), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 146/483 (30%), Positives = 254/483 (52%), Gaps = 38/483 (7%)

Query: 3   ILRAIFSLF-----IVLLAGCTVGPEYTKPHMPLLPTQF------SIGN-SKNLINIDTL 50
            +R + SLF     ++L  GC VGP+Y  P   + P ++      + G  SK      TL
Sbjct: 8   FVRYLISLFWTVSSLILAIGCAVGPDYQAPKTEV-PAEWNGQAFVTQGQASKTTTEPVTL 66

Query: 51  -KWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYAS-ISHRF 108
            +WW  FND +LN LV++A+  NL + Q   RI  A+       A L P+  AS I  R 
Sbjct: 67  AQWWGIFNDRTLNSLVELAITANLDLKQVEARIRQARAARGVAGAGLGPTVDASVIYQRS 126

Query: 109 IPNLKTNSTGQ-----------------LDSDWKIDLFG-QRRHIESSLANLDSAYAQVD 150
             + +T  +G                  LDS W++D FG  RR++E++ A+L +A     
Sbjct: 127 KSSSETVGSGGSPTVAATGAFRELFQVGLDSSWELDFFGGTRRNLEAATADLRAAMEDRR 186

Query: 151 IAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEA 210
              + +I  +  +Y++ R  +++++IAH+ L++ +K   + H +F  G  S+L +   +A
Sbjct: 187 DVLITLIGDVGSNYLNLRGLQQQLAIAHKNLEVQRKTAAIVHRRFETGFVSRLDVANADA 246

Query: 211 EIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPAD 270
           +  + E+ IP LE S +  ++++  LLG         + + +    P     I IG+P+D
Sbjct: 247 QAAATEAQIPVLESSAQAAIYSLGVLLGQNPAALETTLVRPNPL--PPTPPKIPIGLPSD 304

Query: 271 LIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALT-HDNSFPGYNT--HWSFG 327
           L+R RPDIR  E +L  + A+IG+A +DL+P   L G   ++  D +  G +   +WSF 
Sbjct: 305 LVRRRPDIRRAEAQLHAATARIGVATADLFPRFFLTGGFGVSARDLNRLGISNSRYWSFS 364

Query: 328 PKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQ 387
           P +  PIF  G+I+ NI    +  ++ ++T+Q+TVL A+KEVE AL +  ++++    L 
Sbjct: 365 PTVTWPIFASGRIRWNIEMQNALQEQAFLTYQKTVLTALKEVETALVAYAKEQEHRQSLA 424

Query: 388 HAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIG 447
            AV+ +++++ L+M  Y  G+   L++L  +R+    E  L  + ++L  + + LY A+G
Sbjct: 425 TAVDNNRQAVDLAMKLYVAGKTDFLNVLTAQRSLYVNEEALVQSTQRLTVNLITLYKALG 484

Query: 448 SGY 450
            G+
Sbjct: 485 GGW 487


>gi|116050841|ref|YP_790336.1| putative outer membrane protein precursor [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|115586062|gb|ABJ12077.1| putative outer membrane protein precursor [Pseudomonas aeruginosa
           UCBPP-PA14]
          Length = 479

 Score =  199 bits (505), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 121/462 (26%), Positives = 238/462 (51%), Gaps = 27/462 (5%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSI----GNSKNLINID-TLKWWESFNDTSLNKLVKIAL 69
           L  C++GP++T+P+ P  P  +S+    GN  +L       +WW  F+D  LN L++   
Sbjct: 14  LGACSLGPDFTRPNRPA-PGDWSLQAATGNPSHLAAAPLAAQWWTLFDDAQLNALLQRVQ 72

Query: 70  QQNLTILQATERINAAKENILSVRADLFPSSYASISHR---------FIPNLKTN----- 115
           + NL +  A  R+  ++    S+  D  PS  AS +++         F P+ K       
Sbjct: 73  RANLDLRSAAARLQQSRAIRRSLGGDALPSVDASGNYQRQRTTSAGLFDPSGKAGKGNYN 132

Query: 116 -STGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
            +    D+ W++D +G+ RR +E++ A ++++  ++   +++V+++    YI  R  + R
Sbjct: 133 HALAGFDASWELDFWGRVRRELEAADATVEASENELRDVQVSVLAEAARDYIQLRGEQSR 192

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
            +I    L+  + ++EL+  +   G  + L + +  A++ S+E+ +P +EK+    V+ +
Sbjct: 193 AAIIRDNLETARHSLELTRTRLANGVATDLEVAQALAQVASMEARLPEVEKNQAHLVNAL 252

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
             L+G      L  +       +P   +P+  G+P++L + RPDIR  E +L  + A IG
Sbjct: 253 GYLVGASPGSLLAELGPAREIPRPPGSVPV--GLPSELAQRRPDIRRAEARLHAATASIG 310

Query: 294 IAKSDLYPSLSLNGSIALT--HDNSFPGYN-THWSFGPKLYLPIFDKGKIKSNIRRAESS 350
           +AK+D YP ++LNG+        +S   ++   ++ GP   LPIF+ G+++  +   E+ 
Sbjct: 311 VAKADFYPRITLNGNFGFESLQLSSLGDWDHRQFAIGPAFSLPIFEGGRLRGRLELREAQ 370

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
            QE  I +Q TVL A +EV++A+     +++   +L  AV  +++++  +   YR G   
Sbjct: 371 QQEAAIDYQRTVLRAWQEVDDAMHDYAANQRRQERLGEAVAQNRRALQSAREQYRAGAVD 430

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            L +LD +R     +     +   ++ + V+LY A+G G++P
Sbjct: 431 FLSVLDSQRQLLDNQEQQVASDEAVSLTLVNLYKALGGGWSP 472


>gi|114763048|ref|ZP_01442478.1| nodulation protein T precursor [Pelagibaca bermudensis HTCC2601]
 gi|114544372|gb|EAU47380.1| nodulation protein T precursor [Roseovarius sp. HTCC2601]
          Length = 377

 Score =  199 bits (505), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 114/347 (32%), Positives = 202/347 (58%), Gaps = 10/347 (2%)

Query: 106 HRFIPNLKTNSTGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSY 164
           +  I N  TNS G  +    +DLFG +RR  E++L +L SA   V  A+L  +S L+ +Y
Sbjct: 24  NEMIDNTATNS-GSFNPAIVLDLFGGERRSREAALVSLQSAELSVGTARLAYLSSLVTNY 82

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           ID R+F+  ++I  Q ++  ++ + L   +   GA + L   + +A + +  + +P LE 
Sbjct: 83  IDMRYFQNALAINRQTIETRRETLSLVQSQREAGAATALDEAQAQASLDADLASLPGLES 142

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
            F    + I+TLL  P       +++ +   QP      ++G+PADL+RNRPD+R  E+ 
Sbjct: 143 GFYSATYAIATLLAQPVQSIEDRLERGA--AQPRPASGADVGVPADLVRNRPDVRAAERN 200

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNI 344
           LA + A+IGIA++ LYPSL+L G+I  T      G+N+ W+FGP + LP+ ++  +++  
Sbjct: 201 LAAATAEIGIAEAALYPSLTLGGTITRTE-----GFNS-WTFGPSVVLPVLNQPALRAQR 254

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
            +  + A++  + W+ +VL+A++EV++A TS   +++ V   Q +V  +++ + LS   Y
Sbjct: 255 DQQAAQAEQSELQWRSSVLDAVEEVQSAQTSYLRNRRAVAGYQRSVASNERVVELSRETY 314

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           R G  +LLD+L ++RA +   + L+ + R LA S+  L +A G G++
Sbjct: 315 RGGTTTLLDLLTVQRALSSARLTLASSVRDLATSWASLQVAAGKGWS 361


>gi|167645051|ref|YP_001682714.1| RND efflux system outer membrane lipoprotein [Caulobacter sp. K31]
 gi|167347481|gb|ABZ70216.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Caulobacter sp. K31]
          Length = 482

 Score =  198 bits (504), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 127/465 (27%), Positives = 231/465 (49%), Gaps = 20/465 (4%)

Query: 4   LRAIFSLF--IVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
           L+    LF  ++LL+ C VGP+Y  P    +  Q +   + +  N +  +WW++F D  L
Sbjct: 20  LKVQLGLFASMLLLSACAVGPDYKTPVDAPVVVQNAPAGAFSTANPEA-QWWKAFGDPVL 78

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQ-- 119
           + LV  AL  NL I  A  R++ A+      R D  P   A  S+      +  S GQ  
Sbjct: 79  DGLVTQALAGNLDIKVAVARVDEARALFKDARLDQLPRVTADGSYVKSDQQQPGSNGQRV 138

Query: 120 --------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                    D+ W+IDLFG+ RR +ES+ A   +A A +  A++ + +++  +Y++ R  
Sbjct: 139 ESETYQGGFDAGWEIDLFGRVRRGVESARAEAGAAKADLRDAQVTIAAEVARNYLELRGA 198

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           + R+++A++ LD  ++ + L+ +++  GA + + +   +A + + E+ IP+L  + +   
Sbjct: 199 QARLAVANRNLDTQRETLRLTKVRYDAGAGNPIDVASAQARLNATEAAIPSLITAEKHAN 258

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  L G         +  Q+    P L   + IG  ADL+R RPDI+  E++LA   A
Sbjct: 259 YRLCVLTGQRPGALDATLVVQNAEVTP-LITALPIGDAADLLRRRPDIQAAERRLAAQTA 317

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTH----WSFGPKLYLPIFDKGKIKSNIRR 346
           K+G+A +DL+P + + G I      S  G+       WS  P +  P  D G     ++ 
Sbjct: 318 KVGVATADLFPRVRVTGFIGFLS-GSASGFGNSASQAWSVAPSVTWPALDLGGAHQRLKA 376

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
           A++        + +TVL A++++ENAL    + +  +  L +     +++  L+ I Y++
Sbjct: 377 AQARNDASLAVYDQTVLTALEDLENALVGYRQQQAQLVSLTNQAAASRRAAELARIQYKE 436

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           G    L +LD ER     E  L++A+  +  + V +Y A+G G+ 
Sbjct: 437 GGIDFLVLLDAERTLLAAEDSLTVAETGVNTNVVAIYKALGGGWT 481


>gi|296388676|ref|ZP_06878151.1| putative outer membrane protein precursor [Pseudomonas aeruginosa
           PAb1]
          Length = 479

 Score =  198 bits (504), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 121/462 (26%), Positives = 237/462 (51%), Gaps = 27/462 (5%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSI----GNSKNLINID-TLKWWESFNDTSLNKLVKIAL 69
           L  C++GP++T+P  P  P  +S+    GN  +L       +WW  F+D  LN L++   
Sbjct: 14  LGACSLGPDFTRPDRPA-PGDWSLQAAAGNPSHLAAAPLAAQWWTLFDDAQLNALLQRVQ 72

Query: 70  QQNLTILQATERINAAKENILSVRADLFPSSYASISHR---------FIPNLKTN----- 115
           + NL +  A  R+  ++    S+  D  PS  AS +++         F P+ K       
Sbjct: 73  RANLDLRSAAARLQQSRAIRRSLGGDALPSVDASGNYQRQRTTSAGLFDPSGKAGKGNYN 132

Query: 116 -STGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
            +    D+ W++D +G+ RR +E++ A ++++  ++   +++V+++    YI  R  + R
Sbjct: 133 HALAGFDASWELDFWGRVRRELEAADATVEASENELRDVQVSVLAEAARDYIQLRGEQSR 192

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
            +I    L+  + ++EL+  +   G  + L + +  A++ S+E+ +P +EK+    V+ +
Sbjct: 193 AAIIRDNLETARHSLELTRTRLANGVATDLEVAQALAQVASMEARLPEVEKNQAHLVNAL 252

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
             L+G      L  +       +P   +P+  G+P++L + RPDIR  E +L  + A IG
Sbjct: 253 GYLVGASPGSLLAELGPAREIPRPPGSVPV--GLPSELAQRRPDIRRAEARLHAATASIG 310

Query: 294 IAKSDLYPSLSLNGSIALT--HDNSFPGYN-THWSFGPKLYLPIFDKGKIKSNIRRAESS 350
           +AK+D YP ++LNG+        +S   ++   ++ GP   LPIF+ G+++  +   E+ 
Sbjct: 311 VAKADFYPRITLNGNFGFESLQLSSLGDWDHRQFAIGPAFSLPIFEGGRLRGRLELREAQ 370

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
            QE  I +Q TVL A +EV++A+     +++   +L  AV  +++++  +   YR G   
Sbjct: 371 QQEAAIDYQRTVLRAWQEVDDAMHDYAANQRRQERLGEAVAQNRRALQSAREQYRAGAVD 430

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            L +LD +R     +     +   ++ + V+LY A+G G++P
Sbjct: 431 FLSVLDSQRQLLDNQEQQVASDEAVSLTLVNLYKALGGGWSP 472


>gi|222056600|ref|YP_002538962.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Geobacter sp. FRC-32]
 gi|221565889|gb|ACM21861.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Geobacter sp. FRC-32]
          Length = 504

 Score =  198 bits (504), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 136/470 (28%), Positives = 239/470 (50%), Gaps = 21/470 (4%)

Query: 1   MNILRAIFSLFIVLLAGC-TVGPEYTKPHM--PLLPTQFSIGNS--KNLINIDTLKWWES 55
           ++++R +  +  + LAGC TVGP+Y KP +  P    +    NS  K     D  +WW +
Sbjct: 26  VHLVRWLIIIATLALAGCVTVGPDYVKPELDVPANWNRLDQANSETKAAATGDLSRWWLA 85

Query: 56  FNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS---HRFIPNL 112
            ND  L+ L+  ALQ +  +  A  R+  A+       A L+P+  AS S   +R    L
Sbjct: 86  LNDPLLSGLIDDALQASPDLRSAKARLREARARGAVASAGLYPAVTASGSARRNRSSEEL 145

Query: 113 KTNSTGQL-----DSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYID 166
              ST  L     D+ W++DLFG  RR IE++ A+++S+ A ++  +++++++   +Y++
Sbjct: 146 GGGSTQNLFRADFDAQWELDLFGGVRRGIEATRADVESSVASLENTRVSLVAETAQNYVE 205

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
            R  + R+ IA   L    + ++L+  +   G  S   + +  +  +   + IP LE S 
Sbjct: 206 VRTLQLRLGIARDNLVSQTETLQLTDWRAQAGLVSSQDVDQARSNREQTRARIPGLEISL 265

Query: 227 RMNVHNISTLLG-YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
               H +  LLG  P T  L      +    P++ + I +GIPA+ +R RPD+R  E+KL
Sbjct: 266 AEAEHRLEVLLGKTPGT--LQGRLAVAGEL-PSVPMQIAVGIPAETLRQRPDVRAAERKL 322

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
           A   A+IG A++  YPS S++GSI   ALT            S    +  PIF+ GK+++
Sbjct: 323 AAETARIGAAEAARYPSFSISGSIGFEALTVGALGSSGAATSSLLAGITAPIFNAGKLRN 382

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            +   ++  ++  + ++++VL A++EVENAL + + +++    L +A E  + +   +  
Sbjct: 383 QVVIQDAVREQALVAYEQSVLTALQEVENALVAFSRNRESSEALTNAAESARNAARSARQ 442

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            Y  G      +LD ER    VE  L+  +     + + LY A+G G++P
Sbjct: 443 RYSAGLIDFQSVLDTERTVLSVEDSLASTRANQVAALIRLYKALGGGWSP 492


>gi|66046200|ref|YP_236041.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. syringae B728a]
 gi|63256907|gb|AAY38003.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. syringae B728a]
          Length = 465

 Score =  198 bits (503), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 144/467 (30%), Positives = 243/467 (52%), Gaps = 32/467 (6%)

Query: 7   IFSLFIVLLAGCTVGPEYTKP-HMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
           I SL ++ LA C VGP+Y  P   P      + GN  +   +D + WW+ F D +LNKLV
Sbjct: 8   IPSLLVMALAACAVGPDYQAPVTAPAKLASAAQGN-YDRSKVDRV-WWQQFEDPTLNKLV 65

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFP--SSYAS----------ISHRFIPNLK 113
             +L  N  +  A  R+ +A+     V  D+ P  +S AS          I+ R + N +
Sbjct: 66  ARSLDGNRDLRVAFARLKSARAIRDDVANDVMPVVTSRASSDIGKGQQPGITERRV-NSE 124

Query: 114 TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
               G LD  W++DLFG+ +R +E+S A+ D+A A +   ++ +I++++ +Y   R  + 
Sbjct: 125 RYDLG-LDMAWEVDLFGRIQRQLEASDADQDAAEANLYQLQVTLIAEVVDAYGQLRGAQL 183

Query: 173 RISIAHQILDLYKKNIELSHLKFTQ----GATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
           R +IA   L    KN + S    TQ    G  ++L +V+ EA + ++E+ +P L+     
Sbjct: 184 REAIARDNL----KNQQSSQDVTTQLRDAGVGNELDVVRAEARLAAVEASVPQLQAEQAR 239

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
             + I+TLLG         +   S +  P +   + IG P  ++RNRPDIR  E++LA S
Sbjct: 240 QRNRIATLLGERPENLSVDL---SPSKLPAIAKALPIGDPTQVLRNRPDIRAAERQLAAS 296

Query: 289 VAKIGIAKSDLYPSLSLNGSIALTHD-NSFPGYNTH--WSFGPKLYLPIFDKGKIKSNIR 345
            A+IG+A +DL+P +SL+G +  T    S  G +    WS GP +    FD G +++ IR
Sbjct: 297 TARIGVATADLFPRVSLSGFLGFTAGRGSQIGSSAARAWSLGPSITWAAFDLGSVRAQIR 356

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
            A++ A+     +++ VL A++E ENA +  ++ ++ +  L    +  + +  L+ + YR
Sbjct: 357 SADADAEGALANYEQQVLLALEESENAFSDYDKRQQRLVSLMRQSDASRSAARLASVQYR 416

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           +G    L +LD ER     E   + A+ +L +  V +Y A+G G+ P
Sbjct: 417 EGTADFLVLLDAERERLAAEDAQAQAEIELYRGIVAIYKALGGGWQP 463


>gi|294676171|ref|YP_003576786.1| RND efflux system outer membrane lipoprotein [Rhodobacter
           capsulatus SB 1003]
 gi|294474991|gb|ADE84379.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhodobacter capsulatus SB 1003]
          Length = 450

 Score =  198 bits (503), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 120/412 (29%), Positives = 206/412 (50%), Gaps = 17/412 (4%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           LAGC    +Y  P   + P  F    +          WW +F D +L++L+     +NL 
Sbjct: 17  LAGCAQ-VDYAAPAAKV-PATF---EAAAPGRAAAGPWWSAFRDPTLDQLIAAGRARNLD 71

Query: 75  ILQATERINAAKENILSVRADLFPSSYASI----SHRFIPNLKTNSTGQLDSDWKIDLFG 130
           +LQA   I  A+ ++    A   P    ++     +     +  + +G L   W  DLFG
Sbjct: 72  VLQAIAAIEEARASVSGAGAADLPQVSGTLKDTRGNTSGTGIAESRSGALAVGWTADLFG 131

Query: 131 QRRHIESSLANLDSA-YAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIE 189
             R   ++ +    A YA  D+A+L +   +  +Y + R+ +  I++  + L+  +K++E
Sbjct: 132 ANRANRAAASARLDAAYASADVARLVMEGAIAQAYAELRYQQASIALTRKSLESRRKSLE 191

Query: 190 LSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQ 249
           L+  +   G   +L L++ E  +   E+ +P  E +F   +  ++TL   P +     + 
Sbjct: 192 LTRAQVESGTAGRLELLQAEQLVAEGEAQLPGYETAFDQALVTLATLTAQPVSALRPQLS 251

Query: 250 KQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSI 309
           + +   QP      ++G+PAD++R RPD+R  E+  A +V  IG+AK+  YPS++L+GS+
Sbjct: 252 RGAG--QPRPRFKASVGVPADVLRTRPDVRLAERNYAAAVYDIGVAKAAFYPSVTLSGSV 309

Query: 310 ALTHDNSFPGYNT--HWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIK 367
             TH       NT  +W+ GP L LPIF  G  ++N+R AE+ A +  + W++ VL AI 
Sbjct: 310 TPTHVRD---ANTIRYWAVGPSLNLPIFTGGANQANLRGAEARAVQAKLAWEKAVLTAID 366

Query: 368 EVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIER 419
           EVE+AL + N D + +    H V    +++ LS  NY  G    + +LD ER
Sbjct: 367 EVESALAAYNRDGRNIAAQTHLVATSAETLELSRTNYSLGEGDFMTVLDAER 418


>gi|167035566|ref|YP_001670797.1| RND efflux system outer membrane lipoprotein [Pseudomonas putida
           GB-1]
 gi|166862054|gb|ABZ00462.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Pseudomonas putida GB-1]
          Length = 483

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 130/465 (27%), Positives = 236/465 (50%), Gaps = 25/465 (5%)

Query: 10  LFIVLLAGCTVGPEYTKP--HMP--LLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
           L  VL+AGCT+GP++ +P    P    P Q     S+       L+WWESF+D  L+ L+
Sbjct: 11  LLAVLMAGCTMGPDFRRPDSQAPQQWAPLQGEAAASQPQAEPLELRWWESFHDAQLSALI 70

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI---------PNLKTNS 116
           +   ++NL +  A+ R+  ++    +V AD  PS  A+  +            P+ K   
Sbjct: 71  QRVAERNLDLQMASARLLQSRALRSTVAADEMPSVDANAGYSRARNSAEGLSDPSGKAGK 130

Query: 117 T------GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                  G L + W++DL+G+ RR +E++ A+++ A        L ++S+   +YI  R 
Sbjct: 131 AAYNLWQGDLVAGWELDLWGRVRRQVEAADASVEVAENDRRGVLLALLSETAGNYIQLRA 190

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
            +  + +    L + + +++LS  +  +G  ++L + +  A++ SIES +P+LE + R +
Sbjct: 191 VQHTLDVTQDNLKVARHSLKLSEDRQAEGVATRLDVAQASAQVASIESRLPSLE-ARRDD 249

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
           + N  +LL       L     Q     P       IG+P++L   RPDIR  E +L  + 
Sbjct: 250 LINALSLLAAEPPRSLQAELLQGGEL-PAPQQKFAIGLPSELAERRPDIRQAEARLHAAT 308

Query: 290 AKIGIAKSDLYPSLSLNGSIALT--HDNSFPGYNTH-WSFGPKLYLPIFDKGKIKSNIRR 346
           A IG+AK+D YPS+ L+GS+       + F G+++  ++FGP+L LPIF+ G++K  +  
Sbjct: 309 ASIGVAKADFYPSIRLSGSVGFQAMQLSDFGGWDSRRFAFGPQLSLPIFEGGRLKGTLEL 368

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
            E+  QE  + +++ VL A  E+++ L   N  +     L  AV  ++ ++  +   Y +
Sbjct: 369 REAQQQEAALNYRKVVLGAWHEIDDVLRLYNASQLRRDHLAEAVRQNRIALETAQRQYVE 428

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           G    L++L ++ A    E     +   ++++ V LY A+G G+ 
Sbjct: 429 GAVDFLNVLTVQGALLASEEQWIDSSAAVSQALVGLYKALGGGWQ 473


>gi|77918426|ref|YP_356241.1| outer membrane protein [Pelobacter carbinolicus DSM 2380]
 gi|77544509|gb|ABA88071.1| outer membrane protein [Pelobacter carbinolicus DSM 2380]
          Length = 479

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 130/471 (27%), Positives = 240/471 (50%), Gaps = 22/471 (4%)

Query: 1   MNILRAIFSLFIVLLAGCT----VGPEYTKPHMPLLPTQFSIGN---SKNLINIDTLKWW 53
           MN +R + ++F++   G T    VGP+Y  P +  +P  +S+      +     D  +WW
Sbjct: 1   MNTIRCVRTMFVLACLGLTACVAVGPDYVPP-VADVPATWSMATDNQGQAAEPGDLSRWW 59

Query: 54  ESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK 113
           E FND  LN LV  AL  NL +  A  ++  A+       + L PS   + S     + +
Sbjct: 60  EEFNDPVLNDLVTDALTANLDLATARAQLREARAQRALAGSQLGPSVDVATSASRSQSSE 119

Query: 114 TNS--------TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSY 164
            +         +   D+ W+ D+FG  RR +E++ A++D++   +   +++++++++ +Y
Sbjct: 120 ESGSGSTSELYSAGFDASWEADVFGGLRRGVEAAAADVDASVESLRDTQVSLVAEVVLNY 179

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           +D R  + R+S+A   +    +   L+  +   G  S+L + +   E++S  + +P L  
Sbjct: 180 VDLRTAERRLSVAENNIASLSETYRLAGWRLQAGLVSELDVAQARTELESTRASLPALRT 239

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
           +     + ++ LLG    E    ++  S    P       +GIPAD++R RPD+R  E++
Sbjct: 240 TRAEARNRLAVLLGSSPAELGSRLE--SAGAIPLAERAAAVGIPADILRQRPDVRAAERQ 297

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIK 341
           LA   A++G A+++ YPS  L+GSI   ALT      G    +S    +  PIFD G+I+
Sbjct: 298 LAAQTARLGEAEAERYPSFKLSGSIGLEALTLSALSNGGAAVYSLLGSITAPIFDSGRIR 357

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           +NI   ++  ++  + ++  VL A+++VENAL ++N   K    L  A +  ++++ L+ 
Sbjct: 358 ANIETQDALLEQTRLAYKAAVLTALEDVENALVAVNNAGKRRETLTLAADSARETLQLAE 417

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
             Y  G    L +LD +R    +E DL+ +   LA + + LY A+G G++P
Sbjct: 418 QRYAGGLVDFLTVLDSQRTLLGLEDDLASSAGDLAGAQIQLYKALGGGWSP 468


>gi|330950467|gb|EGH50727.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae Cit 7]
          Length = 465

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 144/467 (30%), Positives = 243/467 (52%), Gaps = 32/467 (6%)

Query: 7   IFSLFIVLLAGCTVGPEYTKP-HMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
           I SL ++ LA C VGP+Y  P   P      + GN  +   +D + WW+ F D +LNKLV
Sbjct: 8   IPSLLVMALAACAVGPDYQAPVTAPAKLASAAQGN-YDRSKVDRV-WWQQFEDPTLNKLV 65

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFP--SSYAS----------ISHRFIPNLK 113
             +L  N  +  A  R+ +A+     V  D+ P  +S AS          I+ R + N +
Sbjct: 66  ARSLDGNRDLRVAFARLKSARAIRDDVANDVMPVVTSRASSDIGKGQQPGITERRV-NSE 124

Query: 114 TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
               G LD  W++DLFG+ +R +E+S A+ D+A A +   ++ +I++++ +Y   R  + 
Sbjct: 125 RYDLG-LDMAWEVDLFGRIQRQLEASDADQDAAEANLYQLQVTLIAEVVDAYGQLRGAQL 183

Query: 173 RISIAHQILDLYKKNIELSHLKFTQ----GATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
           R +IA   L    KN + S    TQ    G  ++L +V+ EA + ++E+ +P L+     
Sbjct: 184 REAIARDNL----KNQQSSQDVTTQLRDAGVGNELDVVRAEARLAAVEATVPQLQAEQAR 239

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
             + I+TLLG         +   S +  P +   + IG P  ++RNRPDIR  E++LA S
Sbjct: 240 QRNRIATLLGERPENLSVDL---SPSKLPAIAKALPIGDPTQVLRNRPDIRAAERQLAAS 296

Query: 289 VAKIGIAKSDLYPSLSLNGSIALTHD-NSFPGYNTH--WSFGPKLYLPIFDKGKIKSNIR 345
            A+IG+A +DL+P +SL+G +  T    S  G +    WS GP +    FD G +++ IR
Sbjct: 297 TARIGVATADLFPRVSLSGFLGFTAGRGSQIGSSAARAWSLGPSITWAAFDLGSVRAQIR 356

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
            A++ A+     +++ VL A++E ENA +  ++ ++ +  L    +  + +  L+ + YR
Sbjct: 357 SADADAEGALANYEQQVLLALEESENAFSDYDKRQQRLVSLMRQSDASRSAARLASVQYR 416

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           +G    L +LD ER     E   + A+ +L +  V +Y A+G G+ P
Sbjct: 417 EGTADFLVLLDAERERLAAEDAQAQAEIELYRGIVAIYKALGGGWQP 463


>gi|303245959|ref|ZP_07332241.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfovibrio fructosovorans JJ]
 gi|302492742|gb|EFL52610.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfovibrio fructosovorans JJ]
          Length = 534

 Score =  197 bits (501), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 145/485 (29%), Positives = 242/485 (49%), Gaps = 43/485 (8%)

Query: 4   LRAIFSLFIVL-LAGCT-VGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK--WWESFNDT 59
            R   + F+ L L GC  +GP++ +P   L  T    G +  L     ++  WW++F D 
Sbjct: 8   FRLCATFFLALCLCGCMKLGPDFKRPDAQLYDTWAEDG-ADGLKQGQAVQNEWWKTFGDP 66

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSS--------YASISHRFIPN 111
            L+KLV+ A  +NLT+  A  R+   +  +      L+P S        Y+  SH   P+
Sbjct: 67  ELSKLVRTAFDRNLTLRVAGLRVIEGRAQLGIAVGQLYPQSQAASGGYTYSRESH-LGPS 125

Query: 112 L-------KTNSTGQL-------DSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNV 156
                   KT S  Q+        + W++D +G+ RR IES+ A + ++ A  D A +++
Sbjct: 126 WPQPSTESKTTSPDQIWQNTVAFSAAWELDFWGKYRRGIESADAAMRASAADYDNALVSL 185

Query: 157 ISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE 216
              +  +Y+D R  + ++ IAH+ ++L K+ ++++  +F  GATS+  + + +  + S E
Sbjct: 186 AGDVARTYLDLRINQAQLKIAHENVELEKEGLKIAEARFRYGATSERDVQQAKTMLLSTE 245

Query: 217 SDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRP 276
           + IP  + + + N H +S LLG P  +    +        P     I +G+PADL+R RP
Sbjct: 246 ATIPGFQSAIKKNRHALSVLLGLPPDKAPEGLTDSEGIPAPPW--EIAVGVPADLLRRRP 303

Query: 277 DIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDN----------SFPGYNTHWSF 326
           D+R  E       A+IG+AK+DL+PS SL GSI     N          S  G+     F
Sbjct: 304 DVRAAEYAAMAQCAQIGVAKADLFPSFSLTGSIGFLASNVGVFKLSELLSNNGFTAQ--F 361

Query: 327 GPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKL 386
            P+    +F+ G+I  N+R  ++  Q   I +Q+TVL A++EVE+A+T+       V  L
Sbjct: 362 SPQFGWNLFNYGRIIDNVRVQDAKFQALLIQYQQTVLTALREVEDAMTAYIGASAQVVSL 421

Query: 387 QHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAI 446
             A +  K+S  L+ I Y +G+     +L  ++   K + DL   + Q+A S V LY A+
Sbjct: 422 AKAADAAKRSADLAFIQYSEGKTDYTTVLVAQQQLLKQQDDLVQMRGQVATSLVSLYRAL 481

Query: 447 GSGYN 451
           G G+ 
Sbjct: 482 GGGWQ 486


>gi|114331918|ref|YP_748140.1| RND efflux system, outer membrane lipoprotein, NodT family protein
           [Nitrosomonas eutropha C91]
 gi|114308932|gb|ABI60175.1| RND efflux system, outer membrane lipoprotein, NodT family protein
           [Nitrosomonas eutropha C91]
          Length = 493

 Score =  197 bits (501), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 127/484 (26%), Positives = 246/484 (50%), Gaps = 44/484 (9%)

Query: 8   FSLFIVLLAGCT-VGPEYTKPHMPLLPTQFSIGNS------------------------K 42
           F L ++ L GC  VGP+Y  P   + P +F+   S                        K
Sbjct: 9   FRLLVLFLTGCAAVGPDYVPPE-KITPEKFNAALSEDQKAKLSLPETGQEADEAKTEFTK 67

Query: 43  NLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYA 102
            +     + WW +  D  L +L++ A++ NL +  A  R+   + +    R+ LFP+   
Sbjct: 68  QVTPAMLVDWWNTLEDPLLTRLIEWAIRGNLDLQLAQSRLREERASRGIARSGLFPTIEG 127

Query: 103 SISH-RFIPNLKTNSTGQLD-------SDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAK 153
             +  R   NL++    ++D       + W+ID+FG  RR IES+ A++++   +++   
Sbjct: 128 DAAFTRRKTNLQSGGISEIDLYSLSFDASWEIDMFGGIRRSIESAQASVEARQEELNDTL 187

Query: 154 LNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIK 213
           + +++++  +YI+ R F+ R+  A   L+  +  +++   +   G T+ LSL + +  ++
Sbjct: 188 VTLVAEVAINYIEIRAFQARLEAAVNNLESQEGTLQIVQDRLDAGLTTTLSLEQAKYNLE 247

Query: 214 SIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGI--PADL 271
           + +S+IP L+       + ++ LLG    EF   + ++   +Q    + + + +  PADL
Sbjct: 248 NSKSEIPMLQTGIEQGKNGLAVLLG----EFPGSLAEELEQYQKVPTVSVEVVVGVPADL 303

Query: 272 IRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGP 328
           +R RPD+R  E++LA   A++G+A +DLYP L L GS+ L + ++   F G    +  GP
Sbjct: 304 LRRRPDVRRAERELAAQTARVGVATADLYPRLFLFGSVGLEYISAASFFTGPAAAFQIGP 363

Query: 329 KLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQH 388
           ++  P+F+ G+I+ NI+  +    +  I ++ +VL A+K+VENAL     ++     L  
Sbjct: 364 QIRWPVFNAGRIRQNIKIEDERQSQALIQYEASVLTAVKDVENALIDFANEQVRRQALIK 423

Query: 389 AVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGS 448
           + +  K ++SLS   Y  G    + +LD ERA    +  L++++ ++  + + LY ++G 
Sbjct: 424 STQSAKSAVSLSRELYTAGLTDFIGVLDAERALFSFQDQLAVSEGKVTSNLIRLYKSLGG 483

Query: 449 GYNP 452
           G+ P
Sbjct: 484 GWKP 487


>gi|107102387|ref|ZP_01366305.1| hypothetical protein PaerPA_01003449 [Pseudomonas aeruginosa PACS2]
          Length = 479

 Score =  197 bits (500), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 120/462 (25%), Positives = 238/462 (51%), Gaps = 27/462 (5%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSI----GNSKNLINID-TLKWWESFNDTSLNKLVKIAL 69
           L  C++GP++T+P  P  P ++S+    GN  +L       +WW  F+D  LN L++   
Sbjct: 14  LGACSLGPDFTRPDRPA-PGEWSLQAAAGNPSHLTAAPLAAQWWTLFDDAQLNALLQRVQ 72

Query: 70  QQNLTILQATERINAAKENILSVRADLFPSSYASISHR---------FIPNLKTN----- 115
           + NL +  A  R+  ++    S+  D  PS  AS +++         F P+ K       
Sbjct: 73  RANLDLRSAAARLQQSRAIRRSLGGDALPSVDASGTYQRQRTTSAGLFDPSGKAGKGNYN 132

Query: 116 -STGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
            +    D+ W++D +G+ RR +E++ A ++++  ++   +++V+++    YI  R  + R
Sbjct: 133 HALAGFDASWELDFWGRVRRELEAADATVEASENELRDVQVSVLAEAARDYIQLRGEQNR 192

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
            +I    L+  ++++EL+  +   G  + L + +  A++ S+E+ +P +EK+    V+ +
Sbjct: 193 AAIIRDNLETARRSLELTRTRLANGVATDLEVAQALAQVASMEARLPEVEKNQAHLVNAL 252

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
             L+G      L  +       +P   +P+  G+P++L + R DIR  E +L  + A IG
Sbjct: 253 GYLVGASPGSLLAELGPARAIPRPPGSVPV--GLPSELAQRRTDIRRAEARLHAATASIG 310

Query: 294 IAKSDLYPSLSLNGSIALT--HDNSFPGYN-THWSFGPKLYLPIFDKGKIKSNIRRAESS 350
           +AK+D YP ++LNG+        +S   ++   ++ GP   LPIF+ G+++  +   E+ 
Sbjct: 311 VAKADFYPRITLNGNFGFESLQLSSLGDWDHRQFAIGPAFSLPIFEGGRLRGRLELREAQ 370

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
            QE  I +Q TVL A +EV++A+     +++   +L  AV  +++++  +   YR G   
Sbjct: 371 QQEAAIDYQRTVLRAWQEVDDAMHDYAANQRRQERLGEAVAQNRRALQSAREQYRAGAVD 430

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            L +LD +R     +     +   ++ + V+LY A+G G++P
Sbjct: 431 FLSVLDSQRQLLDNQEQQVASDEAVSLTLVNLYKALGGGWSP 472


>gi|116747895|ref|YP_844582.1| Fis family transcriptional regulator [Syntrophobacter fumaroxidans
           MPOB]
 gi|116696959|gb|ABK16147.1| transcriptional regulator, Fis family [Syntrophobacter fumaroxidans
           MPOB]
          Length = 512

 Score =  197 bits (500), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 132/484 (27%), Positives = 248/484 (51%), Gaps = 45/484 (9%)

Query: 5   RAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINI----DTLKWWESFNDTS 60
           R++    + ++ GC VGP Y  P   + P Q+S       + +    D  +WW  F D  
Sbjct: 14  RSLILGLVAVVGGCMVGPNYRTPPSEM-PGQWS--EEPKGVEVAAAPDISRWWTLFEDPK 70

Query: 61  LNKLVKIALQQN--LTILQATERINAAKENILSVRADLFPSSYASISHRF---------- 108
           LN L++ A++ N  L I  A  R   A+  + +  ADLFP+  A  S+ +          
Sbjct: 71  LNDLIERAVRANKDLKIAAARVREARAQRGVTA--ADLFPTVNADGSYVYSQKSLTTTNP 128

Query: 109 ------------IPNLKTNSTG----QLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDI 151
                       +  + T ST       D+ W++DL+G  RR +E++ ANL ++   +  
Sbjct: 129 PLVSSGSSPAATVGGVSTGSTNLFQVGFDAGWELDLWGGTRRAVEAADANLAASVENLRG 188

Query: 152 AKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAE 211
             + ++S +  SY+  R F+ R+ IA   +   ++ +EL+  +F  G +S+L++ + +A+
Sbjct: 189 VLVTLVSDVAVSYMQIRGFQLRLGIARNNIASQRQTLELTEARFEAGLSSELAVAQQKAQ 248

Query: 212 IKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADL 271
           + + E+ +P  E   R  +H +  LLG      L   +       P +   +  G+P+DL
Sbjct: 249 LAATEATVPAFESGMRQAIHQLGVLLG--GKPELLLEELLEEEPIPPVPPGVPAGLPSDL 306

Query: 272 IRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIA----LTHDNSFPGYNTHWSFG 327
           +R RPDIR  E++LA + A IG+A + L+P  SL G++      +     PG N ++S G
Sbjct: 307 LRQRPDIRASERQLAAATASIGVATAQLFPQFSLTGTVGQQSMFSSKWFTPGSN-YFSIG 365

Query: 328 PKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQ 387
           P +   IFD G+I+ NI+  ++  ++ + T+++T+L A+K+VE+AL + ++++     L+
Sbjct: 366 PSVSWAIFDAGRIRWNIKVQDARQEQAFHTYEKTILVALKDVEDALIAYSKEQDTRESLK 425

Query: 388 HAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIG 447
            AV+ ++++  +S   Y +G    L++LD +R     +   + +  +++   V LY A+G
Sbjct: 426 LAVDSNRRAYDISYELYAKGLVDFLNVLDAQRNLFVTQDQYAQSTLRVSADLVALYKALG 485

Query: 448 SGYN 451
            G++
Sbjct: 486 GGWD 489


>gi|116748527|ref|YP_845214.1| RND efflux system outer membrane lipoprotein [Syntrophobacter
           fumaroxidans MPOB]
 gi|116697591|gb|ABK16779.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Syntrophobacter fumaroxidans MPOB]
          Length = 486

 Score =  197 bits (500), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 132/463 (28%), Positives = 246/463 (53%), Gaps = 24/463 (5%)

Query: 8   FSLFIVLLAGCT-VGPEYTKPHMPLLP---TQFSIGNSKNLINIDTLK-WWESFNDTSLN 62
            +L I+++ GC  VGP+Y +P +P+     T+     +    ++ TL  WW + +D  L+
Sbjct: 18  MALAIMIVTGCAAVGPDYVRPEVPVYEAWNTRLDGDANTGETDVRTLAAWWTTLDDPKLS 77

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS---HRFIPNLKTNSTGQ 119
           +LV  A++ NL + +A  R+  A+       ADLFPS  A+ S   +R I +  T++TG 
Sbjct: 78  ELVGRAVKGNLDLKKAKARVREARARRGIAEADLFPSLDAAGSATWNRIISDTGTDTTGD 137

Query: 120 L-----DSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
           L     D+ W++D+FG  RR +E++  +L ++   +    +++++++  +Y+D R +++R
Sbjct: 138 LYTAGFDAAWELDVFGGVRRSVEAADRDLQASEEDLRNVLVSLLAEVGLNYLDVRIYQDR 197

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
           I++A   L    +   L+  ++  G + +L++ +     ++  S IP L       ++ +
Sbjct: 198 IAVAEDNLASQDETCRLTEWRYQAGLSDELAVQQARYNRENTRSQIPLLITGLEAALNRV 257

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
           + LLG         ++++     P L + +  G+PADL+R RPD+R  E++LA   A++G
Sbjct: 258 AVLLGEQPGRVHTELERREPIPVPPLQVAV--GVPADLLRRRPDVRQAERQLAAQTARVG 315

Query: 294 IAKSDLYPSLSLNGSIALT----HDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           +A +DLYP  +LNGSI L      D +    +   S GP +   IF  G I+ NI  A+S
Sbjct: 316 VATADLYPKFTLNGSIGLEALALKDPA--SASLLLSGGPAITWAIFKGGAIRQNI-EAQS 372

Query: 350 SAQEQ-YITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           + QEQ  I ++  +L A++EVENAL +  + +     L  A +  +K+  L+   Y  G 
Sbjct: 373 ALQEQALIQYEAVILGALEEVENALVAYAQVQLRRQALSEATQAARKAAELARHKYEAGL 432

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
               ++LD +R+    +  L+++   +  + + LY A+G G+ 
Sbjct: 433 TDFTNVLDAQRSLLSFQEQLALSNGNVTGNLMRLYKALGGGWT 475


>gi|307822568|ref|ZP_07652799.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Methylobacter tundripaludum SV96]
 gi|307736172|gb|EFO07018.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Methylobacter tundripaludum SV96]
          Length = 482

 Score =  196 bits (499), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 131/462 (28%), Positives = 239/462 (51%), Gaps = 32/462 (6%)

Query: 16  AGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           +GC  VGP+Y +P +P+ P Q++   +  +      +WW++FND  L+KL+  A+  NL 
Sbjct: 15  SGCFAVGPDYQRPKIPI-PRQWT--ETPAVQGSQPEQWWKTFNDPILDKLISEAIASNLD 71

Query: 75  ILQATERINAAKENILSVRADLFPS--SYASISHRF------IPNLKTNSTGQ------- 119
           +  A ER+  A+    +  A   PS  + +S S RF           T+S G        
Sbjct: 72  LKLALERVKDARALRSATIAAGLPSLDAKSSASRRFNNSSSPASQTGTSSAGGGFGIGNQ 131

Query: 120 --------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                    D+ W++D FG  RR +ES+ A +D          + ++ ++  +YI+ R  
Sbjct: 132 FINIFQMGFDAQWELDFFGGVRRAVESADATIDVEVENSRDVLVTLLGEVARNYIELRAN 191

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           +  I+I  + L   ++  EL+ ++   G    L + + +A   + E+ +P  E + + ++
Sbjct: 192 QRLIAITRENLHAQQETQELTQIRQQTGLAGMLEVTQAQALAATTEAQLPNYETAVKQSI 251

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           H +S LLG      +  + +Q     P +   +   +P++L++ RPDIR  E++LA + A
Sbjct: 252 HALSVLLGKEPGALVVRLDQQGTI--PAIAANVITNLPSELLQRRPDIRRAERQLAVANA 309

Query: 291 KIGIAKSDLYPSLSLNGSIAL--THDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
            +G+A ++LYP ++L   I L  T    F      WS    L LPIF+ GK+ +NI   +
Sbjct: 310 SVGVATAELYPKINLAAFIGLQNTTITDFTPVGKSWSAASSLTLPIFNWGKLNANIDSKK 369

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           +  ++ ++T+Q TVL+A KEVE+AL + +++++    L  AV  ++ ++ L+   Y++G 
Sbjct: 370 AQFEQSFLTYQSTVLSAFKEVEDALIAYSKEQQRHKALAKAVAANQLAVQLANERYQKGL 429

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            + LD+L  + A  + +  L  ++ QLA + V LY A+G G+
Sbjct: 430 TAFLDVLTSQTALYQAQSLLVTSESQLAGNLVALYKALGGGW 471


>gi|257093349|ref|YP_003166990.1| NodT family RND efflux system, outer membrane lipoprotein
           [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
 gi|257045873|gb|ACV35061.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
          Length = 521

 Score =  196 bits (499), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 133/460 (28%), Positives = 235/460 (51%), Gaps = 26/460 (5%)

Query: 13  VLLAGCT-VGPEYTKPHMPLLPTQFSIGNSKNLINID--------TLKWWESFNDTSLNK 63
           VLL GC  VGP++ +P +  LP     G S + +N +        T +WW +F+D  L++
Sbjct: 20  VLLGGCAAVGPDFKRPAVSWLPGWS--GGSLDSLNAEQRGKPRAQTEEWWRNFSDPVLDQ 77

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTG----- 118
           L+  A + N  +  A  RI  A+  ++   + L+P     I+   +   +  S+G     
Sbjct: 78  LIAEAQRVNPNVRTAGMRILEARAQLMIAGSLLYPQQQ-QITGTVLRTGEERSSGPDSAL 136

Query: 119 -----QLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                 L   W+ID +G+ RR +E++ +   ++ AQ D  ++ + +++   Y   R  + 
Sbjct: 137 TAYNAGLAIGWEIDFWGKFRRSVEAADSGYFASIAQYDDLQVLMAAQVATFYCAIRTLEL 196

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
           R+ IAHQ   L K+++E++   F  G  S+L + + +A+  +  S IP LE S R   + 
Sbjct: 197 RLQIAHQNAALQKRSLEITERLFKHGNDSELDVQQAKAQYLATLSTIPQLEGSLRQTQNA 256

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  +L  P    L  M    N   P   + + + +PADL+R RPD+R  E +LA   A I
Sbjct: 257 LGVVLARPPGP-LSEMADGKNTI-PQAELGVIVDLPADLLRRRPDVRAVEMQLAAQSALI 314

Query: 293 GIAKSDLYPSLSLNGSIALTHDN-SFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           G++ +DLYPS++L GS+ L+  + S       W  GP L   +FD G++   +   ++  
Sbjct: 315 GVSVADLYPSIALLGSLGLSATSLSGSPRTLAWGVGPSLVWNVFDHGRLTGEVLVQDARF 374

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           Q+ Y  +   VL A +EV++A     ++++ V  L+ AV+  K+S++++ I YR+G  + 
Sbjct: 375 QQLYEQYHGAVLQAAREVDDAAVGFAKNREQVPILEEAVKAAKRSLAIASIQYREGLANF 434

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             +LD +R     +  L   +  +A+S V LY A+G G+ 
Sbjct: 435 ERVLDSQRTLFSQQERLVSNRGNVAQSLVALYKAMGGGWQ 474


>gi|254467519|ref|ZP_05080929.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhodobacterales bacterium Y4I]
 gi|206684520|gb|EDZ45003.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhodobacterales bacterium Y4I]
          Length = 465

 Score =  196 bits (499), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 133/451 (29%), Positives = 228/451 (50%), Gaps = 23/451 (5%)

Query: 13  VLLAGCTV-GPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQ 71
            LL GCTV G +Y +P   + P  +    S          WW+   D +L++LV   L Q
Sbjct: 6   TLLCGCTVAGRDYQRPAFAV-PASYYQTRSYATAQGAAETWWQGLKDAALDRLVAAGLAQ 64

Query: 72  NLTILQATERINAAKE------NILSVRADLFPSSYASISHRFIPNLKTN-STGQLDSDW 124
           NL I  A +R+ AA+           VR DL  SS  + S R   +  T+  + ++ + +
Sbjct: 65  NLDIKSARQRLKAAEAVRRASGRPEQVRGDLEGSS--AFSRRESQDGSTSLDSAEIGATY 122

Query: 125 KIDLFG--QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILD 182
             DLFG  QRR  E ++A+ D+ + Q+   +L +I  +  +YI+AR F+   ++  + ++
Sbjct: 123 VFDLFGGFQRRS-ERAVADRDAQFYQMATTRLAIIDAITRTYIEARFFQRGAAVTRKTIE 181

Query: 183 LYKKNIE-LSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPA 241
           L ++ +  +  LK  + A   L L + + ++ S ++D+P     +   V  ++TLL   A
Sbjct: 182 LRQQILATVEELKAAR-AVLALDLERTKLQVASAKADLPGFISGYEAAVFALATLLDRDA 240

Query: 242 TEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYP 301
           +E    MQ  S   QP+      +G+PA L+RNRPD+   E +L  + A IG+ +++LYP
Sbjct: 241 SEVFAMMQNSSG--QPHPSTQPELGVPASLLRNRPDVLLAEAQLRSATASIGVTEAELYP 298

Query: 302 SLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQET 361
           SL + GSI      +F G    +  GP L LP+F++  +++   RA + A+     ++  
Sbjct: 299 SLEVTGSI-----EAFRGLPDLYQIGPSLRLPLFNRPVLRAFHERAIAEAKATEYDYRAE 353

Query: 362 VLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERAT 421
           V  A++EV+   +++   ++       AV L  K   L+   +R    +L D+L+ E A 
Sbjct: 354 VRGAVEEVQAQQSALKAARERTAAQAQAVGLGGKVADLARETFRANEITLFDLLNTEEAL 413

Query: 422 AKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
              E+ L  A+R LA ++  L IA+G G+ P
Sbjct: 414 RDNELGLIAARRDLALAWSRLQIALGKGWAP 444


>gi|317047490|ref|YP_004115138.1| RND efflux system outer membrane lipoprotein [Pantoea sp. At-9b]
 gi|316949107|gb|ADU68582.1| RND efflux system, outer membrane lipoprotein, NodT family [Pantoea
           sp. At-9b]
          Length = 507

 Score =  196 bits (499), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 134/475 (28%), Positives = 238/475 (50%), Gaps = 47/475 (9%)

Query: 18  CTVGPEYTKPHMPL------LPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQ 71
           C VGP+Y  PH         LP+Q +   SK L       WW+SFND  L+ L+  A+  
Sbjct: 21  CAVGPDYQPPHAQTPTSYRDLPSQEA---SKPLSAATNPLWWQSFNDPLLDSLITRAIAD 77

Query: 72  NLTILQATERINAAKENILSVRADLFP--SSYASISHRFIP------------------- 110
           NLT+ QA  RI  A+E +      L P  S  A ++ + +                    
Sbjct: 78  NLTLQQAVLRIAGAREQLAQAGGGLLPTLSGSAKVTRQQLGLKGLLESNGVYDKVDSDVA 137

Query: 111 ---NLKTNST----GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIP 162
              N  T+S     G  D+ W++DL+G+ RR IE + A   +A  Q + A +++ +++  
Sbjct: 138 DQLNGLTHSVNLYQGSFDASWELDLWGKVRRQIEMANAQQQAAIEQRNDALVSLQAEVAR 197

Query: 163 SYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTL 222
           +Y+  R  +  +    + + + ++  EL+  +   G      +    A++ S+ + +P  
Sbjct: 198 AYLQLRGAQAVLQTLQEQIAIAQQTSELTQSQQRNGMAPLTDVENARAQLSSLNAQLPQY 257

Query: 223 EKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP--INIGIPADLIRNRPDIRY 280
           +   R  ++ ++ LLG    +    +  +  + +P   +P  +++GIPA L R RPDIR 
Sbjct: 258 QAQERQAMNGLAVLLG----KTPGALDSELASVKPLPALPKLVSVGIPATLARRRPDIRQ 313

Query: 281 QEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS--FPGYNTH-WSFGPKLYLPIFDK 337
            E  L    A IG++ ++L+PSLSL G + + + ++     +++H +S GP L +PIF  
Sbjct: 314 AEATLHAQTANIGVSVAELFPSLSLTGQLGVRNTDASYLDNWSSHFYSIGPSLSIPIFQG 373

Query: 338 GKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSM 397
           G++ SN++ A +      + +++TVL A+++VENAL S   D++ VT L       +++ 
Sbjct: 374 GQLVSNVKLARAQQANAALAYRQTVLTALQDVENALVSYRADQQQVTALDETTGALQRAF 433

Query: 398 SLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            L+  +YRQG  + L++LD +R  A+ +   +  + Q A   V LY A+G G+ P
Sbjct: 434 DLATDSYRQGISTFLEVLDAQRQLAQAQAQSTQVRMQTALDLVALYKALGGGWEP 488


>gi|145589051|ref|YP_001155648.1| RND efflux system outer membrane lipoprotein [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|145047457|gb|ABP34084.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 526

 Score =  196 bits (497), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 140/465 (30%), Positives = 240/465 (51%), Gaps = 40/465 (8%)

Query: 20  VGPEYTKP-------HMPLLPTQF--SIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQ 70
           VGP++++P       +     TQF  S+G + N I +D ++WW+SFND +LN L+K A  
Sbjct: 2   VGPDFSRPSVKAGDQYQATAKTQFTESLGENSNQI-LDPVEWWQSFNDPTLNALLKQAAS 60

Query: 71  QNLTILQATERINAAKENILSVRADLFPS-----SYASISHRFIPNLKTNSTGQL----- 120
           QNLT+ QA  RI   +  +    A + P+     SYA+  +  +  + TNS G L     
Sbjct: 61  QNLTLQQAAIRIYQLQAQLGVTDATILPTVALSGSYANTRNSNLQEI-TNSPGNLVFNNA 119

Query: 121 --DSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIA 177
               +W++D +G+ RR IESSL +  S  A    A +++ + +  +YI+ R+ +E I++A
Sbjct: 120 VVQLNWELDFWGKARRGIESSLNSYMSGVAAFYSADVSISADVANTYINIRNNEELIAVA 179

Query: 178 HQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLL 237
              L L K+++ ++  +F  GATS L L + +A+ +  ++ IP L  S +   H +S LL
Sbjct: 180 TTNLALQKESLRIAGARFKYGATSMLDLSQAQAQYEQTKAQIPALIASLKKTQHAMSILL 239

Query: 238 GYPATEFLHYMQKQSNNFQPNLYIP--INIGIPADLIRNRPDIRYQEKKLADSVAKIGIA 295
           G P      Y +K   N + +L  P  + +G+P DL+R RPD+   E   A   + IG+ 
Sbjct: 240 GEPP----DYYEKTYGNTKGSLKPPTELGVGMPRDLLRRRPDVLQAEFAAAAQSSLIGVN 295

Query: 296 KSDLYPSLSLNGSIALTHDNSFPGYNT----HWS-----FGPKLYLPIFDKGKIKSNIRR 346
           K+ L+P+ +L G+    + N F G +T     W+         L LP+F +G I   +R 
Sbjct: 296 KAQLFPTFTLGGNFGYANSN-FGGGSTGSLFSWANNSTGISAGLSLPLFYRGAIVDQVRV 354

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
            ++  Q+  + +Q  VLNA KEVE++L +I+  K  V      V   K +  +++  Y+ 
Sbjct: 355 QDAVFQQSILAYQNLVLNAQKEVEDSLIAISTSKSSVEDYTRGVIAAKSAADMALERYKA 414

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           G+     ++  +++   ++  L   K      YV  + A+G G++
Sbjct: 415 GQNDYNTVIVAQQSLLSIQNSLVQTKSNELIGYVGAFKALGGGWS 459


>gi|254499031|ref|ZP_05111726.1| putative outer membrane protein [Legionella drancourtii LLAP12]
 gi|254351742|gb|EET10582.1| putative outer membrane protein [Legionella drancourtii LLAP12]
          Length = 481

 Score =  196 bits (497), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 129/459 (28%), Positives = 232/459 (50%), Gaps = 32/459 (6%)

Query: 18  CTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQ-QNLTIL 76
           CTVGP Y KP  PL P ++S+    +        W +S  D  L + +  AL+  NL I 
Sbjct: 26  CTVGPNYHKPETPL-PEKYSLAKQNSPAKKTNQFWMDSLGDPLLIRFINQALRGNNLDIQ 84

Query: 77  QATERINAAKENILSVRADLFPSSYAS-----------------ISHRFIPNLKTNSTGQ 119
           +A   I  A+  +   +AD FP   AS                   +  +P   T+    
Sbjct: 85  KAYANICQARAELGISKADYFPQLDASGKISRDRLSANSEILVAFPNGIVPLNYTDYKFG 144

Query: 120 LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAH 178
            D+ W++D FG+ RR +E+S A   SA        ++  +++   Y   R +++RI IA 
Sbjct: 145 FDASWELDFFGRIRRGVEASRARFQSAIENQANVIISTAAEVANIYTQYRVYQKRIIIAQ 204

Query: 179 QILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG 238
             +  Y + ++L  L+   G+ + + L ++E+E+ S ++ +  L+   + ++  ++ L+G
Sbjct: 205 NTIKSYSETVKLVKLQMQAGSATGVDLSRVESEVLSAKATLMPLQAEAKASLAALAVLVG 264

Query: 239 -YPATEFLHYMQKQS-NNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
            YP +      Q       +P     + IG+P+DL+  RPDI+  E+ LA + A IG+A+
Sbjct: 265 EYPESLLDKLTQTAPIPTIKPT---SLAIGLPSDLLLRRPDIKIAERDLAAATADIGVAR 321

Query: 297 SDLYPSLSLNGSIALTHDNSFPGY-----NTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           ++ +P   L G I    D + PG      + +WSFGP++ LPIF  G++K+ +R  E++ 
Sbjct: 322 ANQFPRFQLVGDIG--SDTTIPGAFFKAASGYWSFGPQVSLPIFQGGRLKNAVRAQEAAR 379

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
                 +++TVL A+ +VE++L   N ++    K+Q +    K +  L  + Y+ G+ SL
Sbjct: 380 NNALANYKKTVLQALADVESSLIRYNRERLRKQKIQESYAKLKSAHRLIKLQYKTGQTSL 439

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +D+LD+ER   ++E   + +  Q+  + + LY A+G G+
Sbjct: 440 IDVLDVERQLNQLEDQQAQSTGQVTINLIALYKALGGGW 478


>gi|77458882|ref|YP_348388.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           fluorescens Pf0-1]
 gi|77382885|gb|ABA74398.1| outer membrane component of multidrug efflux system [Pseudomonas
           fluorescens Pf0-1]
          Length = 473

 Score =  195 bits (495), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 132/466 (28%), Positives = 235/466 (50%), Gaps = 29/466 (6%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK----WWESFNDTSLNKL 64
           SL ++ L+ C VGP+Y  P         +   +    N D  K    WW+ F+D +LN+L
Sbjct: 9   SLLVLALSACAVGPDYKTPTTEAANITSATDGAAGQKNFDRSKFEGIWWQQFDDPTLNQL 68

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL-KTNSTGQ---- 119
           V  +LQ N  +  A  R  AA+    ++R D+   +  +I+ R   +L K    GQ    
Sbjct: 69  VTQSLQGNRELRVAFARWKAAR----AIRDDVSNDAMPTITSRASSDLAKGQIPGQTTKR 124

Query: 120 ---------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                    LD  W++DLFG+ +R++E+S A+  +A A +   ++ +I++L+ +Y   R 
Sbjct: 125 VNSERYDLGLDMAWELDLFGRIQRNLEASDADQQAAEADLYQLQVTMIAELVDAYGQLRG 184

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
            + R  IA   L+  +++ +++      G   +L + + +A + S+E+ +P L+      
Sbjct: 185 AQLREKIALANLNNQQESRKITISLRDAGVGDQLDVERADARLASVEASVPQLQAEQARQ 244

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            + I+TLLG    +    +   S    P +   + IG P +L++ RPDI   E+KLA + 
Sbjct: 245 KNRIATLLGERPDKLTVDL---SPKDLPAIAKALPIGDPGELLQRRPDILSAERKLASAT 301

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           A+IG+AK+DL+P +SL+G +  T              W+ GP +    FD G +++ +R 
Sbjct: 302 ARIGVAKADLFPRVSLSGFLGWTAGRGSQIGSSAANAWALGPSITWAAFDLGSVRARLRG 361

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
           A++ A+    T+++ VL A++E ENA +   + ++ +  L    E  +K+  L+ I YR+
Sbjct: 362 ADADAEGALATYEQQVLLALEESENAFSDYGKRQQRLISLIRQSESSRKAADLAEIRYRE 421

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           G    L +LD +R     E   + A+  L +  V +Y A+G G+ P
Sbjct: 422 GTTDFLVLLDAQRERLNAEDSQAQAEVDLYRGIVAIYKALGGGWQP 467


>gi|294055909|ref|YP_003549567.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Coraliomargarita akajimensis DSM 45221]
 gi|293615242|gb|ADE55397.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Coraliomargarita akajimensis DSM 45221]
          Length = 484

 Score =  194 bits (494), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 135/469 (28%), Positives = 246/469 (52%), Gaps = 31/469 (6%)

Query: 6   AIFSLFIVLLAGCT-VGPEYTKPHMPLLPTQF--SIGNSKNLINIDTLKWWESFNDTSLN 62
           ++  LF   L GC  VG +Y +P + ++P  +   + +      + T +WW  FND  L 
Sbjct: 5   SVLGLFG--LTGCKIVGTDYEEPEL-VMPDAWHQRLADEAEAQTVVTEQWWGQFNDPVLV 61

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS---HRFIPNLKTN---- 115
            LV  AL  NL +  A ER+  A+E     ++ L+PS  A+      R   N+  +    
Sbjct: 62  GLVDSALAANLDLAIAYERVVQAREAKDVSKSGLWPSVDATAGFSRERNSENVGLSPAAG 121

Query: 116 --------STGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYID 166
                   STG LD  W++D+FG  +R +ES+ ANL +         + + +++  +YI+
Sbjct: 122 GGSTRNYYSTG-LDVAWELDVFGGVQRAVESADANLMATEESYRDFMVLLAAEVAGTYIE 180

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
            R   ER+ +A   +   +++++L+  +F  G   KL + + +  + + ++ +P L++S 
Sbjct: 181 LRTINERMELAEANIANQEESLKLALDRFDAGLAPKLDVSQAQTNLSNTQAFLPQLKQSR 240

Query: 227 RMNVHNISTLLG-YPA-TEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
              ++ ++TLLG Y A  E L    + S    PN  +     IP D++R RPDIR  E+ 
Sbjct: 241 TAELNRLATLLGLYAADVELLLGEAEGSIPVPPNAALST---IPVDMVRARPDIRAAERS 297

Query: 285 LADSVAKIGIAKSDLYPSLSLNGS---IALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIK 341
           LA   A+IG+A +DLYP   LNGS   +A    N     +  + +GP +   +F+ G+++
Sbjct: 298 LAAQNARIGVAAADLYPRFFLNGSFNLLATDSSNWIDAGSRSFGWGPGVRWNLFNAGRVR 357

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           S +   ES+ +  Y +++ +VL A++EVEN+++ I   ++ +  L+   E  ++++SL  
Sbjct: 358 SQVAIEESATRAAYYSYENSVLLAVEEVENSMSGIVNGRERLQALEQGTEAAREAVSLVK 417

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            NY +G     ++LD ER   + E + ++++  +A +YV L+ A+G G+
Sbjct: 418 ENYSRGLVDFQNVLDSERTLTQTEDNRALSQGSVASAYVGLFKALGGGF 466


>gi|330897820|gb|EGH29239.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. japonica str. M301072PT]
          Length = 465

 Score =  194 bits (494), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 136/462 (29%), Positives = 238/462 (51%), Gaps = 22/462 (4%)

Query: 7   IFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVK 66
           I SL ++ LA C VGP+Y  P         +   S +   +D   WW+ F D +LNKLV 
Sbjct: 8   IPSLLVMALAACAVGPDYRAPVTAPAKLASAAQGSYDRSKVDR-AWWQQFEDPTLNKLVA 66

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFP--SSYAS----------ISHRFIPNLKT 114
            +L  N  +  A  R+ +A+     V  D+ P  +S AS          I+ R + N + 
Sbjct: 67  RSLDGNRDLRVAFARLKSARAIRDDVANDVMPVVTSRASSDIGKGQQPGITERRV-NSER 125

Query: 115 NSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
              G LD  W++DLFG+ +R +E+S A+ ++A A +   ++ +I++++ +Y   R  + R
Sbjct: 126 YDLG-LDMAWEVDLFGRIQRQLEASDADQEAAEANLYQLQVTLIAEVVDAYGQLRGAQLR 184

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
            +IA   L   + + +++      G  ++L +V+ EA + ++E+ +P L+       + I
Sbjct: 185 EAIARDNLKNQQSSQDVTTQLRDAGVGNELDVVRAEARLAAVEATVPQLQAEQARQRNRI 244

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
           +TLLG         +   S +  P +   + IG P  ++RNRPDIR  E++LA S A+IG
Sbjct: 245 ATLLGERPENLSVDL---SPSKLPAIAKALPIGDPTQVLRNRPDIRAAERQLAASTARIG 301

Query: 294 IAKSDLYPSLSLNGSIALTHD-NSFPGYNTH--WSFGPKLYLPIFDKGKIKSNIRRAESS 350
           +A +DL+P +SL+G +  T    S  G +    WS GP +    FD G +++ IR A++ 
Sbjct: 302 VATADLFPRVSLSGFLGFTAGRGSQIGSSAARAWSLGPSITWAAFDLGSVRAQIRSADAD 361

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
           A+     +++ VL A++E ENA +  ++ ++ +  L    +  + +  L+ + YR+G   
Sbjct: 362 AEGALANYEQQVLLALEESENAFSDYDKRQQRLVSLMRQSDASRSAARLASVQYREGTAD 421

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            L +LD ER     E   + A+ +L    V +Y A+G G+ P
Sbjct: 422 FLVLLDAERERLAAEDAQAQAEIELYHGIVAIYKALGGGWQP 463


>gi|302186718|ref|ZP_07263391.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. syringae 642]
          Length = 465

 Score =  194 bits (493), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 138/463 (29%), Positives = 241/463 (52%), Gaps = 24/463 (5%)

Query: 7   IFSLFIVLLAGCTVGPEYTKP-HMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
           I SL ++ LA C VGP+Y  P   P      + GN  +   +D + WW+ F D +LNKLV
Sbjct: 8   IPSLLVMALAACAVGPDYQAPVTAPAKLASAAQGN-YDRSKVDRV-WWQQFEDPTLNKLV 65

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFP--SSYAS----------ISHRFIPNLK 113
             +L  N  +  A  R+ +A+     V  D+ P  +S AS          I+ R + N +
Sbjct: 66  ARSLDGNRDLRVAFARLKSARAIRDDVANDVMPVVTSRASSDIGKGQQPGITERRV-NSE 124

Query: 114 TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
               G LD  W++DLFG+ +R +E+S A+ ++A A +   ++ +I++++ +Y   R  + 
Sbjct: 125 RYDLG-LDMAWEVDLFGRIQRQLEASDADQEAAEANLYQLQVTLIAEVVDAYGQLRGAQL 183

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
           R +IA   L   + + +++      G  ++L +V+ EA + ++E+ +P L+       + 
Sbjct: 184 REAIARDNLKNQQSSQDVTTQLRDAGVGNELDVVRAEARLAAVEATVPQLQAEQARQRNR 243

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           I+TLLG         +   S +  P +   + IG P  ++RNRPDIR  E++LA S A+I
Sbjct: 244 IATLLGERPENLSVDL---SPSKLPAIAKALPIGDPTQVLRNRPDIRAAERQLAASTARI 300

Query: 293 GIAKSDLYPSLSLNGSIALTHD-NSFPGYNTH--WSFGPKLYLPIFDKGKIKSNIRRAES 349
           G+A +DL+P +SL+G +  T    S  G +    WS GP +    FD G +++ IR A++
Sbjct: 301 GVATADLFPRVSLSGFLGFTAGRGSQIGSSAARAWSLGPSITWAAFDLGSVRAQIRSADA 360

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
            A+     +++ VL A++E ENA +  ++ ++ +  L    +  + +  L+ + YR+G  
Sbjct: 361 DAEGALANYEQQVLLALEESENAFSDYDKRQQRLVSLMRQSDASRSAARLASVQYREGTA 420

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
             L +LD ER     E   + A+ +L    V +Y A+G G+ P
Sbjct: 421 DFLVLLDAERERLAAEDAQAQAEIELYHGIVAIYKALGGGWQP 463


>gi|322832671|ref|YP_004212698.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rahnella sp. Y9602]
 gi|321167872|gb|ADW73571.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rahnella sp. Y9602]
          Length = 560

 Score =  194 bits (492), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 125/483 (25%), Positives = 240/483 (49%), Gaps = 52/483 (10%)

Query: 16  AGCTVGPEYTKPHMPLLPTQFSI--------GNSKNLINIDTLKWWESFNDTSLNKLVKI 67
           A C+VGP+Y KP+ P+ P+ ++         G S  L +     WW++FND  L+ L+  
Sbjct: 54  AACSVGPDYQKPN-PVTPSAYNDMTQPKDKDGASIALPSEPNPLWWKAFNDPQLDSLITR 112

Query: 68  ALQQNLTILQATERINAAKENILSVRA--------------------------------- 94
           A+  N+++ QA  RI  A+E +                                      
Sbjct: 113 AIAGNISLQQAVLRIAGAREQVKQAEGAWLPSVQGSAKMTRQQLGLKGILDSSGASQQLD 172

Query: 95  DLFPSSYASISHRFIP-NLKTNSTGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIA 152
           DL P +  +IS    P NL     G  D+ W++DLFG  RR +E++ A   S+  Q + A
Sbjct: 173 DLGPEASGAISTATRPVNLYQ---GNFDASWELDLFGGTRRQVEAANAQTQSSIEQRNDA 229

Query: 153 KLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEI 212
            +++ +++  +Y+  R  +   +     +D+ ++ ++L+  +   G + +L +    A++
Sbjct: 230 LVSLEAEVARAYLQLRGAQSVTAAIQTQIDVAQQTLDLTQNRQQNGLSPQLDVENARAQL 289

Query: 213 KSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLI 272
            S+ + +P  +   R  ++ ++ LLG         +   +    P L   + +G+P+ L 
Sbjct: 290 GSLRAQLPQYQAQERQAMNGLAVLLGQTPGSLDAELS--APKPMPALPAAVPVGVPSQLA 347

Query: 273 RNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTH-DNSF-PGYNTH-WSFGPK 329
           R RPD+R  E  L  + A IG++ + ++PS+SL G   + + D S+   +++H +SFGP+
Sbjct: 348 RRRPDVRKAEADLHAATANIGVSVAQMFPSISLTGQFGMRNTDVSYLDNWSSHFYSFGPQ 407

Query: 330 LYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHA 389
           + LPIF  G++ S++  + +      + +++TVL A+++V+NAL +   D+  V+ L   
Sbjct: 408 ISLPIFQGGRLVSSVHLSRAQQANAALNYRQTVLTALQDVDNALVNYRTDQDQVSGLDQT 467

Query: 390 VELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
            +  + +  L+  +YRQG  + +++LD +R  A+     + AK + +   V LY A+G G
Sbjct: 468 TKALQTAFDLASDSYRQGLSTFINVLDAQRQLAQAHQQSAEAKVKTSTDLVSLYKALGGG 527

Query: 450 YNP 452
           + P
Sbjct: 528 WEP 530


>gi|53802442|ref|YP_112818.1| outer membrane efflux family protein [Methylococcus capsulatus str.
           Bath]
 gi|53756203|gb|AAU90494.1| outer membrane efflux family protein [Methylococcus capsulatus str.
           Bath]
          Length = 518

 Score =  193 bits (491), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 126/460 (27%), Positives = 235/460 (51%), Gaps = 31/460 (6%)

Query: 17  GCT-VGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTI 75
           GC  +GP++ +P + L  T       K     D   WW+ FND  L++L++ A +QNL +
Sbjct: 28  GCNKIGPDFHRPEIKLTDTWLD-APKKAAKAGDFRNWWKLFNDPVLDRLIEKAYRQNLDV 86

Query: 76  LQATERINAAKENILSVRADLFPSS--------YASISHRFIPNLKTNS--------TGQ 119
            +A  RI  A+  +   +  LFP          Y  IS  + P  + +         TG 
Sbjct: 87  QKAAIRIYQARAQLGIAKGYLFPQKQNVGMDTFYERISE-YSPYYQGSDFHTFTYFQTG- 144

Query: 120 LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAH 178
            D+ W++D++G+ RR I+++ A L ++  Q D   + + +++  +Y+  R F +R+++A 
Sbjct: 145 FDAMWELDIWGRFRRGIDAAGAELAASTLQYDDMVVTLTAEVAAAYVQIRTFNQRLALAK 204

Query: 179 QILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG 238
              DL +++  ++  +F  G +++L + + +A  ++  ++I  LE   R + + +S LLG
Sbjct: 205 GNADLQERSFRVAESQFRNGLSTELDMQQAKALHQATLAEIANLEVGLRQSKNALSVLLG 264

Query: 239 YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSD 298
              +     +   S+   P     I +GIP D++R RPD+R QE K A   A+IGIA+S+
Sbjct: 265 MQPSHLEKELGPDSDI--PAARSEIAMGIPTDILRRRPDVRAQEYKAASQCAQIGIAESE 322

Query: 299 LYPSLSLNGSIALTHD--------NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESS 350
           L P LSL G++             N+         FGP +  PIF  G++ +N+R  ++ 
Sbjct: 323 LLPRLSLVGTVGFNSGSVDGLDVANAISPSGLAGKFGPTVIWPIFQYGRLTNNVRVQDAK 382

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
            QE    ++ TVL A++EVE+A+ +  + ++ V  L   V   +++  L++  Y+ G   
Sbjct: 383 FQELLTDYRSTVLRALREVEDAIIAFKKAEERVASLSDGVRASQRAAELALRQYQNGLED 442

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              +L+ E    + +  L+ ++  +A+S + +Y A+G G+
Sbjct: 443 YTRVLNSELFLVQQQDRLTASRGDVARSVIAMYKALGGGW 482


>gi|160901087|ref|YP_001566669.1| RND efflux system outer membrane lipoprotein [Delftia acidovorans
           SPH-1]
 gi|160366671|gb|ABX38284.1| RND efflux system, outer membrane lipoprotein, NodT family [Delftia
           acidovorans SPH-1]
          Length = 501

 Score =  193 bits (491), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 130/478 (27%), Positives = 233/478 (48%), Gaps = 37/478 (7%)

Query: 7   IFSLFIVLLAGCTVGPEYTKPHMPLLPTQFS----IGNSKN---LINIDTLKWWESFNDT 59
           +F +   L AGC VGP+Y +P  P LP  +     +G +K      + D   WW +F D 
Sbjct: 8   VFLMLASLCAGCAVGPDY-QPPAPALPQAYMGSRVLGETKPPSPASSTDLAAWWAAFGDP 66

Query: 60  SLNKLVKIALQQNLTILQATERI----------NAAKENILSVRADLFPSSYASISHRF- 108
            + +LV  ALQQNL + QA  R+           AA      + A     SY S+     
Sbjct: 67  QMARLVTAALQQNLDVAQAAGRVLQARAGLDAAAAALLPSAQISAQTA-RSYQSVETPLG 125

Query: 109 -----IPNLKTNSTGQ---LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISK 159
                +P      + Q   L + W++DLFG  RR  ++SLA   ++ A     +L V ++
Sbjct: 126 RVLDSMPGFDRYGSAQEANLGASWELDLFGGLRRARQASLAEYQASEAGATAVRLAVAAQ 185

Query: 160 LIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDI 219
              +YI  R  + R+++A   +   ++   +  L+F +G + +L L ++E  +   ++ +
Sbjct: 186 TADTYIQIRGLQARLAVARSQVQAQQQLRSIVELRFGKGLSPELQLRQVEGALARAQATV 245

Query: 220 PTLEKSFRMNVHNISTLLG-YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDI 278
           P LE +    ++ +  +L   P T        +     P L +      P DL+R RPD+
Sbjct: 246 PPLENALEAALNAMDVMLATAPGTHRAELADPRPVPVLPTLSL---AEAPGDLLRRRPDL 302

Query: 279 RYQEKKLADSVAKIGIAKSDLYPSLSLNGSIA----LTHDNSFPGYNTHWSFGPKLYLPI 334
              E++LA S A+IG+A ++ YP LS++G I     ++  N F    +  S    L   +
Sbjct: 303 IAAERRLAASNARIGVAIAEYYPKLSISGLIGSATSISAGNLFSAGASQASVVGGLRWRL 362

Query: 335 FDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHK 394
           FD G+I + I +A++   E    ++++VL A +EVENAL S+++ ++++T L    +   
Sbjct: 363 FDFGRINAQIHQAQAQEAESLAAYRQSVLRATEEVENALVSLDKRQELMTVLARGADALT 422

Query: 395 KSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           ++   +   Y +G  SL+++L  + +   V    ++A+ + A+S V ++ A+G G+ P
Sbjct: 423 RARQAAGAAYDKGVVSLIEVLQADESLLGVLDAQALARTESARSTVAIFKALGGGWTP 480


>gi|260597214|ref|YP_003209785.1| hypothetical protein CTU_14220 [Cronobacter turicensis z3032]
 gi|260216391|emb|CBA29452.1| hypothetical protein CTU_14220 [Cronobacter turicensis z3032]
          Length = 515

 Score =  193 bits (491), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 131/485 (27%), Positives = 242/485 (49%), Gaps = 58/485 (11%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDT--------LKWWESFNDTSLNKLVKIA 68
           GC VGP+Y +P  P+ P  F     +N  ++ +         +WW +F    L+ L++ A
Sbjct: 22  GCAVGPDY-QPPSPVTPGAFGETARQNAPDVASKARNTAPDPRWWRTFKSPQLDSLIERA 80

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPSSYASI--------------SHRFIPNLKT 114
           +  NL++ Q   RI  A+E I       FP+   ++              SH     L  
Sbjct: 81  IAGNLSLQQTVLRIAGAREQINQAGGAFFPAVNGNLRATRQQLGLEGELKSHDVYGQLNN 140

Query: 115 NS-----------------TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNV 156
                               G  D+ W+IDL+G+ RR +E++ A   +A  Q + A +++
Sbjct: 141 VDPQISSALGPLTQPINLYQGSFDAQWEIDLWGKVRRQVEAADAQQKAAIEQRNDALVSL 200

Query: 157 ISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE 216
            +++  +++  R  +  ++  +Q +   ++ +EL+  +   G + +L +    A++ +++
Sbjct: 201 EAEVARAWLQLRGAQSILATMNQQIASAQQTLELTESRQQSGLSPQLDVENARAQLGTLQ 260

Query: 217 SDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP--INIGIPADLIRN 274
           + +P  +   R  ++ ++ LLG P       +Q      QP   +P  + +GIP+ L R 
Sbjct: 261 AQLPQYQAQERQAMNGLAVLLGKPPGALDAELQA----AQPLPALPEIVPVGIPSTLARR 316

Query: 275 RPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWS-----FGPK 329
           RPD+R  E +L  + A+IG++ + L+PSLSL+G   +   NS   Y T WS     FGP+
Sbjct: 317 RPDVREAEARLHAATAQIGVSVAQLFPSLSLSGQFGMR--NSETNYLTDWSSHFYSFGPQ 374

Query: 330 LYLPIFDKGKIKSNIR--RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQ 387
           + +PIF  G++ S+++  RAE  A    + +++TVL A+ +VENAL S   D++    L+
Sbjct: 375 VSIPIFQGGRLVSSVKLTRAEQGAAA--LQYRQTVLTALSDVENALVSYRTDQQREAGLE 432

Query: 388 HAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIG 447
             ++  + S  L+  +YR+G  + +++LD +R  A+ E   + A+ Q +   V LY A+G
Sbjct: 433 KTLDALQTSFELASDSYRKGIATFIEVLDAQRQLAQAEQQRAQARVQSSLDLVALYKALG 492

Query: 448 SGYNP 452
            G+ P
Sbjct: 493 GGWEP 497


>gi|53804520|ref|YP_113823.1| outer membrane efflux family protein [Methylococcus capsulatus str.
           Bath]
 gi|53758281|gb|AAU92572.1| outer membrane efflux family protein [Methylococcus capsulatus str.
           Bath]
          Length = 558

 Score =  193 bits (491), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 127/463 (27%), Positives = 231/463 (49%), Gaps = 24/463 (5%)

Query: 13  VLLAGCT--VGPEYTKPHMPLLPTQFSIGNSK-NLINIDTLKWWESFNDTSLNKLVKIAL 69
           VL  GC+  +GP+Y  P   + P      + + +    D  +WW  F D  LNKLV+ A 
Sbjct: 51  VLAGGCSTKIGPDYQTPETRVSPDWLESEDRRVSRKEGDFREWWRVFKDPVLNKLVETAY 110

Query: 70  QQNLTILQATERINAAKENILSVRADLFPSSYA--SISHRF-IPNLKTNSTGQ------- 119
            QNL +  A  RI  ++  +     +LFP S A    +  F +P L+    G        
Sbjct: 111 SQNLPLQIAAVRILGSRAELGIATGNLFPQSQAFQGQTEDFGMPLLRNLGLGDSLWYTRI 170

Query: 120 -LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIA 177
            + S+W+ID++G+ RR IES+ A L ++ A+ D   + + + +  +Y+  R  ++R+ IA
Sbjct: 171 GVMSNWEIDIWGKYRRAIESADAQLMASVAEYDDILVTLTADVANTYVQIRTLEKRLDIA 230

Query: 178 HQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLL 237
              ++   +++ ++  KF  G +++  + +    + S ++ IP LE   R   + +  LL
Sbjct: 231 RHNVETQSESLRIADAKFHGGTSTQRDVEQARTVLASTQATIPVLEGQLRQAKNTLCYLL 290

Query: 238 GYPATEFLHYMQKQSNNFQ-PNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
           G    +    +  ++   Q P   + + +GIPADL+R RPD+R  E+  A   A+IGIAK
Sbjct: 291 GMTPEKLDEPLGGEAQFGQIPAPPVQVAVGIPADLLRRRPDVRRAERSAAAQSARIGIAK 350

Query: 297 SDLYPSLSLNGSIALTHDNS--------FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
           + LYP+ S++GS      NS        F     +++FGP +   +F+ G++ + +R  +
Sbjct: 351 ASLYPAFSISGSFGFIATNSQGHSLSDIFNWGQHYYAFGPSVQWNLFNYGQLTNQVRAQD 410

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           +  QE  +++Q TVL A +E E+AL    + +     L  +    ++S+ L+ + YR+G 
Sbjct: 411 ARFQELALSYQNTVLKAQQEAESALIGFLKAQNSAQFLAESTAAAQRSLDLATLQYREGI 470

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
                +L  E+   K + + +     +A + V +Y  +G G+ 
Sbjct: 471 TDFTTVLTAEQDLLKQQDNFAQTLGNIATNLVGVYRTLGGGWQ 513


>gi|330980897|gb|EGH79000.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. aptata str. DSM 50252]
          Length = 465

 Score =  193 bits (490), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 135/462 (29%), Positives = 237/462 (51%), Gaps = 22/462 (4%)

Query: 7   IFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVK 66
           I SL ++ LA C VGP+Y  P         +   S +   +D   WW+ F D +LNKLV 
Sbjct: 8   IPSLLVMALAACAVGPDYRAPVTAPAKLASAAQGSYDRSKVDR-AWWQQFEDPTLNKLVA 66

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFP--SSYAS----------ISHRFIPNLKT 114
            +L  N  +  A  R+ + +     V  D+ P  +S AS          I+ R + N + 
Sbjct: 67  RSLDGNRDLRVAFARLKSGRAIRDDVANDVMPVVTSRASSDIGKGQQPGITERRV-NSER 125

Query: 115 NSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
              G LD  W++DLFG+ +R +E+S A+ ++A A +   ++ +I++++ +Y   R  + R
Sbjct: 126 YDLG-LDMAWEVDLFGRIQRQLEASDADQEAAEANLYQLQVTLIAEVVDAYGQLRGAQLR 184

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
            +IA   L   + + +++      G  ++L +V+ EA + ++E+ +P L+       + I
Sbjct: 185 EAIARDNLKNQQSSQDVTTQLRDAGVGNELDVVRAEARLAAVEATVPQLQAEQARQRNRI 244

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
           +TLLG         +   S +  P +   + IG P  ++RNRPDIR  E++LA S A+IG
Sbjct: 245 ATLLGERPENLSVDL---SPSKLPAIAKALPIGDPTQVLRNRPDIRAAERQLAASTARIG 301

Query: 294 IAKSDLYPSLSLNGSIALTHD-NSFPGYNTH--WSFGPKLYLPIFDKGKIKSNIRRAESS 350
           +A +DL+P +SL+G +  T    S  G +    WS GP +    FD G +++ IR A++ 
Sbjct: 302 VATADLFPRVSLSGFLGFTAGRGSQIGSSAARAWSLGPSITWAAFDLGSVRAQIRSADAD 361

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
           A+     +++ VL A++E ENA +  ++ ++ +  L    +  + +  L+ + YR+G   
Sbjct: 362 AEGALANYEQQVLLALEESENAFSDYDKRQQRLVSLMRQSDASRSAARLASVQYREGTAD 421

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            L +LD ER     E   + A+ +L    V +Y A+G G+ P
Sbjct: 422 FLVLLDAERERLAAEDAQAQAEIELYHGIVAIYKALGGGWQP 463


>gi|295701080|ref|YP_003608973.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. CCGE1002]
 gi|295440293|gb|ADG19462.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. CCGE1002]
          Length = 504

 Score =  193 bits (490), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 127/465 (27%), Positives = 229/465 (49%), Gaps = 27/465 (5%)

Query: 5   RAIFSLFIVLLAGCTVGPEYTKPHMPLLPT-QFSIGNSKNLINIDTLKWWESFNDTSLNK 63
           R + S+ ++ L+GC +GP Y +P + +  T +F+ G +  + N     WWE F D  LN+
Sbjct: 8   RLLASVMLLALSGCLLGPNYQRPAVDVPATYRFAQGEAAGIANA---AWWEQFQDPVLNQ 64

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFP--SSYASISHRFIPNLKTNST---- 117
           L+  ALQ N  +  A  R++  +   ++ R+ LFP  S+ A  S + +  ++  +     
Sbjct: 65  LIATALQDNRDVKVAAARVDEFRGMFVTTRSGLFPQVSAGADASRQRVSQVEAVTVPKGV 124

Query: 118 ----GQLDS----DWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
                Q D+     W++DLFG+ RR  E++ ANL ++        L ++S +  +YI+ R
Sbjct: 125 SPVYNQFDATLAVSWELDLFGKVRRETEAARANLLASEEGRRATILTLVSSVASAYINLR 184

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
               ++ IA + +    +++ +   +F  G  S++ L + ++E ++ +  +P LE     
Sbjct: 185 SLDRQLEIAKETVQSRAESVRVFEARFRYGEVSQMELAQSQSEYQAAQVTVPQLEAQIGQ 244

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
               +S L+G      L   ++ S    P    PI  G+P++L+  RPD+   E+ L   
Sbjct: 245 QEDALSVLIGRNPGAILR-GRELSQMGTP----PIPEGLPSELLERRPDLLEAEQTLVAQ 299

Query: 289 VAKIGIAKSDLYPSLSLNG---SIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
            A IG A++  +PS+SL G   S++    N F G    WSF   +  PIF  G I   + 
Sbjct: 300 NALIGAARALYFPSISLTGLFGSVSAQFSNLFTGPARVWSFAGSVTQPIFTAGNITGQVH 359

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
           +AE+  QE   ++++ +  A +EVE++L S+ +  + +      VE       L+   Y 
Sbjct: 360 QAEARQQEALYSYEKAIQVAFQEVEDSLISVQKTHQALDAQNLQVEALVTYARLARQRYE 419

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            G  S +++LD ER+    ++  +  +  +  SYV LY A G G+
Sbjct: 420 GGYTSYIEVLDAERSLFNAQLSYAQTQGAVLTSYVTLYKATGGGW 464


>gi|224368738|ref|YP_002602899.1| RND efflux transporter, outer membrane lipoprotein
           [Desulfobacterium autotrophicum HRM2]
 gi|223691454|gb|ACN14737.1| RND efflux transporter, outer membrane lipoprotein
           [Desulfobacterium autotrophicum HRM2]
          Length = 513

 Score =  192 bits (489), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 116/465 (24%), Positives = 239/465 (51%), Gaps = 18/465 (3%)

Query: 3   ILRAIFSLFIVLLAGCT-VGPEYTKPHMPLLPTQFS--IGNSKNLINIDT---LKWWESF 56
           +L  + ++F+ L  GC  VGP+Y  P    +P +++  +    + + +D+     WW   
Sbjct: 42  VLFVLVTVFMALSGGCVPVGPDYVAPGFNRMPGRWTPEMTGGMSAVPLDSKALASWWIVL 101

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS--SYASISHRFIPNLKT 114
           +D  L  L+  A+  NL + +    +  A+  +L    D FP+  + AS   R+  +   
Sbjct: 102 DDPVLTGLITRAIDVNLDLRKTRAVLREARARLLISGTDAFPTIKTDASAVRRYQDDESG 161

Query: 115 NS-TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
           +S     D+ W++D+FG+ +R  E++ A+L++    +   ++++++++  +YI  R F+ 
Sbjct: 162 SSYNAGFDAFWEMDVFGRVQRAREAATADLEADQESMGDVRVSLVAEVALNYIGVRSFQA 221

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
           R++IA + L + ++ ++L+  +   G TS+L + +  + ++   + +P L+      ++ 
Sbjct: 222 RLAIAQKSLAVQEETLQLTQWQRQAGLTSQLDVEQARSSLEETRASVPDLQTGLGQVMNQ 281

Query: 233 ISTLLG-YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
           ++ LLG YP T +            P   + I +G+PA+++R  P +R  E++LA   A+
Sbjct: 282 LALLLGQYPGTLYKALSVPAPVPVAP---MEIAVGVPAEVLRRIPTVRQAERQLAAQTAR 338

Query: 292 IGIAKSDLYPSLSLNGSIAL----THDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
           +G+A ++ YP  +LNGSI       HD  F   +  +S GP     +FD G+++ NI   
Sbjct: 339 VGVATAEQYPQFTLNGSIGFDALSIHDLLFESASRIFSIGPAFSWTLFDAGRLRQNIEVQ 398

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
            +  Q+  I +++ VL A+K+VE+AL +   ++     L  A    + ++ L+   Y  G
Sbjct: 399 NALTQQAAIEYEKAVLTALKDVEDALVAYGGEQVRRQSLLGASTAQQDALDLARDQYASG 458

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
             +   +LD +R+   ++  L+++   +    + LY A+G G+ P
Sbjct: 459 MVNFQVVLDAQRSLLSLQNQLAVSNGAVTSDLIRLYKALGGGWTP 503


>gi|162147397|ref|YP_001601858.1| outer membrane protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|161785974|emb|CAP55555.1| outer membrane protein [Gluconacetobacter diazotrophicus PAl 5]
          Length = 482

 Score =  192 bits (489), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 136/472 (28%), Positives = 231/472 (48%), Gaps = 32/472 (6%)

Query: 6   AIFSL-FIVLLAGCTVGPEYTKPHM---PLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
           A F+L   + LAGCTVGP + +P +   P    +   G+      IDT +WW SF+D  L
Sbjct: 9   AAFALPLAIALAGCTVGPAFHRPRIDAPPAWGAEPKAGSQTYAGAIDT-RWWRSFDDAEL 67

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSS-------YASISHRFIPNLKT 114
             LV    +QNL +  A +RI  A+  + +V A   P +       Y  +S   I +L  
Sbjct: 68  TGLVDRLGRQNLDLQIAAQRIREARAQMKAVAAAGLPQANWSGSYAYRQLSTHGIFSLAE 127

Query: 115 NSTGQ----------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPS 163
            S G           L + W +DLFG  RR +E+  A+  +A A    A L  +S L  S
Sbjct: 128 PSPGASLNFNLYSNVLSTSWDLDLFGAIRRGVEAQRADQSAALAARRAAALAAVSDLAAS 187

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  R  + +  I    + L + N++L   +F  G  + L + +  A++ S+ES +P LE
Sbjct: 188 YMQLRGVQAQQVILQSNIALARTNLQLVRDRFANGVAANLDVSQAAAQLASMESGLPELE 247

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
            +    ++ I  LL  P       ++ +S   QP L + + +G+P DL R RPDI   E 
Sbjct: 248 NAEAALINAIGLLLSEPPRALEGELKNRSP--QPRLPVSVPVGLPLDLTRRRPDILEAEA 305

Query: 284 KLADSVAKIGIAKSDLYPSLSLNG-----SIALTHDNSFPGYNTHWSFGPKLYLPIFDKG 338
           +L  + A++G A +  YP ++L G     S A +   S P     +S GP L +P+F  G
Sbjct: 306 RLHAATAEVGAAIAAFYPDITLAGNMGTESFAASDFFSLPA--KQFSVGPTLNVPVFQGG 363

Query: 339 KIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMS 398
           ++ + +   +++ QE  +TW+ TVLNA +E ++ALT+  + +      + A+   + + +
Sbjct: 364 RLIARLAFRKAAQQEAVLTWRNTVLNAWREADDALTAYAKSQSTHALTEQALLQDRAAYT 423

Query: 399 LSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            +   Y +G    L+++  + A    +  L+ ++ +   + V LY A+G G+
Sbjct: 424 AARQRYGEGATDYLNVVATQAALLSTQSALADSQTRSETTLVALYRALGGGW 475


>gi|332188540|ref|ZP_08390260.1| efflux transporter, outer membrane factor (OMF) lipo, NodT family
           protein [Sphingomonas sp. S17]
 gi|332011445|gb|EGI53530.1| efflux transporter, outer membrane factor (OMF) lipo, NodT family
           protein [Sphingomonas sp. S17]
          Length = 491

 Score =  192 bits (488), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 132/463 (28%), Positives = 232/463 (50%), Gaps = 34/463 (7%)

Query: 17  GCTVGPEYTKPHMPLL--PTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           GCTVGP+Y       L  P Q+S+  + N    D  +WW SF+D  L +LV+ A+  N  
Sbjct: 17  GCTVGPDYRPAASSELGVPDQWSV-PAANAQAQDLTRWWRSFDDPLLVELVEQAVVANTD 75

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK--------------------T 114
           + QA  R+  A+E+++  RA L P+   S  ++   NL+                    +
Sbjct: 76  VAQAIARLRQARESLIQSRAALLPTVSGSTGYQRNENLRGGGRSFTLPDGTVVDTGGGGS 135

Query: 115 NS-TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
           NS T  L + +++ LFG+ RR +E++ A  + A        L V S+L  +Y+ AR ++ 
Sbjct: 136 NSFTVGLSASYQVGLFGEVRRTVEATRATYEGAGFSYAATLLTVESELARNYMLARAYQA 195

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
           +++ A   L L   N+E++  +   G  S L   +  ++     + IP++E+ +   V  
Sbjct: 196 QLANARASLALQDDNLEIAGFRVQAGLVSSLDAEQARSQRAQTAATIPSIEQQYNAAVSR 255

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIP--INIGIPADLIRNRPDIRYQEKKLADSVA 290
           +  L      +    ++ +    +P    P  I +GIPAD++R RPD+R  E+ LA + A
Sbjct: 256 LGVLT----AQAPGALKSRLAAVRPIPRGPAAIGVGIPADILRRRPDVRAAERNLAAATA 311

Query: 291 KIGIAKSDLYPSLSLNGSI--ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
           +IG+A++ LYP+L+++G+I  A T   S  G     S    L   IF+ G+++S +R A 
Sbjct: 312 RIGVAQAALYPALAISGNINTAATSLGSL-GDAITGSLFAGLTQAIFNGGRLRSQVRSAR 370

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           + A++ Y  +Q TVL A+++VENA+ ++N  ++   +    ++  + S  L+   YR G 
Sbjct: 371 AVAEQNYAAYQGTVLLALEDVENAIVALNTARERERQFAIQLDAARNSAILARSQYRTGL 430

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
                +   E A    +  L  A+   A + V L+ A+G G++
Sbjct: 431 TDFTTLSQQEAALLSAQNGLVQARSDAATAQVSLFAALGGGWD 473


>gi|78047099|ref|YP_363274.1| outer membrane efflux protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78035529|emb|CAJ23175.1| outer membrane efflux protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 474

 Score =  192 bits (488), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 122/428 (28%), Positives = 215/428 (50%), Gaps = 24/428 (5%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIA 68
           +L  ++L+GC VGP+Y +P  P   T     +           WW  F+D  L +LV+ A
Sbjct: 9   ALAALVLSGCAVGPDY-RPDPPAAVTLQGAQDPAYSAQSPVGNWWSQFDDPVLEQLVRDA 67

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPSSYASIS-------------HRFIPNLKTN 115
           L  N  +  A  R+  A+   +  R D  P   A  S              RF   L   
Sbjct: 68  LFANHDLRIAVARVKQARAVFVERRLDQAPHITAQGSFDRREQQQVIAGNQRF---LTEQ 124

Query: 116 STGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
           +T  LD+ W++DLFG QRR  E++ A+LD+  A +   ++ V +++  +Y + R  ++R+
Sbjct: 125 TTLGLDAAWELDLFGRQRRASEAARADLDAEQANLQDVQVTVAAEVARNYFELRGTQKRL 184

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
            ++ + L   +   +L+  ++  GA S+L +    A +K+IE+DIP LE +     H ++
Sbjct: 185 DVSKRTLTNLRDTQKLTQTRWDLGAGSELDVQSSLARLKAIEADIPLLETAEAQYRHRLA 244

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
            LLG         +  +     P    P+ +G  A L+R RPD+R  E++LA + A++G+
Sbjct: 245 VLLGQQPDALDATLAARE---MPAFARPLPLGDTAGLLRQRPDVRGAERRLAAATAQVGV 301

Query: 295 AKSDLYPSLSLNGSIA-LTHDNS--FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           A +DL+P +S++G +  LT D +    G    WS  P +    FD G +++ +R +++ A
Sbjct: 302 ATADLFPRISVSGFVGFLTGDAARLTEGNAKAWSVTPSISWAAFDFGTVRARLRASKAQA 361

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           +     +Q+TVL A+++ ENAL   +  +  +  +       +++  L+ I YR+G    
Sbjct: 362 EGALAQYQQTVLLALEDTENALIGYDRQQGRLAIVVEQANAARRAEQLAQIRYREGSEDF 421

Query: 412 LDILDIER 419
           L +LD +R
Sbjct: 422 LTLLDAQR 429


>gi|85858611|ref|YP_460813.1| type I secretion outer membrane protein [Syntrophus aciditrophicus
           SB]
 gi|85721702|gb|ABC76645.1| type I secretion outer membrane protein [Syntrophus aciditrophicus
           SB]
          Length = 516

 Score =  192 bits (487), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 136/470 (28%), Positives = 226/470 (48%), Gaps = 36/470 (7%)

Query: 5   RAIFSLFIVL-LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNK 63
           ++IF++ IVL LAGC VGP+Y +P +   P  + I +         + WW+  ND  +N 
Sbjct: 40  KSIFAILIVLVLAGCAVGPDYRRPVIES-PPAWRI-DEVEAQETANMAWWDQLNDPVMNS 97

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFP---------------SSYASISHRF 108
           L+  AL+QNL +  AT RI+         R+ LFP                  A +S + 
Sbjct: 98  LIDEALKQNLDLKIATARIDEYIGRYWMGRSGLFPQIGVTAEAGRSRSSEEGAAPMSPQ- 156

Query: 109 IPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
           + N      G     W+IDL+G+ RR  E+S A+L +         L+++S +   YI  
Sbjct: 157 VENPADFYQGFFSGSWEIDLWGKLRRATEASRADLLATQEARQAVILSLVSAVANGYITL 216

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
           R F ++  IA       +++ +L   +F  G  S+L L ++++E +   + IP +EK   
Sbjct: 217 RDFDKQREIAVNTAKTREESYKLFKQRFEGGVISELELNQVKSEYEQALATIPQIEKQIV 276

Query: 228 MNVHNISTLLGY---PATEFLHYMQKQSNNFQPNLYIP-INIGIPADLIRNRPDIRYQEK 283
              + +S LLG    P     H  +         L +P + +G+P+DL+ NRPDIR  E+
Sbjct: 277 FQENALSRLLGRNPGPIARGKHIDE---------LVLPAVPMGLPSDLLANRPDIRQAEQ 327

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A+IG+A++  +P+LSL G          N F G    WS+G  +  PIF  G I
Sbjct: 328 VLVAANARIGVARAQYFPALSLTGLFGQASADLSNLFTGSARVWSWGGSVAAPIFTGGAI 387

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           +  ++ AE+  Q+    +Q  +  A +EVE+AL      ++ +   Q  V+  +     +
Sbjct: 388 RGQVKAAEAVRQQALFGYQRAIQTAFREVEDALVDQRRTREQLEAQQRQVDSLRDYTRFA 447

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            + Y  G  S +++LD ER+    E+     +  L  + V+LY A+G G+
Sbjct: 448 RLRYENGYTSYIEVLDAERSLFSAELTYVQTQGTLFGALVNLYKAMGGGW 497


>gi|294626586|ref|ZP_06705184.1| outer membrane protein [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292599153|gb|EFF43292.1| outer membrane protein [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
          Length = 474

 Score =  192 bits (487), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 122/428 (28%), Positives = 214/428 (50%), Gaps = 24/428 (5%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIA 68
           +L  ++L+GC VGP+Y +P  P   T     +           WW  F+D  L +LV+ A
Sbjct: 9   ALAALVLSGCAVGPDY-RPDPPAAVTLQGAQDPAYSAQSPVGNWWSQFDDPVLEQLVRDA 67

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPSSYASIS-------------HRFIPNLKTN 115
           L  N  +  A  R+  A+   +  R D  P   A  S              RF   L   
Sbjct: 68  LFANHDLRIAVARVKQARAVFVERRLDQAPHITAQGSFDRREQQQVIAGNQRF---LTEQ 124

Query: 116 STGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
           +T  LD+ W++DLFG QRR  E++ A+LD+  A +   ++ V +++  +Y + R  ++R+
Sbjct: 125 TTLGLDAAWELDLFGRQRRASEAARADLDAEQANLQDVQVTVAAEMARNYFELRGTQKRL 184

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
            ++ + L   +   +L+  ++  GA S+L +    A +K+IE+DIP LE +     H ++
Sbjct: 185 DVSKRTLTNLRDTQKLTQTRWDLGAGSELDVQSSLARLKAIEADIPLLETAEAQYRHRLA 244

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
            LLG         +  +     P    P+ +G  A L+R RPD+R  E++LA + A++G+
Sbjct: 245 VLLGQQPDALDATLAARE---MPAFARPLPLGDTAGLLRQRPDVRGAERRLAAATAQVGV 301

Query: 295 AKSDLYPSLSLNGSIA-LTHDNS--FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           A +DL+P +S++G +  LT D +    G    WS  P +    FD G +++ +R +++ A
Sbjct: 302 ATADLFPRISVSGFVGFLTGDAARLTEGNAKAWSVTPSISWAAFDFGTVRARLRASKAQA 361

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           +     +Q+TVL A+++ ENAL      +  +  +       +++  L+ I YR+G    
Sbjct: 362 EGALAQYQQTVLLALEDTENALIGYGRQQARLAIVVEQATAARRAEQLAQIRYREGSEDF 421

Query: 412 LDILDIER 419
           L +LD +R
Sbjct: 422 LTLLDAQR 429


>gi|325928731|ref|ZP_08189901.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [Xanthomonas perforans 91-118]
 gi|325540899|gb|EGD12471.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [Xanthomonas perforans 91-118]
          Length = 467

 Score =  192 bits (487), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 122/429 (28%), Positives = 214/429 (49%), Gaps = 24/429 (5%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKI 67
            +L  ++L+GC VGP+Y +P  P   T     +           WW  F+D  L +LV+ 
Sbjct: 1   MALAALVLSGCAVGPDY-RPDPPAAVTLQGAQDPAYSAQSPVGNWWSQFDDPVLEQLVRD 59

Query: 68  ALQQNLTILQATERINAAKENILSVRADLFPSSYASIS-------------HRFIPNLKT 114
           AL  N  +  A  R+  A+   +  R D  P   A  S              RF   L  
Sbjct: 60  ALFANHDLRIAVARVKQARAVFVERRLDQAPHITAQGSFDRREQQQVIAGNQRF---LTE 116

Query: 115 NSTGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
            +T  LD+ W++DLFG QRR  E++ A+LD+  A +   ++ V +++  +Y + R  ++R
Sbjct: 117 QTTLGLDAAWELDLFGRQRRASEAARADLDAEQANLQDVQVTVAAEVARNYFELRGTQKR 176

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
           + ++ + L   +   +L+  ++  GA S+L +    A +K+IE+DIP LE +     H +
Sbjct: 177 LDVSKRTLTNLRDTQKLTQTRWDLGAGSELDVQSSLARLKAIEADIPLLETAEAQYRHRL 236

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
           + LLG         +  +     P    P+ +G  A L+R RPD+R  E++LA + A++G
Sbjct: 237 AVLLGQQPDALDATLAARE---MPAFARPLPLGDTAGLLRQRPDVRGAERRLAAATAQVG 293

Query: 294 IAKSDLYPSLSLNGSIA-LTHDNS--FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESS 350
           +A +DL+P +S++G +  LT D +    G    WS  P +    FD G +++ +R +++ 
Sbjct: 294 VATADLFPRISVSGFVGFLTGDAARLTEGNAKAWSVTPSISWAAFDLGTVRARLRASKAQ 353

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
           A+     +Q+TVL A+++ ENAL      +  +  +       +++  L+ I YR+G   
Sbjct: 354 AEGALAQYQQTVLLALEDTENALIGYGRQQARLAIVVEQANAARRAEQLAQIRYREGSED 413

Query: 411 LLDILDIER 419
            L +LD +R
Sbjct: 414 FLTLLDAQR 422


>gi|294665675|ref|ZP_06730951.1| outer membrane protein [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|292604570|gb|EFF47945.1| outer membrane protein [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
          Length = 474

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 122/428 (28%), Positives = 214/428 (50%), Gaps = 24/428 (5%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIA 68
           +L  ++L+GC VGP+Y +P  P   T     +           WW  F+D  L +LV+ A
Sbjct: 9   ALAALVLSGCAVGPDY-RPDPPAAVTLQGAQDPAYSAQSPVGNWWSQFDDPVLEQLVRDA 67

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPSSYASIS-------------HRFIPNLKTN 115
           L  N  +  A  R+  A+   +  R D  P   A  S              RF   L   
Sbjct: 68  LFANHDLRIAVARVKQARAVFVERRLDQAPHITAQGSFDRREQQQVIAGNQRF---LTEQ 124

Query: 116 STGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
           +T  LD+ W++DLFG QRR  E++ A+LD+  A +   ++ V +++  +Y + R  ++R+
Sbjct: 125 TTLGLDAAWELDLFGRQRRASEAARADLDAEQANLQDVQVTVAAEVARNYFELRGTQKRL 184

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
            ++ + L   +   +L+  ++  GA S+L +    A +K+IE+DIP LE +     H ++
Sbjct: 185 DVSKRTLTNLRDTQKLTQTRWDLGAGSELDVQSSLARLKAIEADIPLLETAEAQYRHRLA 244

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
            LLG         +  +     P    P+ +G  A L+R RPD+R  E++LA + A++G+
Sbjct: 245 VLLGQQPDALDATLAARE---MPAFARPLPLGDTAGLLRQRPDVRGAERRLAAATAQVGV 301

Query: 295 AKSDLYPSLSLNGSIA-LTHDNS--FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           A +DL+P +S++G +  LT D +    G    WS  P +    FD G +++ +R +++ A
Sbjct: 302 ATADLFPRISVSGFVGFLTGDAARLTEGNAKAWSVTPSISWAAFDFGTVRARLRASKAQA 361

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           +     +Q+TVL A+++ ENAL      +  +  +       +++  L+ I YR+G    
Sbjct: 362 EGALAQYQQTVLLALEDTENALIGYGRQQARLAIVVEQATAARRAEQLAQIRYREGSEDF 421

Query: 412 LDILDIER 419
           L +LD +R
Sbjct: 422 LTLLDAQR 429


>gi|197117785|ref|YP_002138212.1| RND family efflux pump outer membrane lipoprotein [Geobacter
           bemidjiensis Bem]
 gi|197087145|gb|ACH38416.1| efflux pump, RND family, outer membrane lipoprotein [Geobacter
           bemidjiensis Bem]
          Length = 483

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 122/443 (27%), Positives = 229/443 (51%), Gaps = 31/443 (6%)

Query: 36  FSIGNSKN--LINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVR 93
           +S+G      L+  +T  WW +F D  LN L+  AL+ N  +  A  R+  A+    +  
Sbjct: 37  WSMGEEAGAPLVTAET-PWWTAFGDPLLNALIDRALRANPDVRLAEARVLEARARRGAAT 95

Query: 94  ADLFPSSYASIS------HRFIPN-LKTNSTGQL-------------DSDWKIDLFG-QR 132
             L PS  A  S       R  PN +     G++             D+ W++DLFG +R
Sbjct: 96  GSLAPSLDARGSFTRERESRNAPNPVLVRPGGEVEPPGTENLFQAGFDASWELDLFGGKR 155

Query: 133 RHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSH 192
           R +E+  A+L+SA  +     L +++++  +Y + R  + +  +A   + + + ++ L  
Sbjct: 156 RAVEAVQADLESALYERGGVVLTLVAEVSRNYFELRGIQRQSRLAATSVAVQRDSLALLR 215

Query: 193 LKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQS 252
            +F  G  + L +V+ EAE++   S +P+L+ S+R  +H +  LLG     F   +Q +S
Sbjct: 216 ARFAAGMATDLEVVRAEAEVERRASLLPSLDFSYRKALHRLGVLLGEAPGAFAGELQPES 275

Query: 253 NNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALT 312
               P+   P+  G P+D++R RPD+R  E++LA + A++G+AK+DLYP   ++GS+AL 
Sbjct: 276 IIPVPSGMPPV--GAPSDILRQRPDLRRAERQLAAASARVGVAKADLYPRFVVSGSLALA 333

Query: 313 HDNSFPGYNTH----WSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKE 368
            +  F  ++      WS GP +  PIF +G+I + I   ++  Q+  I ++  +L+A+++
Sbjct: 334 SEE-FGDFSDRGSVLWSIGPSIIWPIFQRGRIVARIEVRDAQEQQALIAYRRVILDALED 392

Query: 369 VENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDL 428
           +ENAL    ++      L  AV+  ++++  +   Y+ G     ++L  E    + + +L
Sbjct: 393 MENALAGYRDEADRRAALIKAVDADRRNVVFARGRYQGGLTDFREVLVAESNLLQAQGEL 452

Query: 429 SIAKRQLAKSYVDLYIAIGSGYN 451
           + ++  L  + V LY A+G G++
Sbjct: 453 AQSETNLLLALVALYKALGGGWS 475


>gi|330958418|gb|EGH58678.1| outer membrane efflux protein [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 465

 Score =  191 bits (485), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 133/449 (29%), Positives = 236/449 (52%), Gaps = 24/449 (5%)

Query: 21  GPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATE 80
           GP+Y  P    +  + +   + +   ++TL WW+ F D +LNKLV  +L  N  +  A  
Sbjct: 22  GPDYKAPQTAPVKLESAAQGNYDRSKMNTL-WWQQFEDPTLNKLVARSLDGNRDLRVAFA 80

Query: 81  RINAAKENILSVRADLFP--SSYAS----------ISHRFIPNLKTNSTGQLDSDWKIDL 128
           R+ +A+     V  D+ P  +S AS          I+ R + N +    G LD  W++DL
Sbjct: 81  RLKSARAIRDDVANDIMPVVTSRASSDIGKGQQPGITERRV-NSERYDLG-LDMAWEVDL 138

Query: 129 FGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKN 187
           FG+ +R +E+S A+ D+A A +   ++ +I++++ +Y   R  + R +IA   L   +K+
Sbjct: 139 FGRIQRQLEASDADQDAAEANLYQLQVTLIAEVVDAYGQLRGAQLREAIARDNLTNQQKS 198

Query: 188 IELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG-YPATEFLH 246
            +++      G  ++L +V+ +A + ++E+ +P L+       + I+TLLG  P T  + 
Sbjct: 199 QDITTQLRDAGVGNELDVVRSDARLAAVEATVPQLQAEQTRQRNRIATLLGERPDTLSVD 258

Query: 247 YMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLN 306
                S +  P +   + IG    ++RNRPDIR  E++LA S A+IG+A +DL+P +SL+
Sbjct: 259 L----SPSKLPAIAKALPIGDATQVLRNRPDIRAAERQLAASTARIGVATADLFPRVSLS 314

Query: 307 GSIALTHD-NSFPGYNTH--WSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVL 363
           G +  T    S  G +    WS GP +    FD G +++ IR A++ A+     +++ VL
Sbjct: 315 GFLGFTAGRGSQIGSSAARAWSLGPSITWAAFDLGSVRAQIRSADADAEGALANYEQQVL 374

Query: 364 NAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAK 423
            A++E ENA +  N+ ++ +  L    E  + +  L+ + YR+G    L +LD ER    
Sbjct: 375 LALEESENAFSDYNKRQQRLVALMRQSESSRAAARLASVQYREGTADFLVLLDAERERLA 434

Query: 424 VEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            E   + A+ +L +  V +Y A+G G+ P
Sbjct: 435 AEDSQAQAEIELYRGIVAIYKALGGGWQP 463


>gi|187924110|ref|YP_001895752.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia phytofirmans PsJN]
 gi|187715304|gb|ACD16528.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia phytofirmans PsJN]
          Length = 513

 Score =  191 bits (485), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 137/493 (27%), Positives = 235/493 (47%), Gaps = 51/493 (10%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLP----TQFSIGNSKNLINIDTLKWWESFNDTSL 61
           A+  L   +L GC VGP +  P          TQ +   SK + +  T +WW  FND  L
Sbjct: 12  ALALLLCSMLTGCLVGPNFEPPQTATPDVFNRTQTAQAASKAVESGFTPQWWTLFNDPIL 71

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH---RFIPN-----LK 113
           + L +     NL +  A+ R+  ++       A+ +P+   + S+   R  PN     L 
Sbjct: 72  DSLEQQLSDANLDVAAASARLRQSRAQQRIAGAEEYPALNGAASYDRERGSPNGILSLLG 131

Query: 114 TNSTGQ-------------------------------LDSDWKIDLFGQ-RRHIESSLAN 141
              TG                                 D+ W++D +G+ RR +E++ A 
Sbjct: 132 VTPTGSQTQSASGSAPLGVAPLPGAKGSPAYDLYQFGFDASWELDFWGRVRRGVEAASAL 191

Query: 142 LDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATS 201
            D++Y   +   L+  ++L   YI  R  +  + IA Q LD+     +L+  +  +G T+
Sbjct: 192 SDASYEDRNAILLSARAELARDYIQLRDTQALLQIAKQNLDIAHDVTKLTQNRVHEGVTT 251

Query: 202 KLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG-YPATEFLHYMQKQSNNFQPNLY 260
            L +    A+ +SIES IPTLE      ++ I  LL   P    L  M  + ++  P L 
Sbjct: 252 DLDVANAMAQAESIESLIPTLESRNTTTINAIGVLLAKEPGA--LQQMLAEPHDV-PALP 308

Query: 261 IPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIA---LTHDNSF 317
             + IG+P++L++ RPDIR  E +L  + A IG+AK+D YP +SLNGS     L   N  
Sbjct: 309 DQVPIGVPSELVQRRPDIRKAEAQLHAATATIGMAKADFYPRISLNGSAGFQSLQLSNLA 368

Query: 318 PGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSIN 377
              +  +  GP + LPIF+ G++K  +   E+  QE  I +Q TVL A +EV++AL   +
Sbjct: 369 DWASGQFVVGPSITLPIFEGGRLKGTLHLREAQQQEAAIVYQHTVLQAWREVDDALVVYD 428

Query: 378 EDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAK 437
            +++   +L+  V L+++++S++   Y+ G    LD+L++++     + +L  +K     
Sbjct: 429 AEQRRRDRLKTVVSLNQRALSIAQQRYKAGAVDFLDVLNVQKQLLDAQSNLEQSKADADA 488

Query: 438 SYVDLYIAIGSGY 450
           + + L   +G G+
Sbjct: 489 NLITLCKVLGGGW 501


>gi|30249104|ref|NP_841174.1| Outer membrane efflux protein [Nitrosomonas europaea ATCC 19718]
 gi|30138721|emb|CAD85026.1| Outer membrane efflux protein [Nitrosomonas europaea ATCC 19718]
          Length = 476

 Score =  191 bits (484), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 139/465 (29%), Positives = 238/465 (51%), Gaps = 30/465 (6%)

Query: 10  LFIVLLAGCTVGPEYTKPHMPLLPTQF-----SIGNSKNL----INIDTLK-WWESFNDT 59
           L  V+L+GC VGP+Y +P +P +P  +      I   ++L    I+   LK WW++FND 
Sbjct: 9   LIAVILSGCAVGPDY-RPPLPGIPDSWQAEKEEIVEQQSLSVQPIDQQVLKEWWKNFNDP 67

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFP----SSYASISHR----FIPN 111
            L+ L+  AL  N  +  A  RI+ A+    ++RA LFP    ++ A  SH     F P 
Sbjct: 68  RLDSLIDQALSDNFDLKIALSRIDQARAERSAIRAGLFPGVNATANAQRSHNPFPGFAPG 127

Query: 112 LKTN--STGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
           +K N    G  D+ W+IDLFG+ RR +E++ A+LD+   Q   A + + + L  SYI+ R
Sbjct: 128 IKFNLFELG-FDALWEIDLFGRLRRQLEAASADLDAVNIQYSQALVTLTADLARSYIEYR 186

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
            F+ ++ I    L   +   EL+   F  G  ++   V+  A+ ++  + IP LE S   
Sbjct: 187 SFQNQLRITRANLAAQQTTQELTEKLFKAGVGTRYDAVRARAQTETTRAQIPDLEGSLVA 246

Query: 229 NVHNISTLLGY-PATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
            +  +  L G  P        +  +    P   I   +  P   IR+RPD+   E++LA 
Sbjct: 247 ALRQLEMLTGQQPGALAAALSEPDAVPMAPGRTI---LASPVATIRHRPDLHIAERRLAA 303

Query: 288 SVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNI 344
           + A  G A ++L+P LSL+  + L +   D  F      ++    L  P+ + G+I++ I
Sbjct: 304 ATALQGAAIAELFPRLSLSAFLGLRNTELDALFKSAAFSYNTAAGLLQPLLNFGRIRAGI 363

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
             A +  QE Y+T+++TVL A++E E ALT   +++     L  +V   ++++ LS + +
Sbjct: 364 DLANARQQETYLTFEKTVLEALQETETALTRYLKEEIRRQALARSVMDLREAVRLSQLRF 423

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           + G  S LD+LD +R     E+DL+ ++ +++   + +Y  +G G
Sbjct: 424 QVGTVSFLDVLDAQRTLYSAEIDLARSETKVSTDLITVYKTLGGG 468


>gi|302341464|ref|YP_003805993.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfarculus baarsii DSM 2075]
 gi|301638077|gb|ADK83399.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfarculus baarsii DSM 2075]
          Length = 488

 Score =  191 bits (484), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 129/458 (28%), Positives = 234/458 (51%), Gaps = 27/458 (5%)

Query: 16  AGCT-VGPEYTKPHMPLLPTQFSIGNSKNLINIDT-----LKWWESFNDTSLNKLVKIAL 69
           AGC  VGP+Y  P  P  P  +    +  L           +WW  F+D  L +L+  +L
Sbjct: 21  AGCAAVGPDYQAPS-PQTPPAWRATMTGGLEAATPQAQALAQWWARFDDPLLTELIGQSL 79

Query: 70  QQNLTILQATERINAAKENILSVRADLFP---SSYASISHRFIPNLKTNSTGQ------- 119
             NL I  A  ++  A+      +A L+P   +  A  S R   N ++ S GQ       
Sbjct: 80  AGNLDIKTARAKVRQARAARGLSQAALWPELSADGAFESRRASENSRSGSGGQYDLYSGG 139

Query: 120 LDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAH 178
            D+ W+ID+FG  RR +E++ A+L++A A +    +++ ++   +Y++AR ++ R++   
Sbjct: 140 FDAGWEIDIFGGARRGVEAAQADLEAAQADLRDVWVSICAETARNYVEARTYQARLAAMR 199

Query: 179 QILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG 238
             L+   K   L   +   G +++L+L +    ++S  + +P L+     ++++++ L G
Sbjct: 200 ANLEAQTKTHALIAARRAAGLSNELALRQAGYNLESSRAQLPGLQAGLESSLNSLAILAG 259

Query: 239 Y-PATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKS 297
             P +  LH    +     P     + +G+PA+ +R RPDIR  E++LA   A++G+A +
Sbjct: 260 RTPGS--LHQRLAEVRPI-PQCPPRVAVGVPAEALRQRPDIRAAERRLAAQTARVGVATA 316

Query: 298 DLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQ 354
            LYP L L GSI L   +S   F   +  W  GP +   IFD G ++ NI   +SS QEQ
Sbjct: 317 ALYPKLRLLGSIGLESVSSGELFSAASQAWGIGPAVSWKIFDAGAVRQNI-AIQSSLQEQ 375

Query: 355 Y-ITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLD 413
             + +Q+ VL A+ EVE+ LT+   ++     L  AVE  +++ +++   YR G     +
Sbjct: 376 ALLAYQKAVLAALAEVEDNLTAYAREQLRAQSLAKAVEEARRAEAIAQDQYRAGLVDFNN 435

Query: 414 ILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +L+ +R+  +++  L+ ++  +    + +Y A+G G+N
Sbjct: 436 VLEAQRSLLQLQDQLAQSRGAVTSDLITVYKALGGGWN 473


>gi|217978579|ref|YP_002362726.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Methylocella silvestris BL2]
 gi|217503955|gb|ACK51364.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Methylocella silvestris BL2]
          Length = 500

 Score =  190 bits (483), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 135/474 (28%), Positives = 235/474 (49%), Gaps = 39/474 (8%)

Query: 10  LFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINI---------DTLKWWESFNDT 59
           L  + + GC +VGP++T P  PLLP    +G  +                  WW +F+D 
Sbjct: 14  LACLTIGGCYSVGPDFTAPD-PLLPRTSFLGKPEPRAEPEPPRLSEQGSGADWWRTFHDK 72

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF----------- 108
           +L  L +     NL I  AT R+  ++     V +  FPS     S++            
Sbjct: 73  TLTSLAERVAGANLDIASATVRLGESRAQRGVVASAAFPSINGQASYQRELYSKNGILSL 132

Query: 109 ------IPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLD-SAYAQVDIAKLNVISKL 160
                  P +    TG  D+ W++D++G+ RR +ES+ A+L+ S Y + DI  ++ +++L
Sbjct: 133 AGPNINAPPISVWQTG-FDASWELDIWGRVRRQVESADASLEASEYQRRDIL-VSTLAEL 190

Query: 161 IPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIP 220
              Y+  R  + +I+I  + L      +EL+  +  +G TS L +    A ++SI++ +P
Sbjct: 191 ARDYVTLRGAQAQIAILTENLKSASDILELTRTRTAKGLTSDLDVQNAAALVESIKAQLP 250

Query: 221 TLEKSFRMNVHNISTLLG-YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIR 279
            L+    +N + IS +L   P +     MQ +S    P       +G+P++L R RPDIR
Sbjct: 251 ALQNDVDVNANAISFILDEQPGSLKGELMQAKSRIPAPPRP---PLGVPSELARRRPDIR 307

Query: 280 YQEKKLADSVAKIGIAKSDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIFD 336
             E +L  + A IG+A +D YPS+ LNG++   AL   N + G +  + FGP + LPIF+
Sbjct: 308 AAEAQLHATTADIGVAVADFYPSVKLNGNLVLNALDAKNLWKGSSLQYQFGPSVSLPIFE 367

Query: 337 KGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKS 396
            G++KS +       QE  I + +TVL+A  E+ NAL + + +++    L+  V+   ++
Sbjct: 368 AGRLKSTLDLRSQQQQEAAIAYHKTVLSAWHEIVNALNAYSSEQRRRDSLKAQVDHASQA 427

Query: 397 MSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +++S   Y  G    L +LD +R   +     + +   ++ S + LY A+G G+
Sbjct: 428 LAISRTRYNNGVADFLTVLDAQRTVLQAMQQQAQSTTNVSISLIQLYKALGGGW 481


>gi|170720060|ref|YP_001747748.1| RND efflux system outer membrane lipoprotein [Pseudomonas putida
           W619]
 gi|169758063|gb|ACA71379.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Pseudomonas putida W619]
          Length = 483

 Score =  190 bits (483), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 131/467 (28%), Positives = 239/467 (51%), Gaps = 29/467 (6%)

Query: 10  LFIVLLAGCTVGPEYTKP--HMP--LLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
           L  VL+AGCT+GP++ +P    P    P Q     S+       L+WWE+F+D  L+ L+
Sbjct: 11  LLAVLMAGCTLGPDFKRPASQAPQQWAPLQGQAAPSQPQAEALELRWWETFHDARLSALI 70

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPS-------SYASISHRFI--PNLKTNS 116
           +   ++NL +  A+ R+  ++    +V AD  PS       S A  S   +  P+ K   
Sbjct: 71  QQVAERNLDLQIASARLLQSRALRSTVAADQAPSVDVDGGYSRARNSAEGLSDPSGKAGK 130

Query: 117 T------GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
           +      G L + W++DL+G+ RR +E++ A ++ A        L ++S+   +YI  R 
Sbjct: 131 SAFNLWQGDLVAGWELDLWGRVRRQVEAADATVEVAENDRRGVLLALLSETAGNYIQLRA 190

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
            +  + +    L + + +++LS  +  +G  ++L + +  A++ SIE+ +P+LE + R +
Sbjct: 191 VQHTLDVTRDNLKVARHSLKLSQDRQAEGVATRLDVAQASAQVASIEARLPSLE-ARRDD 249

Query: 230 VHNISTLLGYPATEFLHYMQKQ--SNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
           + N  +LL   A E    +Q Q       P       IG+P++L   RPDIR  E +L  
Sbjct: 250 LINALSLL---AAEPPRSLQAQLLEGGELPAPQQQFAIGLPSELAERRPDIRQAEARLHA 306

Query: 288 SVAKIGIAKSDLYPSLSLNGSIALT--HDNSFPGYNTH-WSFGPKLYLPIFDKGKIKSNI 344
           + A IG+AK+D YPS+ L+GS+       + F  +++  ++FGP+L LPIF+ G++K  +
Sbjct: 307 ATASIGVAKADFYPSIRLSGSVGFQAMQLSDFGAWDSRRFAFGPQLSLPIFEGGRLKGTL 366

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
              E+  QE  + +++ VL A  E+++ L   N  +     L  AV  ++ ++  +   Y
Sbjct: 367 ALREAQQQEAALNYRKVVLGAWHEIDDVLRLYNASQLRRDHLAEAVRQNRIALETAQRQY 426

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            +G    L++L ++ A    E     +   ++++ V LY A+G G+ 
Sbjct: 427 VEGAVDFLNVLTVQSALLASEEQWIDSSAAVSQALVGLYKALGGGWQ 473


>gi|104783518|ref|YP_610016.1| multidrug efflux MFS outer membrane protein [Pseudomonas
           entomophila L48]
 gi|95112505|emb|CAK17232.1| putative multidrug efflux MFS outer membrane protein [Pseudomonas
           entomophila L48]
          Length = 485

 Score =  190 bits (482), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 131/470 (27%), Positives = 238/470 (50%), Gaps = 35/470 (7%)

Query: 10  LFIVLLAGCTVGPEYTKP--HMP--LLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
           L  VLLAGCT+GP++  P    P      Q     S+ +     L+WW+SF+D  L+ L+
Sbjct: 18  LLAVLLAGCTLGPDFQSPASEAPQDWASLQGEAAASQPVAEPLELRWWDSFHDPRLSALI 77

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI---------PNLKTNS 116
           +   ++NL +  A+ R+  ++    +V AD  PS  A+  +            P+ K   
Sbjct: 78  QKVTERNLDLRMASARLLQSRALRSTVAADEAPSVDANAGYSRARNSAEGLNDPSGKAGK 137

Query: 117 T------GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
           +      G L + W++DL+G+ RR +E++ A ++ A        L ++S+   +YI  R 
Sbjct: 138 SAYNLWQGDLVAGWELDLWGRVRRQVEAADATVEVAENDRRGVLLALLSETAGNYIQLRA 197

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
            +  + +    L + + +++LS  +  +G  ++L + +  A++ SIES +PTLE + R +
Sbjct: 198 VQHTLDVTQDNLKVARHSLKLSEDRQAEGVATRLDVAQASAQVASIESRLPTLE-ARRDD 256

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP-----INIGIPADLIRNRPDIRYQEKK 284
           + N  +LL   A E    +Q       P   +P       IG+P++L   RPDIR  E +
Sbjct: 257 LINALSLL---AAEPPRSLQ---GELLPTGELPAPRQRFAIGVPSELAERRPDIRQAEAR 310

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIALT--HDNSFPGYNTH-WSFGPKLYLPIFDKGKIK 341
           L  + A IG+AK+D YPS+ L+GS+       + F  +++  ++FGP+L LPIF+ G++K
Sbjct: 311 LHAATASIGVAKADFYPSIRLSGSVGFQAMQLSDFGAWDSRRFAFGPQLSLPIFEGGRLK 370

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
             +   E+  QE  + +++ VL A  E+++ L   N  +     L  AV  ++ ++  + 
Sbjct: 371 GTLELREAQQQEAALNYRKVVLGAWHEIDDVLRLYNASQLRRDHLAEAVRQNRIALETAQ 430

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             Y +G    L++L ++ A    E     +   ++++ V LY A+G G+ 
Sbjct: 431 RQYMEGAVDFLNVLTVQSALLASEEQWIDSSAAVSQALVGLYKALGGGWQ 480


>gi|87310275|ref|ZP_01092406.1| outer membrane efflux family protein [Blastopirellula marina DSM
           3645]
 gi|87287024|gb|EAQ78927.1| outer membrane efflux family protein [Blastopirellula marina DSM
           3645]
          Length = 531

 Score =  190 bits (482), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 128/451 (28%), Positives = 225/451 (49%), Gaps = 22/451 (4%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGNSKNLIN--IDTLKWWE-SFNDTSLNKLVKIALQQNL 73
           G  VGP Y  P +P+    +   + K +I   +D   WW  SFND  LN+LV  A  QNL
Sbjct: 44  GFKVGPNYRTPAVPVA-QDWIDSDDKRVIGDPVDAAAWWSTSFNDPVLNQLVTEAYNQNL 102

Query: 74  TILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS---------TGQLDSDW 124
           T+ QA  RI  A+         +FP      S ++  NL T +         +G     W
Sbjct: 103 TVRQAGARIMQARALRAIAVGSMFPQQQ-DFSAQYSHNLVTGAGFDRHFSSWSGSFGLAW 161

Query: 125 KIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDL 183
           ++D +G+ RR +ES+ A+LD+A        + +++ +  +YID R  + R+ +    ++ 
Sbjct: 162 EVDFWGRYRRAVESADADLDAAVYDYGDVVVTLVADVAQTYIDIRTLQTRLELVKLNVEN 221

Query: 184 YKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATE 243
            +K  EL+ ++F  G +S++ + + ++ +   E+ +P LE S R + + +  L G P   
Sbjct: 222 QRKTYELTEIRFVNGESSEVDVQQAKSSLVQTEALVPQLEISLRQSQNQLCVLFGAPPEW 281

Query: 244 FLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSL 303
            +  +        PN+   I +GIPA  +  RPD+R  E++LA   A IG+A+S+LYP +
Sbjct: 282 IVDMLGAGE---IPNVKPEIALGIPAATLLQRPDVRRSERQLASQSALIGVAESELYPHI 338

Query: 304 SLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQE 360
           +L+G++  + +   + F   +   S GP L   I + G+I  NI   ++  QE    +Q+
Sbjct: 339 TLSGTVGRSGNQFKDLFRTGSGFGSVGPSLDWNILNYGRIAGNIHFQDARFQELLAAYQQ 398

Query: 361 TVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG-RYSLLDILDIER 419
           TVLNA  E ENA+    + ++ +     A E   K+  L  + + +G       +  ++ 
Sbjct: 399 TVLNANLEAENAIVGFLKAQEQLRLQLEAAEAADKTNQLITLQFEEGEEIDFNRVFSVQN 458

Query: 420 ATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              + EV  ++AK  +A+  V +Y ++G G+
Sbjct: 459 TKTQQEVAAAVAKGNVAQGVVAIYRSLGGGW 489


>gi|52840899|ref|YP_094698.1| major facilitator superfamily multidrug-efflux transporter
           [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|52628010|gb|AAU26751.1| multidrug efflux MFS outer membrane protein (RND family)
           [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
          Length = 479

 Score =  190 bits (482), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 131/478 (27%), Positives = 240/478 (50%), Gaps = 38/478 (7%)

Query: 5   RAIFSLF-IVLLAGCTVGPEYTKPHM------PLLPTQFSIGNSKNLINIDTLKWWESFN 57
           R +  LF I  L GCTVGP+Y +P +      P    +  I +S  +     L WW++F+
Sbjct: 3   RKLALLFSISCLFGCTVGPDYQRPDIKIQEKWPTSKVEKKISSSAPV----HLTWWKAFH 58

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYAS-------ISHRFIP 110
           D  L++ +  A   NL I  A  RI  A+       A+ +P    S       IS   + 
Sbjct: 59  DPLLDRYINEAATNNLDIKAAEARIRQARAMKQISLANFYPQINGSASANSLQISKGTLE 118

Query: 111 NLKTNSTG-------------QLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNV 156
            +  NS                 D+ W++DLFG+ RR +E+S A+L+ AY       L+ 
Sbjct: 119 GIFANSPTYTLIDRNQWIYNLGFDAQWELDLFGKTRRKVEASKASLEEAYESRRTILLST 178

Query: 157 ISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE 216
           I+++  SYI+ R  ++   IA + ++L +K + L   ++  G +S++ +   E ++K+ E
Sbjct: 179 IAEIARSYIELRGAQQLYGIAQKNVELQRKTLALVRQRYKAGVSSEVDVSLAEGQLKNTE 238

Query: 217 SDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRP 276
           S +P      ++N + I+ +LG      L  + K  +  +P   +P+  G+ +D++R RP
Sbjct: 239 SVLPNYITQIQVNAYQIAVMLGKDPQTILKDIAKMQSLPKPPQKVPM--GLRSDILRQRP 296

Query: 277 DIRYQEKKLADSVAKIGIAKSDLYPSLSLNGS----IALTHDNSFPGYNTHWSFGPKLYL 332
           DIR  E++LA +VA+IG+A +D +P  +L+ S     + + D  F   +  W  GP++ L
Sbjct: 297 DIRATERQLASAVAEIGVAVADFFPQFNLSVSNLAFQSTSVDTLFQSSSGFWLMGPQVSL 356

Query: 333 PIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVEL 392
           PIF  G+I++N+   ++ AQ+  I +++ +L A++E ++AL   ++       L+ A+  
Sbjct: 357 PIFRGGQIRANVESKKAVAQQAAIQYKKIILQALQEAQSALARYSQSLDTNHSLRAAIIA 416

Query: 393 HKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +K+++  +   ++ G    L +L  E A    E     ++     + + LY A+G G+
Sbjct: 417 NKRAVQFAKKRFQYGEDDYLSLLQSEAALLNAETQEVNSEVSSLTALISLYKALGGGW 474


>gi|209515073|ref|ZP_03263942.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. H160]
 gi|209504699|gb|EEA04686.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. H160]
          Length = 504

 Score =  190 bits (482), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 129/465 (27%), Positives = 227/465 (48%), Gaps = 27/465 (5%)

Query: 5   RAIFSLFIVLLAGCTVGPEYTKPHMPLLPT-QFSIGNSKNLINIDTLKWWESFNDTSLNK 63
           R + S+ ++ L+GC +GP Y +P + +  T +F+ G +  + N     WWE F D  L++
Sbjct: 8   RLLASVMLLALSGCLLGPNYERPAVDVPATYRFAQGEAAGIANA---TWWEQFQDPVLDQ 64

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFP--SSYASISHRFI--------PNLK 113
           L+  ALQ N  +  A  R++  +   ++ R+ LFP  S+ A  S + +        P   
Sbjct: 65  LIAAALQDNRDVKVAAARVDEFRGQFVTTRSGLFPQVSAGADASRQRVSQDEGVPVPKGV 124

Query: 114 TNSTGQLDS----DWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
           +    Q D+     W++DLFG+ RR  E++ ANL ++        L ++S +  SYI+ R
Sbjct: 125 SPIFNQFDATLAVSWELDLFGKVRRETEAARANLLASEEGRRATILTLVSSVASSYINLR 184

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
               ++ IA + +    +++ +   +F  G  S++ L + ++E ++    IP LE     
Sbjct: 185 SLDRQLEIAKETVQSRAESVRVFEARFRYGEVSQMELAQSQSEYQAALVTIPQLEAQIAQ 244

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
               +S L+G      L   ++ +    P    PI  G+P+DL+  RPD+   E+ L   
Sbjct: 245 QEDALSVLIGRNPGAILR-GRELAQMGTP----PIPEGLPSDLLERRPDLLEAEQTLVAQ 299

Query: 289 VAKIGIAKSDLYPSLSLNG---SIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
            A IG A++  +PS+SL G   S++    N F G    WSF   +  PIF  G I   + 
Sbjct: 300 NALIGAARALYFPSISLTGLFGSVSAQFSNLFTGPARVWSFAGSVTQPIFTAGNITGQVH 359

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
           +AE+  QE   ++++ +  A +EVE++L S+ +  + +      VE       L+   Y 
Sbjct: 360 QAEARQQEALYSYEKAIQVAFQEVEDSLISVQKTHEALDAQNLQVEALITYAHLARQRYE 419

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            G  S +++LD ER+    ++  +  +  +  SYV LY A G G+
Sbjct: 420 GGYTSYIEVLDAERSLFNAQLSYAQTQGAVLTSYVTLYKATGGGW 464


>gi|261341407|ref|ZP_05969265.1| RND efflux system, outer membrane lipoprotein, NodT [Enterobacter
           cancerogenus ATCC 35316]
 gi|288316724|gb|EFC55662.1| RND efflux system, outer membrane lipoprotein, NodT [Enterobacter
           cancerogenus ATCC 35316]
          Length = 507

 Score =  189 bits (481), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 128/482 (26%), Positives = 242/482 (50%), Gaps = 41/482 (8%)

Query: 10  LFIVLLAGCTVGPEYTKPHMPLLPTQFSIGN----SKNLINIDTLKWWESFNDTSLNKLV 65
           + ++LL GC VGP+Y +P  P        G+    SK +      +WW++F    L+ LV
Sbjct: 10  MIMMLLVGCAVGPDYQQPAPPPSGHWNDKGDGEVKSKTVSAATNPRWWKTFGSPQLDSLV 69

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSSYASI--------------SHRFI-- 109
           + A+  NL++ Q   RI  A+E I       +P+   ++              SH     
Sbjct: 70  ERAIAGNLSLQQTVLRIAGAREQINQAGGAFYPAVNGNLQATRQQLGLEGELKSHGVYDQ 129

Query: 110 -----PNLKTN----------STGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAK 153
                P L+              G  D+ W+IDL+G+ RR +E++ A    A  Q + A 
Sbjct: 130 LDNVDPQLRGALGPLTQPINLYQGSFDAQWEIDLWGKVRRQVEAAEAQQKVAIEQRNDAL 189

Query: 154 LNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIK 213
           +++ +++  +++  R  +  I+  +  ++  ++ +EL+  +   G + ++ +    A++ 
Sbjct: 190 VSLEAEVARAWLQLRGAQSIIATLNTQIESAQQTLELTDSRQRGGLSPQMDVENARAQLG 249

Query: 214 SIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIR 273
           ++E+ +P  +   R  ++ ++ LLG P       +Q  S    P L   +  GIP+ L R
Sbjct: 250 NLEAQLPQYQAQERQAMNGLAILLGKPPGALDAELQ--SAQPMPTLPDIVQTGIPSTLAR 307

Query: 274 NRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIAL--THDNSFPGYNTH-WSFGPKL 330
            RPD+R  E +L  + A+IG++ ++L+PS +L+G   L  +  N    +++H +SFGP++
Sbjct: 308 RRPDVRQAEAQLHAATAEIGVSVAELFPSFTLSGQFGLRNSETNWLTDWSSHFYSFGPQV 367

Query: 331 YLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAV 390
            +PIF  G++ S+++ A +      + +++TVL A+ +VENAL S   D++    L   +
Sbjct: 368 SIPIFQGGRLVSSVKVARAQQGAAVLDYRQTVLTALGDVENALVSYRTDQQREAGLAKTI 427

Query: 391 ELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +  + +  L+  +YRQG  S +D+LD +R  A+ +   + A+ Q A     LY A+G G+
Sbjct: 428 DALQNAFDLASDSYRQGIASFIDVLDAQRQLAQAQQQRAQAQVQSALDLAALYKALGGGW 487

Query: 451 NP 452
            P
Sbjct: 488 EP 489


>gi|258543602|ref|YP_003189035.1| secretion system type I outer membrane efflux pump lipoprotein NodT
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256634680|dbj|BAI00656.1| secretion system type I outer membrane efflux pump lipoprotein NodT
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256637736|dbj|BAI03705.1| secretion system type I outer membrane efflux pump lipoprotein NodT
           [Acetobacter pasteurianus IFO 3283-03]
 gi|256640790|dbj|BAI06752.1| secretion system type I outer membrane efflux pump lipoprotein NodT
           [Acetobacter pasteurianus IFO 3283-07]
 gi|256643845|dbj|BAI09800.1| secretion system type I outer membrane efflux pump lipoprotein NodT
           [Acetobacter pasteurianus IFO 3283-22]
 gi|256646900|dbj|BAI12848.1| secretion system type I outer membrane efflux pump lipoprotein NodT
           [Acetobacter pasteurianus IFO 3283-26]
 gi|256649953|dbj|BAI15894.1| secretion system type I outer membrane efflux pump lipoprotein NodT
           [Acetobacter pasteurianus IFO 3283-32]
 gi|256652943|dbj|BAI18877.1| secretion system type I outer membrane efflux pump lipoprotein NodT
           [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655997|dbj|BAI21924.1| secretion system type I outer membrane efflux pump lipoprotein NodT
           [Acetobacter pasteurianus IFO 3283-12]
          Length = 529

 Score =  189 bits (481), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 127/488 (26%), Positives = 236/488 (48%), Gaps = 52/488 (10%)

Query: 11  FIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKN---LINIDTLK-----WWESFNDTSLN 62
            + +LAGC VGP+Y KP     P+Q+     K+   L+++ T +     WW  FND  L 
Sbjct: 32  LVFMLAGCMVGPDYKKPDT-WSPSQWQRAADKDTSQLLSVPTTQAPDPQWWAIFNDPELT 90

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHR-----------FIPN 111
            L K    QNL + QATE+   ++  +L   A+ FP   AS S+R            +  
Sbjct: 91  SLEKRLADQNLDVQQATEQFAVSRGQLLLAGAERFPDLAASGSYRRAQYSSKQLQRIVER 150

Query: 112 LKTNSTGQ------------------------LDSDWKIDLFGQ-RRHIESSLANLDSAY 146
           +  N+ G                         L + W+IDL+G+ RR  E++ A + +  
Sbjct: 151 IGENAAGTGMGEMLSAQSSSISIPLLNQWQDGLQASWEIDLWGRVRRQYEAAKAYMKATM 210

Query: 147 AQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLV 206
            +     +   ++L   Y+  R+ +E++ I  +  D   + ++LS  ++  G  S+L + 
Sbjct: 211 EERRGILIARQAELASDYMTLRNLQEQLRITKENRDAASEILQLSSSRYKSGLVSELDVD 270

Query: 207 KLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIG 266
              +E++   + IP  E+   M ++ I+ L+G P       ++K +      +   + +G
Sbjct: 271 SARSEVERTSALIPQFEQRIAMQINAINLLMGAPPGGLNTELEKTAGIP--PVPPQVPVG 328

Query: 267 IPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALT----HDNSFPGYNT 322
           +P++L   RPDIR   ++L  + A++G A++D YP ++++           D  F   + 
Sbjct: 329 LPSELAERRPDIREAGEELHAATAEVGQAEADFYPKVTIDAGFGFQSFSFRDMGF-WSSR 387

Query: 323 HWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKI 382
            W+ GP + LPIF  G++   +   ++S +   + +++TVLNA KEV+NALT+   ++K 
Sbjct: 388 MWNVGPAITLPIFQGGRLTGQLHMKKASQKAAALRYRKTVLNAWKEVDNALTAYQAEQKR 447

Query: 383 VTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDL 442
              +++ V    +S+ L+   Y+ G  S L +LD +R   + +  L+ +   ++ + V L
Sbjct: 448 NQNIRNQVAADARSLELAQSQYKHGLQSYLQVLDTQRRLLQSQTQLADSTATMSSNLVQL 507

Query: 443 YIAIGSGY 450
           Y A+G G+
Sbjct: 508 YNALGGGW 515


>gi|149186298|ref|ZP_01864611.1| RND efflux system, outer membrane lipoprotein, NodT [Erythrobacter
           sp. SD-21]
 gi|148829887|gb|EDL48325.1| RND efflux system, outer membrane lipoprotein, NodT [Erythrobacter
           sp. SD-21]
          Length = 480

 Score =  189 bits (481), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 143/478 (29%), Positives = 241/478 (50%), Gaps = 44/478 (9%)

Query: 5   RAIFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNK 63
           R I ++F   LAGC TVGP+Y +P +    T +    S  +   + + WW +  D  L +
Sbjct: 8   RWIAAVFSAGLAGCATVGPDYERPPIEATATDWIDRESVPVAEAEFIAWWRNLGDPVLTR 67

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS-------------HRFIP 110
           LV+ +LQ NLTI QA  R+  A+     +RA   PS  A  S                IP
Sbjct: 68  LVEASLQDNLTIRQALLRVEEARARRAQIRASALPSVGADASVTALQQSLNANPGFAQIP 127

Query: 111 NLKT-----NSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSY 164
             +      +  G L   W+IDL+GQ RR +E+  A ++ A A  + A+L V  +   +Y
Sbjct: 128 GFQRELEIYDVGGSLA--WQIDLWGQTRRALEAGDARIEGAIAAANGARLAVAIETASTY 185

Query: 165 IDARHFK-ER----ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDI 219
           +    ++ ER     SIA Q     ++ + LS+++  +G  S+  L+ +E+E+  IE+++
Sbjct: 186 LALIGYQSERGALLASIAAQ-----RELLALSNIQLREGEISRADLLLVESELARIEAEL 240

Query: 220 PTLEKSFRMNVHNISTLLG-YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDI 278
           P L+   R     +  L+G  P  E    +  +  N    L +P+  G+ ADL+R RPDI
Sbjct: 241 PRLDVEIRAAALALGPLIGGLPEREI--ALATEDRNEVALLDVPV--GLRADLLRRRPDI 296

Query: 279 RYQEKKLADSVAKIGIAKSDLYPSLSLNG-----SIALTHDNSFPGYNTHWSFGPKLYLP 333
              E++LA   A+IG+A+++L+P L LN      SIAL  D  F G +T +S  P L   
Sbjct: 297 ARAERELAAETAEIGVARAELFPQLRLNAAGGFSSIAL--DTLFDGDSTSYSIVPFLSWR 354

Query: 334 IFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELH 393
           +F+ G+I++ I  A+  A+   + +++++L A++E E A+   +  ++ +   + A  L 
Sbjct: 355 VFEGGRIRAEIDLAQLEARRAALAYEQSILTALEETETAIARYDLGREALALSERAATLS 414

Query: 394 KKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            ++  L+ I ++ G    L + + ER     E   +IA RQ + +   LY A+G G+ 
Sbjct: 415 AENYRLARIQFQYGAIDQLRLQEAERGLRNAERGRAIAYRQASLAMAGLYAALGGGWQ 472


>gi|187923686|ref|YP_001895328.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia phytofirmans PsJN]
 gi|187714880|gb|ACD16104.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia phytofirmans PsJN]
          Length = 512

 Score =  189 bits (481), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 136/493 (27%), Positives = 235/493 (47%), Gaps = 51/493 (10%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLP----TQFSIGNSKNLINIDTLKWWESFNDTSL 61
           A+  L   +L GC VGP +  P          T+ +   SK + +  T +WW  FND  L
Sbjct: 12  ALALLLCSMLTGCLVGPNFEPPQTATPDVFNRTRSAQAASKAVESGFTPQWWTLFNDPIL 71

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH---RFIPN-----LK 113
           + L +     NL +  A+ R+  ++       A+ +P+   + S+   R  PN     L 
Sbjct: 72  DSLEQQLSDANLDVAAASARLRQSRAQQRIAGAEEYPTLNGAASYDRERGSPNGILSLLG 131

Query: 114 TNSTGQ-------------------------------LDSDWKIDLFGQ-RRHIESSLAN 141
              TG                                 D+ W++D +G+ RR +E++ A 
Sbjct: 132 VTPTGSQTQSASGSAPLGVAPLPGAKGSPAYDLYQFGFDASWELDFWGRVRRGVEAASAL 191

Query: 142 LDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATS 201
            D++Y   +   L+  ++L   YI  R  +  + IA Q LD+     +L+  +  +G T+
Sbjct: 192 SDASYEDRNAILLSARAELARDYIQLRDTQALLQIAKQNLDIAHDATKLTQNRVHEGVTT 251

Query: 202 KLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG-YPATEFLHYMQKQSNNFQPNLY 260
            L +    A+ +SIES IPTLE      ++ I  LL   P    L  M  + ++  P L 
Sbjct: 252 DLDVANAMAQAESIESLIPTLESRNTTTINAIGVLLAKEPGA--LQQMLAEPHDV-PALP 308

Query: 261 IPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIA---LTHDNSF 317
             + IG+P++L++ RPDIR  E +L  + A IG+AK+D YP +SLNGS     L   N  
Sbjct: 309 DQVPIGVPSELVQRRPDIRKAEAQLHAATATIGMAKADFYPRISLNGSAGFQSLQLSNLA 368

Query: 318 PGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSIN 377
              +  +  GP + LPIF+ G++K  +   E+  QE  I +Q TVL A +EV++AL   +
Sbjct: 369 DWASGQFVVGPSITLPIFEGGRLKGTLHLREAQQQEAAIVYQHTVLQAWREVDDALVVYD 428

Query: 378 EDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAK 437
            +++   +L+  V L+++++S++   Y+ G  + LD+L++++     +  L  +K     
Sbjct: 429 AEQRRRDRLKTVVSLNQRALSIAQQRYKAGAVNFLDVLNVQKQLLDAQSKLEQSKADADA 488

Query: 438 SYVDLYIAIGSGY 450
           + + L   +G G+
Sbjct: 489 NLITLCKVLGGGW 501


>gi|226941844|ref|YP_002796918.1| OprM [Laribacter hongkongensis HLHK9]
 gi|226716771|gb|ACO75909.1| OprM [Laribacter hongkongensis HLHK9]
          Length = 481

 Score =  189 bits (480), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 124/457 (27%), Positives = 225/457 (49%), Gaps = 18/457 (3%)

Query: 11  FIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQ 70
             +L+ GC +GP+Y +P M L P  +        + I +  WW  FND +LN L   AL 
Sbjct: 13  LALLMTGCAIGPDYQRPVMEL-PDSYGTPAGSPELRI-SRDWWTQFNDPALNALEDRALN 70

Query: 71  QNLTILQATERINAAKENILSVRADLFPSSYASI-SHRFIPNLKTNSTG----------Q 119
            N  +  A  RI  A+  + S  ADL P   A   + R   +L +++TG           
Sbjct: 71  YNRDLAAAVARIEQAQAQLTSATADLLPQLNAGADATRGRNSLYSSTTGTNPVMDSYQAS 130

Query: 120 LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAH 178
           L + +++DL+G+ RR+ E++LA+L ++ A  D   L+V S +  +Y   R + E++ I+ 
Sbjct: 131 LAASFELDLWGKLRRNREAALASLRASEAARDTVALSVTSSVADAYFQLRTYDEQLDISR 190

Query: 179 QILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG 238
           + L   ++ +++   ++  G  S+L   + EAE  +    +P  E++       +  L+G
Sbjct: 191 RTLKSREEALQIYAKRYHGGLISELDYRQAEAETATARVAVPRYEQAVSQAETALKVLVG 250

Query: 239 YPATEFLHYMQKQSNNFQPNLYIPI-NIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKS 297
               E       +       +  P+   G P+ L+  RPD+   E++L  + A+IG+A++
Sbjct: 251 ANPREVFEAEVPRGEELSRIVVPPVLPDGTPSTLLLARPDLVSAEQQLVAANARIGVARA 310

Query: 298 DLYPSLSLNGSIA---LTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQ 354
             +PS+SL G++    L     F G    W++G  L +PIF+ GK  + ++ A +  +E 
Sbjct: 311 AYFPSISLTGAVGSASLALGELFTGPAALWNYGGALAMPIFNWGKTGAGVKAATAQQKEA 370

Query: 355 YITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDI 414
              ++  V NA ++  +ALT+  +  + +      V   +++  L+ + Y  G  S LD+
Sbjct: 371 LANYELAVQNAFRDTRDALTAQQKSAEQLAAQDTQVNALQRTAHLARLRYENGYSSYLDV 430

Query: 415 LDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           LD ER+    E+D + A+     + V +Y A+G GY+
Sbjct: 431 LDAERSLFSSELDRANARLARLNAAVSVYRALGGGYD 467


>gi|148360684|ref|YP_001251891.1| multidrug efflux MFS outer membrane protein [Legionella pneumophila
           str. Corby]
 gi|296106251|ref|YP_003617951.1| multidrug efflux MFS outer membrane protein [Legionella pneumophila
           2300/99 Alcoy]
 gi|148282457|gb|ABQ56545.1| multidrug efflux MFS outer membrane protein (RND family)
           [Legionella pneumophila str. Corby]
 gi|295648152|gb|ADG23999.1| multidrug efflux MFS outer membrane protein [Legionella pneumophila
           2300/99 Alcoy]
          Length = 479

 Score =  189 bits (480), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 131/478 (27%), Positives = 240/478 (50%), Gaps = 38/478 (7%)

Query: 5   RAIFSLF-IVLLAGCTVGPEYTKPHM------PLLPTQFSIGNSKNLINIDTLKWWESFN 57
           R +  LF I  L GCTVGP+Y +P +      P    +  I +S  +     L WW++F+
Sbjct: 3   RKLVLLFSISCLFGCTVGPDYQRPDIKIQEKWPTSKVEKKISSSAPV----HLTWWKAFH 58

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYAS-------ISHRFIP 110
           D  L++ +  A   NL I  A  RI  A+       A+ +P    S       IS   + 
Sbjct: 59  DPLLDRYINEAATNNLDIKAAEARIRQARAMQQISLANFYPQINGSASANSLQISKGTLE 118

Query: 111 NLKTNSTG-------------QLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNV 156
            +  NS                 D+ W++DLFG+ RR +E+S A+L+ AY       L+ 
Sbjct: 119 GIFANSPTYTLIDRNQWIYNLGFDAQWELDLFGKTRRKVEASKASLEEAYESRRTILLST 178

Query: 157 ISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE 216
           I+++  SYI+ R  ++   IA + ++L +K + L   ++  G +S++ +   E ++K+ E
Sbjct: 179 IAEIARSYIELRGAQQLYGIAQKNVELQRKTLALVRQRYKAGVSSEVDVSLAEGQLKNTE 238

Query: 217 SDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRP 276
           S +P      ++N + I+ +LG      L  + K  +  +P   +P+  G+ +D++R RP
Sbjct: 239 SVLPNYITQIQVNAYQIAVMLGKDPQTILKDIAKIQSLPKPPQKVPM--GLRSDILRQRP 296

Query: 277 DIRYQEKKLADSVAKIGIAKSDLYPSLSLNGS----IALTHDNSFPGYNTHWSFGPKLYL 332
           DIR  E++LA +VA+IG+A +D +P  +L+ S     + + D  F   +  W  GP++ L
Sbjct: 297 DIRATERQLASAVAEIGVAVADFFPQFNLSVSNLAFQSTSVDTLFQSSSGFWLMGPQVSL 356

Query: 333 PIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVEL 392
           PIF  G+I++N+   ++ AQ+  I +++ +L A++E ++AL   ++       L+ A+  
Sbjct: 357 PIFHGGQIRANVESKKAVAQQAAIQYKKIILQALQEAQSALVRYSQSLDTNHSLRAAIIA 416

Query: 393 HKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +K+++  +   ++ G    L +L  E A    E     ++     + + LY A+G G+
Sbjct: 417 NKRAVQFAKKRFQYGEDDYLSLLQSEAALLNAETQEVNSEVSSLTALISLYKALGGGW 474


>gi|170696138|ref|ZP_02887273.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia graminis C4D1M]
 gi|170138953|gb|EDT07146.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia graminis C4D1M]
          Length = 512

 Score =  189 bits (480), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 130/493 (26%), Positives = 235/493 (47%), Gaps = 53/493 (10%)

Query: 7   IFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL------INIDTLKWWESFNDTS 60
           + +L  +LL+ C VGP + +P   + P  FS   S            D+  WW+  ND +
Sbjct: 13  LATLLGMLLSACMVGPNFERPQTAV-PDVFSRTQSAQAPSRAIEAGFDS-DWWKLLNDPT 70

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF------------ 108
           L+ L +     NL +  A+ R+  ++     V AD +P+  A+ S+              
Sbjct: 71  LDSLEQRLTDANLDVAAASARLRQSRAQQRIVGADEYPTVSAAASYNRERGSMNGILSLL 130

Query: 109 ----------------------IPNLKTNSTGQL-----DSDWKIDLFGQ-RRHIESSLA 140
                                 +P  K +    L     D+ W++D +G+ RR +E++ A
Sbjct: 131 GVTPTGSQSQSASGASPTGVAPLPGDKGSPAYDLYQFGFDASWELDFWGRVRRGVEAATA 190

Query: 141 NLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGAT 200
             +++Y   +   L+  ++L   Y+  R  +  + IA Q L++ +   +L+  +  +G T
Sbjct: 191 VSNASYEDRNFVLLSARAELARDYVQLRDTQALLEIAQQNLEIARDATKLTETRVREGVT 250

Query: 201 SKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLY 260
           + L +    A+  SIES IPTLE +    +++I  LLG    E    +   +    P L 
Sbjct: 251 TNLDVANAAAQAASIESLIPTLEANCETTINSIGLLLGMQPGELQQTLS--ARGAVPKLP 308

Query: 261 IPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIA---LTHDNSF 317
             + IG  +++++ RPDIR  E +L  + A IG+AK+D YP +SLNGS     L   N  
Sbjct: 309 NNVPIGFASEVVQRRPDIRRAEAQLHAATAAIGMAKADFYPRISLNGSAGFQSLQLSNLA 368

Query: 318 PGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSIN 377
              +  +  GP + LPIF+ G++K  +   E+  QE  I ++ TVL A +EV++AL   +
Sbjct: 369 DWASGQFVIGPSITLPIFEGGRLKGTLHLREAQQQEAAIVYKRTVLAAWREVDDALVLYD 428

Query: 378 EDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAK 437
            +++   +LQ  V L++ ++S++   Y+ G    LD+L++++     + +L  +    A 
Sbjct: 429 AEQRRNERLQQVVRLNQSALSIARQRYKAGAVDFLDVLNVQKQLLDAQSNLERSTANAAT 488

Query: 438 SYVDLYIAIGSGY 450
           + + L  A+G G+
Sbjct: 489 NLITLCKALGGGW 501


>gi|259908973|ref|YP_002649329.1| RND efflux system, outer membrane lipoprotein, NodT [Erwinia
           pyrifoliae Ep1/96]
 gi|224964595|emb|CAX56108.1| RND efflux system, outer membrane lipoprotein, NodT [Erwinia
           pyrifoliae Ep1/96]
          Length = 515

 Score =  189 bits (479), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 127/480 (26%), Positives = 240/480 (50%), Gaps = 50/480 (10%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQF----SIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQ 70
           L+GC +GP+Y  P  P +P  F    +   +K L +     WW++FND  L+ L++ A+Q
Sbjct: 22  LSGCVLGPDYQPPR-PAMPEVFNSMQAQQGAKPLASATRADWWKAFNDPQLDSLIERAVQ 80

Query: 71  QNLTILQATERINAAKENILSVRADLFPSSYASISHRFI--------------------- 109
            NL++ QA  RI  A++ +   R    PS   S + RF                      
Sbjct: 81  GNLSLQQAVLRIAGARQQLNQARGAWAPS--VSSNARFTRQQLGVKGELESQGIDDRLNG 138

Query: 110 --------PNLKTNS------TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKL 154
                   P L +         G  D+ W++DL+G+ RR +E + A    +  + + A +
Sbjct: 139 VDNADSVRPALDSLEKPIGLYQGSFDASWELDLWGKVRRQVEMADARQQQSAEERNDALV 198

Query: 155 NVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKS 214
           ++ +++  +Y+  R  +         +D+ ++ ++L+  +   G   + ++    A++ S
Sbjct: 199 SLEAEVARAYLQLRGAQAITQTIETQIDVAQQTLDLTQSQQRNGLAPQTNVENARAQLSS 258

Query: 215 IESDIPTLEKSFRMNVHNISTLLG-YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIR 273
           + + +P  +      ++ ++ L G  P         +++    P L   +++G+P++L R
Sbjct: 259 LRAQLPQYQAQIHQAMNGLAVLTGQVPGALDAELTARKA---LPVLPPAVSVGVPSELAR 315

Query: 274 NRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS--FPGYNTH-WSFGPKL 330
            RPD+R  E  L  + A IG++ + L+PSLSL+G   + + ++     +++H +SFGP +
Sbjct: 316 RRPDVRAAEASLHAATASIGVSVAQLFPSLSLSGQFGMRNSDASYLDNWSSHFYSFGPSV 375

Query: 331 YLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAV 390
            LPIF  G++ SN++ A +      + +++TVL A+++VENAL S   D++ VT L  +V
Sbjct: 376 TLPIFQGGRLVSNVKLARAQQASAALQYRQTVLTALQDVENALVSYRSDRQQVTGLDESV 435

Query: 391 ELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +  + + +L+   YRQG  S ++ LD +R  A+V+     A+ Q     V LY A+G G+
Sbjct: 436 QALQNAFNLASDGYRQGLSSFIEPLDAQRQLAQVQQQAEQARVQSRLDLVALYKALGGGW 495


>gi|224368667|ref|YP_002602829.1| multidrug efflux system, outer membrane subunit [Desulfobacterium
           autotrophicum HRM2]
 gi|223691383|gb|ACN14666.1| multidrug efflux system, outer membrane subunit [Desulfobacterium
           autotrophicum HRM2]
          Length = 546

 Score =  189 bits (479), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 130/465 (27%), Positives = 241/465 (51%), Gaps = 34/465 (7%)

Query: 14  LLAGCTV-GPEY-----TKPHMPLLPTQFSIGNSKNL-INIDTLKWWESFNDTSLNKLVK 66
            + GC+V GP+Y     TK H      Q   G   +  ++    +WWE F+D  L +LV 
Sbjct: 71  FVGGCSVVGPDYQTPDLTKAHGAGWLGQPGAGERTSFSMDAPVARWWEQFDDPELTRLVG 130

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP--------NLKTNSTG 118
             ++ NL + +A ERI  A        AD  P  Y ++  + +         N +  S G
Sbjct: 131 EVVEANLDLSKARERIVEAGLRRRLTGADRMP--YVNLDGKIVQAGTGEKAVNREGPSPG 188

Query: 119 QLD--------SDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
           +          S W++DL+G+  R +E++  + ++         +++ ++L+ +YID R 
Sbjct: 189 EEATLFSAGGFSGWELDLWGRVARLVEAANRSYEAELETYRYVSVSLTAELVLAYIDVRT 248

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
            +ER+    + ++L  K++EL  L++  G +++L + ++  ++    +  P L ++  + 
Sbjct: 249 LEERLGALEKNIELLTKSLELVELRYRTGTSTELEVKQIRRQLNQTRALGPELRRARSVA 308

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            + I+ L G    E  +++ + ++   P +   + IG+P DL+  R D+R  E++ A +V
Sbjct: 309 ANTIAILRGQVPAE--NHLAEGTHMHVPEM---MGIGLPVDLLTRRADVRRLERQYAAAV 363

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           A IG AK+D YP LS+ GSI    D+    F   +  +S GP+L  P+FD GK+++ +  
Sbjct: 364 AMIGSAKADKYPRLSITGSIYFQTDDLGILFQPESIVYSLGPRLSFPLFDAGKLQTKVEI 423

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
             S A++  +  ++T+L A+ EVEN++  I  +++ V  L  A+E   +S+ L+   YR 
Sbjct: 424 RGSQAEQARLELEKTLLTAVGEVENSVVGIVHNQERVGFLGAALENAIRSVRLADQLYRI 483

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           G  SL +++D +R   KV+ +L +AK+      V LY A+G G++
Sbjct: 484 GLGSLFELIDAQREQIKVQDELILAKQFELGEIVRLYRALGGGWD 528


>gi|54296688|ref|YP_123057.1| hypothetical protein lpp0719 [Legionella pneumophila str. Paris]
 gi|53750473|emb|CAH11867.1| hypothetical protein lpp0719 [Legionella pneumophila str. Paris]
          Length = 479

 Score =  189 bits (479), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 131/478 (27%), Positives = 240/478 (50%), Gaps = 38/478 (7%)

Query: 5   RAIFSLF-IVLLAGCTVGPEYTKPHM------PLLPTQFSIGNSKNLINIDTLKWWESFN 57
           R +  LF I  L GCTVGP+Y +P +      P    +  I +S  +     L WW++F+
Sbjct: 3   RKLALLFSISCLFGCTVGPDYQRPDIKIQEKWPTSKVEKKISSSAPV----HLTWWKAFH 58

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYAS-------ISHRFIP 110
           D  L++ +  A   NL I  A  RI  A+       A+ +P    S       IS   + 
Sbjct: 59  DPLLDRYINEAATNNLDIKAAEARIRQARAMKQISLANFYPQINGSASANSLQISKGTLE 118

Query: 111 NLKTNSTG-------------QLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNV 156
            +  NS                 D+ W++DLFG+ RR +E+S A+L+ AY       L+ 
Sbjct: 119 GIFANSPTYTLIDRNQWIYNLGFDAQWELDLFGKTRRKVEASKASLEEAYESRRTILLST 178

Query: 157 ISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE 216
           I+++  SYI+ R  ++   IA + ++L +K + L   ++  G +S++ +   E ++K+ E
Sbjct: 179 IAEIARSYIELRGAQQLYGIAQKNVELQRKTLALVRQRYKAGVSSEVDVSLAEGQLKNTE 238

Query: 217 SDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRP 276
           S +P      ++N + I+ +LG      L  + K  +  +P   +P+  G+ +D++R RP
Sbjct: 239 SVLPNYITQIQVNAYQIAVMLGKDPQTILKDIAKIQSLPKPPQKVPM--GLRSDILRQRP 296

Query: 277 DIRYQEKKLADSVAKIGIAKSDLYPSLSLNGS----IALTHDNSFPGYNTHWSFGPKLYL 332
           DIR  E++LA +VA+IG+A +D +P  +L+ S     + + D  F   +  W  GP++ L
Sbjct: 297 DIRATERQLASAVAEIGVAVADFFPQFNLSVSNLAFQSTSVDTLFQSSSGFWLMGPQVSL 356

Query: 333 PIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVEL 392
           PIF  G+I++N+   ++ AQ+  I +++ +L A++E ++AL   ++       L+ A+  
Sbjct: 357 PIFHGGQIRANVESKKAVAQQAAIQYKKIILQALQEAQSALVRYSQSLDTNHSLRAAIIA 416

Query: 393 HKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +K+++  +   ++ G    L +L  E A    E     ++     + + LY A+G G+
Sbjct: 417 NKRAVQFAKKRFQYGEDDYLSLLQSEAALLNAETQEVNSEVSSLTALISLYKALGGGW 474


>gi|320353350|ref|YP_004194689.1| NodT family RND efflux system, outer membrane lipoprotein
           [Desulfobulbus propionicus DSM 2032]
 gi|320121852|gb|ADW17398.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfobulbus propionicus DSM 2032]
          Length = 474

 Score =  188 bits (478), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 128/462 (27%), Positives = 228/462 (49%), Gaps = 31/462 (6%)

Query: 10  LFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNS--KNLINIDTLKWWESFNDTSLNKLVKI 67
           L I+L+ GCTVGP+Y +P +   P+ + + +S  K+L N     WW+ FND  L  L++ 
Sbjct: 9   LLILLVGGCTVGPDYNRPPIDA-PSDWRLIDSEAKDLANT---PWWQQFNDPVLTTLIET 64

Query: 68  ALQQNLTILQATERINAAKENILSVRADLFPSSYASISH-----------RFIPNLKTNS 116
           AL++N  +  A  RI          RADLFP    S  +           R+    KT +
Sbjct: 65  ALRENKELQIAAARIEEYAGRYGMARADLFPQVSGSAEYNRQRVTELGDNRYASGYKTTT 124

Query: 117 ---TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                 L + W+ID++G+ RR  E++ A L ++        L+++S +   YI+ R    
Sbjct: 125 DTFAATLGASWEIDIWGRIRRGTEAARAELLASEEGRRAVVLSLVSSVASGYINLRDLDR 184

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
           ++ I+        ++  L   +F  G  S L L +  ++ +   + IP+LEK+     + 
Sbjct: 185 QLEISRNTATSRGQSYALFKERFAGGIISDLELSQNRSQYEEALASIPSLEKAIAQQENG 244

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINI-GIPADLIRNRPDIRYQEKKLADSVAK 291
           +S LLG            +  N    L +P  + G+P+DL+  RPDIR  E+ L  + A+
Sbjct: 245 LSVLLGRNPGPI-----PRGRNID-QLTLPAVVAGLPSDLLERRPDIRQAEQTLIAANAR 298

Query: 292 IGIAKSDLYPSLSLNGSIA-LTHDNS--FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
           IG+AK+  +PS+SL G+    + D S  F G +  W++   + +P+F  GKI  +++ AE
Sbjct: 299 IGVAKAAYFPSISLTGAFGSASGDLSDLFKGPSKVWNYSAPVTMPLFTAGKIAGSVKEAE 358

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           +  Q+  + +Q+ + N  +EV +AL       + +   ++ V+  ++   ++ + Y  G 
Sbjct: 359 AIQQQALLGYQQAIQNGFREVNDALADQQHTTRQLAAQKNQVDSLRQYADIARLRYDNGY 418

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              L +LD ER+    E+  +  +  L  + ++LY A+G G+
Sbjct: 419 TDYLAVLDAERSLFNAELAYTQTQGALHLALINLYKAMGGGW 460


>gi|21242237|ref|NP_641819.1| outer membrane protein [Xanthomonas axonopodis pv. citri str. 306]
 gi|21107660|gb|AAM36355.1| outer membrane protein [Xanthomonas axonopodis pv. citri str. 306]
          Length = 474

 Score =  188 bits (478), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 127/457 (27%), Positives = 225/457 (49%), Gaps = 24/457 (5%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIA 68
           +L  ++L+GC VG +Y +P  P   T     +           WW  F+D  L +LV+ A
Sbjct: 9   ALAALVLSGCAVGLDY-RPDPPAAVTLQGAQDPAYSAQSPVGNWWSQFDDPVLEQLVRDA 67

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPSSYASIS-------------HRFIPNLKTN 115
           L  N  +  A  R+  A+   +  R D  P   A  S              RF   L   
Sbjct: 68  LFANHDLRIAVARVKQARAVFVERRLDQAPHITAQGSFDRREQQQVIAGNQRF---LTEQ 124

Query: 116 STGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
           +T  LD+ W++DLFG QRR  E++ A+LD+  A +   ++ V +++  +Y + R  ++R+
Sbjct: 125 TTLGLDAAWELDLFGRQRRASEAARADLDAEQANLQDVQVTVAAEVARNYFELRGTQKRL 184

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
            ++ + L   +   +L+  ++  GA S+L +    A +K+IE+DIP LE +     H ++
Sbjct: 185 DVSKRTLTNLRDTQKLTQTRWDLGAGSELDVQSSLARLKAIEADIPLLETAEAQYRHRLA 244

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
            LLG         +  +     P    P+ +G  A L+R RPD+R  E++LA + A++G+
Sbjct: 245 VLLGQQPDALDATLAARE---MPAFARPLPLGDTAGLLRQRPDVRGAERRLAAATAQVGV 301

Query: 295 AKSDLYPSLSLNGSIA-LTHDNS--FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           A +DL+P +S++G +  LT D +    G    WS  P +    FD G +++ +R +++ A
Sbjct: 302 ATADLFPRISVSGFVGFLTGDAARLTEGNAKAWSVTPSISWAAFDFGTVRARLRASKAQA 361

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           +     +Q+TVL A+++ ENAL      +  +  +       +++  L+ I YR+G    
Sbjct: 362 EGALAQYQQTVLLALEDTENALIGYGRQQARLAIVVEQANAARRAEQLAQIRYREGSEDF 421

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGS 448
           L +LD +R     +  L+ A+  +    V +Y A+G 
Sbjct: 422 LTLLDAQRTQLAADDALAQAETAVNVGVVGVYKALGG 458


>gi|283478983|emb|CAY74899.1| Outer membrane efflux protein precursor [Erwinia pyrifoliae DSM
           12163]
          Length = 521

 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 127/480 (26%), Positives = 240/480 (50%), Gaps = 50/480 (10%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQF----SIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQ 70
           L+GC +GP+Y  P  P +P  F    +   +K L +     WW++FND  L+ L++ A+Q
Sbjct: 28  LSGCVLGPDYQPPR-PAMPEVFNSMQAQQGAKPLASATRADWWKAFNDPQLDSLIERAVQ 86

Query: 71  QNLTILQATERINAAKENILSVRADLFPSSYASISHRFI--------------------- 109
            NL++ QA  RI  A++ +   R    PS   S + RF                      
Sbjct: 87  GNLSLQQAVLRIAGARQQLNQARGAWAPS--VSSNARFTRQQLGVKGELESQGIDDRLNG 144

Query: 110 --------PNLKTNS------TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKL 154
                   P L +         G  D+ W++DL+G+ RR +E + A    +  + + A +
Sbjct: 145 VDNADSVRPALDSLEKPIGLYQGSFDASWELDLWGKVRRQVEMADARQQQSAEERNDALV 204

Query: 155 NVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKS 214
           ++ +++  +Y+  R  +         +D+ ++ ++L+  +   G   + ++    A++ S
Sbjct: 205 SLEAEVARAYLQLRGAQAITQTIETQIDVAQQTLDLTQSQQRNGLAPQTNVENARAQLSS 264

Query: 215 IESDIPTLEKSFRMNVHNISTLLG-YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIR 273
           + + +P  +      ++ ++ L G  P         +++    P L   +++G+P++L R
Sbjct: 265 LRAQLPQYQAQIHQAMNGLAVLTGQVPGALDAELTARKA---LPVLPPAVSVGVPSELAR 321

Query: 274 NRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS--FPGYNTH-WSFGPKL 330
            RPD+R  E  L  + A IG++ + L+PSLSL+G   + + ++     +++H +SFGP +
Sbjct: 322 RRPDVRAAEASLHAATASIGVSVAQLFPSLSLSGQFGMRNSDASYLDNWSSHFYSFGPSV 381

Query: 331 YLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAV 390
            LPIF  G++ SN++ A +      + +++TVL A+++VENAL S   D++ VT L  +V
Sbjct: 382 TLPIFQGGRLVSNVKLARAQQASAALQYRQTVLTALQDVENALVSYRSDRQQVTGLDESV 441

Query: 391 ELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +  + + +L+   YRQG  S ++ LD +R  A+V+     A+ Q     V LY A+G G+
Sbjct: 442 QALQNAFNLASDGYRQGLSSFIEPLDAQRQLAQVQQQAEQARVQSRLDLVALYKALGGGW 501


>gi|261855396|ref|YP_003262679.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Halothiobacillus neapolitanus c2]
 gi|261835865|gb|ACX95632.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Halothiobacillus neapolitanus c2]
          Length = 493

 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 131/458 (28%), Positives = 231/458 (50%), Gaps = 22/458 (4%)

Query: 13  VLLAGCT-VGPEYTKPHMPLLPT-QFSIGNSK--NLINIDTLKWWESFNDTSLNKLVKIA 68
           ++L+GC  VGP+Y KP +P+    Q  I N+   ++ +    +WW  F+D  L++L++ A
Sbjct: 27  LILSGCAAVGPDYQKPTVPVPKNWQSPIVNASPPSVDDAGLARWWREFHDPVLDRLIERA 86

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN--------LKTNSTGQL 120
           L  N  + QA  R+  A+       AD FP+   + S   I +        +    T   
Sbjct: 87  LANNKNLKQAEARLLEARARRGFAEADRFPTLGTNASANRIGSSQELGSGLINNQYTAGF 146

Query: 121 DSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQ 179
           D+ W++D+FG +RR +E++ A ++++ A +   + ++ +++  +Y++ R F  R+++A  
Sbjct: 147 DARWEMDIFGGKRRALEAASAQVEASEADLSAVQTSLTAEVGVNYLNLRAFAARLAVAEA 206

Query: 180 ILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGY 239
            L +  +  +L+  ++  G TS+L L +  + ++   + IP LE +     + I+ LLG 
Sbjct: 207 NLAIQTQTRDLAQWRYQAGLTSRLDLEQATSALEQTRAQIPVLETNLAQTKNQIAILLGI 266

Query: 240 PATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDL 299
              +   +         P     +N GIPADL+R RPDIR  E++LA   A+IG+A +  
Sbjct: 267 NPEDLPPFATAPI----PQADAMMNTGIPADLLRRRPDIRRAERQLAAQTAQIGVATAAQ 322

Query: 300 YPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYI 356
           YP  SL GSI L      N F      +S G      +FD G+I  NI+   +   +   
Sbjct: 323 YPDFSLAGSIGLASLASGNLFTAGAKTFSIGSNAAWTLFDAGRIHQNIQIQNALQAQALA 382

Query: 357 TWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILD 416
            ++ TVL A  EVENAL S   +++    L  AV   + + +L+   Y  G      +LD
Sbjct: 383 QYESTVLTAFAEVENALISYAREQERRAALTRAVAAAQSAQALAQSQYAAGLIDFQSVLD 442

Query: 417 IERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY--NP 452
            +R+   ++  L+ ++  ++ S + LY A+G G+  NP
Sbjct: 443 TQRSLLTLQDLLTTSEAAVSTSLIQLYKALGGGWVANP 480


>gi|46581648|ref|YP_012456.1| RND efflux system outer membrane lipoprotein [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|46451071|gb|AAS97716.1| RND efflux system, outer membrane protein, NodT family
           [Desulfovibrio vulgaris str. Hildenborough]
 gi|311235289|gb|ADP88143.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfovibrio vulgaris RCH1]
          Length = 541

 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 127/470 (27%), Positives = 233/470 (49%), Gaps = 44/470 (9%)

Query: 16  AGCTVGPEYTKP--HMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNL 73
           A   VGP+++ P   +P +    S   + +  ++D   WW +FND  L+ LV  A   NL
Sbjct: 40  ACAKVGPDFSAPGGDVPDVWQDASHPVASSDADVDG-TWWNTFNDPVLDSLVTEARSANL 98

Query: 74  TILQATERINAAKENILSVRADLFPSS--------YASISHRFIPNLKTNSTGQ------ 119
           ++  A  R+  A+  + +   +L+P +        +   S R  P     +TG+      
Sbjct: 99  SLHLAALRVFEARARLGAAVGNLYPQTQQGTGGLTWTHPSDR-APTAPQPTTGRDNPDYV 157

Query: 120 -----LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
                LD  W++D +G+ RR IE++ A+L ++ A    A ++V +++  SYI  R  +++
Sbjct: 158 QTSAGLDVAWELDFWGKFRRGIEAADADLRASMADHQTALVSVSAEVARSYILYRTVQKQ 217

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
           ++IA   + + ++++ ++  +F  GATS+  + +  + ++  E+ IP L  S R   + +
Sbjct: 218 LAIAETNVAIQRESLRIATARFNYGATSERDMRQALSLLRDTEARIPNLAHSLRETRNAL 277

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
             LLG    +      +  +   P     + +GIPADL+R RPD+       A   A++G
Sbjct: 278 CVLLGKAPQDI---SARLGDAPIPTAPTHVAVGIPADLLRRRPDVHKALATAAGQCARLG 334

Query: 294 IAKSDLYPSLSLNGSIALT------------HDNSFPGYNTHWSFGPKLYLPIFDKGKIK 341
           +AK+D YP+ +L G +  T              N F  Y      GP L LP+F+ G+I 
Sbjct: 335 VAKADFYPAFTLGGFVGFTASNVGAFGLGDTFSNGFTAYG-----GPGLSLPLFNYGRIV 389

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           SN+R  ++  Q+   +++ETVL A++E E+A+    + +     L  +     +SM L++
Sbjct: 390 SNVRAQDARFQQSLTSYRETVLVALRETEDAIDRFIQAQGRTALLTESASDAARSMQLAL 449

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           I Y++G      +L   R  A  E  L+ AK ++ +S V ++ A+G G++
Sbjct: 450 IQYQEGSTDFTTVLTAARDLATREDALAAAKGEICQSLVAMFKALGGGWH 499


>gi|70730606|ref|YP_260347.1| multidrug efflux RND outer membrane protein OprN [Pseudomonas
           fluorescens Pf-5]
 gi|68344905|gb|AAY92511.1| multidrug efflux RND outer membrane protein OprN [Pseudomonas
           fluorescens Pf-5]
          Length = 473

 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 130/462 (28%), Positives = 232/462 (50%), Gaps = 21/462 (4%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK----WWESFNDTSLNKL 64
           SL ++ L+ C VGP+Y  P         +   +    N D  +    WW+ F+D +LN+L
Sbjct: 9   SLLVLALSACAVGPDYQTPTTEAAHISAATDGAAGQKNFDRARFEGIWWQQFDDPTLNQL 68

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPS--SYAS--ISHRFIPNLKTNSTGQ- 119
           V  +LQ N  +  A  R+ AA+        D  P+  S AS  ++   IP   T      
Sbjct: 69  VSKSLQGNRELRVAFARLRAARAIRDDASNDAMPTITSRASSDLAKGQIPGQTTKRVNSE 128

Query: 120 -----LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
                LD  W++DLFG+ +R++E++ A+  +A A +   ++ +I++L+ +Y   R  + R
Sbjct: 129 RYDLGLDMAWELDLFGRIQRNLEATDADQQAAEADLYQLQVTMIAELVDAYGQLRGAQLR 188

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
             IA   LD  +++ +++      G   +L +V+ +A + S+E+ +P L+       + I
Sbjct: 189 EKIALANLDNQQESRKITESLRDAGVGDQLDVVRADARLASVEASVPQLQAEQTRQRNRI 248

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
           +TLLG    +    +   S    P +   + IG P +L++ RPDI   E+KLA + A+IG
Sbjct: 249 ATLLGERPDKLSVDL---SPAQLPAIAKALPIGDPGELLQRRPDILSAERKLAAATARIG 305

Query: 294 IAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESS 350
           +AK+DL+P +SL+G +  T              W+ GP +    FD G +++ +R A+++
Sbjct: 306 VAKADLFPRVSLSGFLGFTAGRGSQIGSSAANAWALGPSITWAAFDLGSVRARLRGADAN 365

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
           A     ++++ VL A++E ENA +   + ++ +  L    E  + +  L+ I YR+G   
Sbjct: 366 ADGALASYEQQVLLALEESENAFSDYGKRQQRLISLIRQSESSRAAADLAEIRYREGTVD 425

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            L +LD +R     E   + A+  L +  V +Y A+G G+ P
Sbjct: 426 FLVLLDAQRERLAAEDSQAQAEVDLYRGIVAIYKALGGGWQP 467


>gi|295096495|emb|CBK85585.1| efflux transporter, outer membrane factor (OMF) lipoprotein, NodT
           family [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 496

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 130/482 (26%), Positives = 242/482 (50%), Gaps = 45/482 (9%)

Query: 12  IVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL----KWWESFNDTSLNKLVKI 67
           ++LL GC VGP Y +P  P        G+S       +     +WW++F    L+ L++ 
Sbjct: 1   MMLLVGCAVGPNYQQPAPPATTHWNDKGDSAVKSQTSSAATNPRWWKTFGSPQLDSLIER 60

Query: 68  ALQQNLTILQATERINAAKENILSVRADLFPSSYASI--------------SHRFI---- 109
           A+  NLT+ Q   RI  A+E I       FPS   ++              SH       
Sbjct: 61  AIAGNLTLQQTVLRIAGAREQINQAGGAFFPSVNGNVQATRQQLGLEGELKSHGVYDQLN 120

Query: 110 ---PNLKTN----------STGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLN 155
              P L+              G  D+ W+IDL+G+ RR +E++ A   +A  Q + A ++
Sbjct: 121 NVDPELRGALGPLTQPINLYQGSFDAQWEIDLWGKVRRQVEAAEAQQRAAIEQRNDALVS 180

Query: 156 VISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSI 215
           + +++  +++  R  +  I+  +  ++  ++ ++L+  +   G + ++ +    A++ ++
Sbjct: 181 LEAEVARAWLQLRGAQSIIATLNTQIESAQQTLDLTESRQRGGLSPQMDVENARAQLGNL 240

Query: 216 ESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP--INIGIPADLIR 273
           E+ +P  +   R  ++ ++ LLG P       +Q    + QP   +P  +  GIP+ L R
Sbjct: 241 EAQLPQYQAQERQAMNGLAILLGKPPGALDAELQ----SVQPIPALPDIVQTGIPSTLAR 296

Query: 274 NRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIAL--THDNSFPGYNTH-WSFGPKL 330
            RPD+R  E  L  + A+IG++ ++L+PS +L+G   L  +  N    +++H +SFGP++
Sbjct: 297 RRPDVREAEANLHAATAQIGVSVAELFPSFTLSGQFGLRNSESNWLTDWSSHFYSFGPQV 356

Query: 331 YLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAV 390
            +PIF  G++ S+++ A +      + +++TVL A+ +VENAL S   D++    L   +
Sbjct: 357 SIPIFQGGRLVSSVKVARAQQGAAVLDYRQTVLTALGDVENALVSYRTDQQREAGLAKTI 416

Query: 391 ELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +  + +  L+  +YRQG  S +D+LD +R  A+ E   + A+ Q A   V LY A+G G+
Sbjct: 417 DALQNAFDLASDSYRQGIASFIDVLDAQRQLAQAEQQRAQAQVQSALDLVALYKALGGGW 476

Query: 451 NP 452
            P
Sbjct: 477 EP 478


>gi|77456372|ref|YP_345877.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           fluorescens Pf0-1]
 gi|77380375|gb|ABA71888.1| putative ABC transport system, lipoprotein [Pseudomonas fluorescens
           Pf0-1]
          Length = 483

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 128/470 (27%), Positives = 238/470 (50%), Gaps = 32/470 (6%)

Query: 9   SLFIVL----LAGCTVGPEYTKPHMPLL-----PTQFSIGNSKNLINIDTLKWWESFNDT 59
           SL +VL    LA CTVGP++ KP    +     P++ ++  S+ +      +WWE F+D 
Sbjct: 6   SLTVVLSLSALAACTVGPDFQKPQATQIAEWAKPSKTAV--SQAVSEPLNERWWEVFHDA 63

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN----LKTN 115
            L+ L + AL+ NL +  A+ R+  ++     + AD +P++ A+ S+    N    L   
Sbjct: 64  QLSALTQRALRSNLDLQLASSRLQQSRAARQVITADRYPTTAATGSYARKRNSGEGLNDP 123

Query: 116 STGQLDS-----------DWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPS 163
           S    DS            W++D +G+ RR  E++ ANL+ A        L V++    +
Sbjct: 124 SGHNGDSAFNLWDAGFSASWELDFWGRVRRETEAADANLEVAENDRRGVLLAVLADTAQN 183

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           YI  R  +   ++  Q LD+ + +++LS L+   G  + L + +  A++ +IES +P LE
Sbjct: 184 YIQLRGVQNTRAVTEQNLDVARHSLKLSQLRLNDGVATDLDVAEAAAQVAAIESRLPALE 243

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +     ++ IS L+G P       +   ++   P   + + IG+P+ L   RPDIR  E 
Sbjct: 244 QRQAQLINAISLLMGEPPQTLAKELS--TDAPVPQSPLTVAIGLPSQLAERRPDIRQAEA 301

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIA--LTHDNSFPGYNTH-WSFGPKLYLPIFDKGKI 340
           +L  + A IG+AK D YP ++L+G++       + F  + +  +  GP+  LP+FD G++
Sbjct: 302 RLHAATANIGVAKGDFYPRITLSGNLGSQAMQLSDFGSWGSRAFGIGPQFSLPLFDGGRL 361

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           +  ++  E+  QE  I +Q+TVL A  E+++ LT+ N  ++    L  AV  ++ ++  +
Sbjct: 362 RGVLQLREAQQQEAAIGYQQTVLRAWHEIDDQLTAYNASQRRRDSLAEAVRQNQIALRTA 421

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              Y +G    +++L ++ A    +     +   ++ + + LY A+G G+
Sbjct: 422 QQQYVEGVVDFVNVLTVQGALLATQEQWVESSTGVSLAMIGLYRALGGGW 471


>gi|186473792|ref|YP_001861134.1| RND efflux system outer membrane lipoprotein [Burkholderia phymatum
           STM815]
 gi|184196124|gb|ACC74088.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia phymatum STM815]
          Length = 515

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 130/481 (27%), Positives = 227/481 (47%), Gaps = 49/481 (10%)

Query: 17  GCTVGPEYTKP--HMPLL--PTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQN 72
           GC VGP++ +P    P +   TQ +   SK +       WWE FND +LN L K     N
Sbjct: 23  GCLVGPDFERPASSTPDVFNRTQSAQAPSKAVEAGFNPDWWELFNDPTLNALEKQLADAN 82

Query: 73  LTILQATERINAAKENILSVRADLFP---------------------------------- 98
           L +  A+ R+  ++       A  +P                                  
Sbjct: 83  LDVAAASARLRQSRAEQRVAGAAEYPTLTGAASYNRERGSENGILSLLGVTPTSTQPQSA 142

Query: 99  SSYASISHRFIPNLKTNSTGQL-----DSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIA 152
           S  A +    +P  K +    L     D+ W+ID++G+ RR +E++ A  D+++ + +  
Sbjct: 143 SGSAPLGVSAMPGSKGSPAYDLYQFGFDASWEIDIWGRVRRSVEAASALTDASFEERNAV 202

Query: 153 KLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEI 212
            L+  ++L   YI  R  +  + IA Q LD+ +    L+  +  +G T+ L +    A+ 
Sbjct: 203 LLSARAELARDYIQLRDTQALLQIARQNLDIARDATRLTQTRAHEGVTTDLDVANASAQA 262

Query: 213 KSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLI 272
            +IES IPTLE      ++ I  LL          +    +   P L   + IG P++L+
Sbjct: 263 ANIESLIPTLESRRATTINAIGVLLAKEPGALGDMLADPGD--VPALPAQVPIGFPSELV 320

Query: 273 RNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIA---LTHDNSFPGYNTHWSFGPK 329
           + RPDIR  E +L  + A IG+AK+D YP +SLNGS     L   N     +  +  GP 
Sbjct: 321 QRRPDIRKAEAQLHAATAAIGMAKADFYPRISLNGSAGFQSLQLSNLADWASGQFVVGPS 380

Query: 330 LYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHA 389
           + LPIF+ G++K  ++  E+  QE  I ++ TVL A +EV++AL   + +++   +L+  
Sbjct: 381 ITLPIFEGGRLKGTLQLREAQQQEAAIVYKRTVLQAWREVDDALIVYDAEQRRHERLEEV 440

Query: 390 VELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           V+L+ +++S++   Y+ G    LD+L++++     + +L  +K     + + L   +G G
Sbjct: 441 VKLNLRALSIARQRYKAGAVDFLDVLNVQKQLLDAQSNLEQSKADADANLITLCKVLGGG 500

Query: 450 Y 450
           +
Sbjct: 501 W 501


>gi|224826361|ref|ZP_03699463.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Lutiella nitroferrum 2002]
 gi|224601462|gb|EEG07643.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Lutiella nitroferrum 2002]
          Length = 496

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 117/465 (25%), Positives = 233/465 (50%), Gaps = 22/465 (4%)

Query: 5   RAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSI--GNSKNLI--NIDTLKWWESFNDTS 60
           RA+F +  +L   C VGP+Y  P + + P       G     +    +  +WWE  +D  
Sbjct: 29  RAVF-VMPLLATACAVGPDYRAPALAVPPAWHGPLQGGLHTTVPPAAELARWWERLDDPL 87

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS--SYASISHRFIPNLKTNSTG 118
           L++L+  A+  NL +  A  R+  A+       A+ +P+  + A+++     +  +   G
Sbjct: 88  LSRLIDEAVANNLDVKLAQARLREARARYGLAVAERYPALNARAAVNRNRSSDEMSQGNG 147

Query: 119 --------QLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                   QLD++W++DLFG  RR  E++ A LD+    +   ++++++++   Y++AR 
Sbjct: 148 RAVETWSAQLDANWELDLFGGLRRAQEAAAATLDAEQEALRDTRVSLLAEVALGYVEARG 207

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
           F+ R+++A   L    +  +++  +   G T++L   +    ++   + +P L++    +
Sbjct: 208 FQARLALARGSLATQDETWQITRWRHQAGLTTQLDEDQARFNLEQTRAQLPALQQGLAQS 267

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
              ++ LLG    E     Q  +    P+L   + +GIPAD +R RPD+R  E++LA + 
Sbjct: 268 KQRLAVLLGRAPGELSELDQPAAI---PHLPATVAVGIPADTLRQRPDLRRAERQLAAAT 324

Query: 290 AKIGIAKSDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           A++G+A +  YP +SL+G++   AL+           ++ G  +   +FD G+++ NI  
Sbjct: 325 AQVGVASAAAYPDVSLSGTLGLQALSGGRLLRSSAGLYALGASVGQVVFDAGRVRHNIEV 384

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
             +  Q+  + +Q  VL A+++VE AL +  E++     L+ AV   + +  L+   Y+ 
Sbjct: 385 QNALQQQAQLNYQSAVLTALRDVEGALVAYAEEQNRGVALREAVTAAQGAADLASSQYQA 444

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           G      +LD +R+   ++  LS ++     + V LY A+G G++
Sbjct: 445 GLVDFQAVLDTQRSLLSLQDQLSQSEAAAVSNLVRLYKALGGGWD 489


>gi|54293646|ref|YP_126061.1| hypothetical protein lpl0699 [Legionella pneumophila str. Lens]
 gi|53753478|emb|CAH14933.1| hypothetical protein lpl0699 [Legionella pneumophila str. Lens]
          Length = 489

 Score =  187 bits (475), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 130/478 (27%), Positives = 239/478 (50%), Gaps = 38/478 (7%)

Query: 5   RAIFSLF-IVLLAGCTVGPEYTKPHM------PLLPTQFSIGNSKNLINIDTLKWWESFN 57
           R +  LF I  L GCTVGP+Y +P +      P    +  I +S  +     L WW++F+
Sbjct: 3   RKLALLFSISCLFGCTVGPDYQRPDIKIQEKWPTSKVEKKISSSAPV----HLTWWKAFH 58

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYAS-------ISHRFIP 110
           D  L++ +  A   NL I  A  RI  A+       A+ +P    S       IS   + 
Sbjct: 59  DPLLDRYISEAATNNLDIKAAEARIRQARAMKQISLANFYPQINGSASANSLQISKGTLE 118

Query: 111 NLKTNSTG-------------QLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNV 156
            +  NS                 D+ W++DLFG+ RR +E+S A+L+ AY       L+ 
Sbjct: 119 GIFANSPTYTLIDRNQWIYNLGFDAQWELDLFGKTRRKVEASKASLEEAYESRRTILLST 178

Query: 157 ISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE 216
           I+++  SYI+ R  ++   IA + ++L +K + L   ++  G +S++ +   E ++K+ E
Sbjct: 179 IAEIARSYIELRGAQQLYGIAQKNVELQRKTLALVRQRYKAGVSSEVDVSLAEGQLKNTE 238

Query: 217 SDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRP 276
           S +P      ++N + I+ +LG      L  + K  +  +P   +P+  G+ +D++R RP
Sbjct: 239 SVLPNYIAQIQVNAYQIAVMLGKDPQTILKDIAKIQSLPKPPQKVPM--GLRSDILRQRP 296

Query: 277 DIRYQEKKLADSVAKIGIAKSDLYPSLSLNGS----IALTHDNSFPGYNTHWSFGPKLYL 332
           DIR  E++LA +VA+IG+A +D +P  +L+ S     + + D  F   +  W  GP++ L
Sbjct: 297 DIRATERQLASAVAEIGVAVADFFPQFNLSVSNLAFQSTSVDTLFQSSSGFWLMGPQVSL 356

Query: 333 PIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVEL 392
           PIF  G+I++N+   ++  Q+  I +++ +L A++E ++AL   ++       L+ A+  
Sbjct: 357 PIFHGGQIRANVESKKAVVQQAAIQYKKIILQALQEAQSALVRYSQSLDTNHSLRAAIIA 416

Query: 393 HKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +K+++  +   ++ G    L +L  E A    E     ++     + + LY A+G G+
Sbjct: 417 NKRAVQFAKKRFQYGEDDYLSLLQSEAALLNAETQEVNSEVSSLTALISLYKALGGGW 474


>gi|120601194|ref|YP_965594.1| RND efflux system outer membrane lipoprotein [Desulfovibrio
           vulgaris DP4]
 gi|120561423|gb|ABM27167.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfovibrio vulgaris DP4]
          Length = 541

 Score =  187 bits (475), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 129/466 (27%), Positives = 236/466 (50%), Gaps = 36/466 (7%)

Query: 16  AGCTVGPEYTKP--HMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNL 73
           A   VGP+++ P   +P +    S   + +  ++D   WW +FND  L+ LV  A   NL
Sbjct: 40  ACAKVGPDFSAPGGDVPDVWQDASHPVASSDADVDG-TWWNTFNDPVLDSLVTEARSANL 98

Query: 74  TILQATERINAAKENILSVRADLFPSS--------YASISHRFIPNLKTNSTGQ------ 119
           ++  A  R+  A+  + +   +L+P +        +   S R  P     +TG+      
Sbjct: 99  SLHLAALRVFEARARLGAAVGNLYPQTQQGTGGLTWTHPSDR-APTAPQPTTGRDNPDYV 157

Query: 120 -----LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
                LD  W++D +G+ RR IE++ A+L ++ A    A ++V +++  SYI  R  +++
Sbjct: 158 QTSAGLDVVWELDFWGKFRRGIEAADADLRASMADHQTALVSVSAEVARSYILYRTVQKQ 217

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
           ++IA   + + ++++ ++  +F  GATS+  + +  + ++  E+ IP L  S R   + +
Sbjct: 218 LAIAETNVAIQRESLRIATARFNYGATSERDMRQALSLLRDTEARIPNLAHSLRETRNAL 277

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
             LLG    +      +  +   P     + +GIPADL+R RPD+       A   A++G
Sbjct: 278 CVLLGKAPQDI---SARLGDAPIPTAPTHVAVGIPADLLRRRPDVHKALATAAGQCARLG 334

Query: 294 IAKSDLYPSLSLNGSIALTHDN--SFPGYNTHWS------FGPKLYLPIFDKGKIKSNIR 345
           +AK+D YP+ +L G +  T  N  SF G    +S       GP L LP+F+ G+I SN+R
Sbjct: 335 VAKADFYPAFTLGGFVGFTASNVGSF-GLGDTFSNGFTAYGGPGLSLPLFNYGRIVSNVR 393

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
             ++  Q+   +++ETVL A++E E+A+    + +     L  +     +SM L++I Y+
Sbjct: 394 AQDARFQQSLTSYRETVLVALRETEDAIDRFIQAQGRTALLTESASDAARSMQLALIQYQ 453

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +G      +L   R  A  E  L+ AK ++ +S V ++ A+G G++
Sbjct: 454 EGSTDFTTVLTAARDLATREDALAAAKGEICQSLVAMFKALGGGWH 499


>gi|94971098|ref|YP_593146.1| RND efflux system, outer membrane lipoprotein, NodT [Candidatus
           Koribacter versatilis Ellin345]
 gi|94553148|gb|ABF43072.1| RND efflux system, outer membrane lipoprotein, NodT [Candidatus
           Koribacter versatilis Ellin345]
          Length = 464

 Score =  187 bits (474), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 142/473 (30%), Positives = 239/473 (50%), Gaps = 32/473 (6%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSI----GNSKNLINIDTLKWWESF 56
           MN  R + +L ++L+AGC VGP Y +P +  +P  +      G   N I++   KWW+ F
Sbjct: 1   MNCKRILLALLLLLMAGCKVGPNYKRPAV-TVPDAYRGPTLDGGQANGISLGEQKWWDVF 59

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS--SYASISHRFIPNLKT 114
           ND  L KL++ AL  N  +  A  R+  A+  +   RAD FP+    AS  +  IP +K 
Sbjct: 60  NDEQLQKLIRQALDANYDVKIAATRVLQAQAALGITRADQFPTIAGGASALNERIPRVKG 119

Query: 115 -----NSTGQLDSD--WKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYID 166
                NS  Q++    W++D +G+ RR  E++ A+L S          +VIS +   Y  
Sbjct: 120 LPAYENSALQVNLSLVWQLDFWGKYRRATEAARADLLSTEWGKRAVINSVISNVANGYFQ 179

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
                  + IA   L   ++++ L +++   G TS L + + E  + +  + IP LE+  
Sbjct: 180 LLELDREMEIAKGTLASRQESLRLVNIRQKGGTTSLLDVRQSEQLLYTAAAAIPDLERRI 239

Query: 227 RMNVHNISTLLGY-PATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
               + IS LLG  P       +Q+     +  +   +  G+P+ L+  RPD++  E++L
Sbjct: 240 EQEENFISILLGQNPGP-----IQRGKPLVEFAILPSVPPGLPSTLLERRPDLQSAEQQL 294

Query: 286 ADSVAKIGIAKSDLYPSLSLNG-----SIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKI 340
             + A+IG+AK+D +P +SL       S ALT    F G    WSFG +L  PIF  GKI
Sbjct: 295 VAANARIGVAKADYFPQISLTALGGYQSSALT--GLFSGPAGLWSFGGQLAQPIFTGGKI 352

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           +SN+R  E+  QE    +Q+++  A +EV ++L +  ++++   +  +       +  L+
Sbjct: 353 RSNVRLTEAQQQEAVFRYQQSIQQAFREVSDSLVAYRKNQEFREQEANLAASAVDATRLA 412

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAK--SYVDLYIAIGSGYN 451
            I Y  G  S L++LD +  T   + ++S+A+ QL +  + V LY A+G G+ 
Sbjct: 413 RIRYEGGVSSYLEVLDND--TRSFDAEISLAQAQLGERVALVQLYNALGGGWQ 463


>gi|188534326|ref|YP_001908123.1| RND efflux system, outer membrane lipoprotein, NodT precursor
           [Erwinia tasmaniensis Et1/99]
 gi|188029368|emb|CAO97245.1| RND efflux system, outer membrane lipoprotein, NodT precursor
           [Erwinia tasmaniensis Et1/99]
          Length = 515

 Score =  187 bits (474), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 128/480 (26%), Positives = 237/480 (49%), Gaps = 50/480 (10%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFS----IGNSKNLINIDTLKWWESFNDTSLNKLVKIALQ 70
           L GC +GP+Y +PH    P  F      G  K L +     WW++FND  L+ L++ A++
Sbjct: 22  LGGCALGPDY-QPHAANTPAAFHGEQMPGGGKTLASAPRADWWKAFNDPQLDSLIERAVR 80

Query: 71  QNLTILQATERINAAKENILSVRADLFPSSYASISHRFI--------------------- 109
            NL++ QA  RI  A++ +  VR    PS   S + RF                      
Sbjct: 81  GNLSLQQAVLRIAGARQQLNQVRGGWAPS--VSGNARFTRQQLGVKGELESQGIDQRLNG 138

Query: 110 --------PNLKTNS------TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKL 154
                   P L +         G  D+ W++DL+G+ RR +E + A    +  + + A +
Sbjct: 139 IDNADGVRPALDSLEKPIGLYQGSFDASWELDLWGKVRRQVEMADARQQQSVEERNDALV 198

Query: 155 NVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKS 214
           ++ +++   Y+  R  +         +D+ ++ ++L+  +   G   + ++    A++ S
Sbjct: 199 SLEAEVARVYLQLRGAQAITRTVETQIDVAQQTLDLTQSQQRNGLAPQTNVENARAQLNS 258

Query: 215 IESDIPTLEKSFRMNVHNISTLLG-YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIR 273
           + + +P  +    + ++ ++ L G  P         +++    P L   + +G+P++L R
Sbjct: 259 LRAQLPQYQAQIHLAMNGLAVLTGRVPGALDAELTPRKA---LPLLPPTLRVGVPSELAR 315

Query: 274 NRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS--FPGYNTH-WSFGPKL 330
            RPD+R  E  L  + A IG++ + L+PSLSL+G   + + ++     +++H +SFGP +
Sbjct: 316 RRPDVRAAEASLHAATANIGVSVAQLFPSLSLSGQFGMRNSDASYLDNWSSHFYSFGPSV 375

Query: 331 YLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAV 390
            LPIF  G++ S+++ A +      + +++TVL A+++VENAL S   D + VT L  +V
Sbjct: 376 TLPIFQGGRLVSSVKLARAQQASAALQYRQTVLTALQDVENALVSYRSDLQQVTGLDESV 435

Query: 391 ELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +  + +  L+  +YRQG  S +D LD +R  A+V+     A+ Q     V LY A+G G+
Sbjct: 436 QALQNAFHLASDSYRQGLSSFIDALDAQRQLAQVQQQAEQARLQSRLDLVALYKALGGGW 495


>gi|307292939|ref|ZP_07572785.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Sphingobium chlorophenolicum L-1]
 gi|306881005|gb|EFN12221.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Sphingobium chlorophenolicum L-1]
          Length = 509

 Score =  187 bits (474), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 132/482 (27%), Positives = 232/482 (48%), Gaps = 45/482 (9%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL-----INIDTL---KWWESFNDTS 60
           SL  + LAGCT+GP +TKP  P  P  ++   S +      I  D      WW +FND  
Sbjct: 19  SLMALALAGCTMGPNFTKP-APSAPADWTSWRSGDASLHGAIGTDATLPADWWRAFNDPV 77

Query: 61  LNKLVKIALQQN-------LTILQA-TERINAAKENILSVRADLFPSSYASISH------ 106
           L++LV+     +       L + QA  +R +AA + +  + A    S      H      
Sbjct: 78  LDELVRRGFAASPDLQTAALHVAQARVQRGSAAVQGLPQINASGQVSRQRQSEHGASTRL 137

Query: 107 -----------------RFIPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQ 148
                            + +    T     LD+ W++DL+G+ RR +E++ A +    A 
Sbjct: 138 LNVVSSSSSGSDRDALVKLLSEPFTLYQTGLDASWELDLWGKVRRSLEAADAGVAQQAAL 197

Query: 149 VDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKL 208
           +D A+L++ S +  +Y D R  + +I++A + +   K+  +L   + T G  +   L + 
Sbjct: 198 LDHARLSLASDVARNYFDLRATQRKIALAREDITALKERTDLLSARTTGGINNHFDLERQ 257

Query: 209 EAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIP 268
            +E++ IE+ +P L        + I+ LLG         ++  ++  +P L   + +G+P
Sbjct: 258 RSELQGIEAQLPALLAQEAAQANQIALLLGERPGALGDLLKPVADAGKPALP-DLALGLP 316

Query: 269 ADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWS 325
           +++   RPDIR  E +L    A IG+AK+D+YPS+ L G   L     +N F   +  WS
Sbjct: 317 SEIALCRPDIRAAEARLHSVTANIGVAKADMYPSIRLGGGFNLESYRAENLFDWASRAWS 376

Query: 326 FGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTK 385
            GP + LP+FD G+ K  ++  E   +E  +++Q+TVL A +E+++AL     +++    
Sbjct: 377 IGPSVSLPLFDGGRRKRVVQLRELEQKEAAVSYQQTVLQAWQEIDDALNGYTAEQQQNAM 436

Query: 386 LQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIA 445
           L   ++  + +  L+   YR G  + LD++D +R   +   DL+ +  +LA  Y  L  A
Sbjct: 437 LAARLDSARAAFDLASARYRGGVITWLDVIDSQRTMLQASRDLADSNGRLATRYAALNKA 496

Query: 446 IG 447
           IG
Sbjct: 497 IG 498


>gi|167033513|ref|YP_001668744.1| RND efflux system outer membrane lipoprotein [Pseudomonas putida
           GB-1]
 gi|166860001|gb|ABY98408.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Pseudomonas putida GB-1]
          Length = 471

 Score =  186 bits (473), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 135/472 (28%), Positives = 239/472 (50%), Gaps = 28/472 (5%)

Query: 1   MNILRAIF-SLFIVLLAGCTVGPEYTKPHMPLLPTQFSI---GNSKNLINIDTLKWWESF 56
           MN+L+ +  SL  + LA C VGP+Y  P     P Q +      + +    ++L WW+ F
Sbjct: 1   MNLLKPLTPSLLALALAACAVGPDYQAPATE--PAQLASDVQAKAYDRSRFESL-WWKQF 57

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFP--SSYAS--ISHRFIPNL 112
           +D  LN+LV+ +L  N  +  A  R+ +A+        D FP  +S AS  I    IP  
Sbjct: 58  DDPVLNQLVQASLDGNRDLRVAFARLKSARSIREDAENDQFPVVTSRASSDIGKGQIPGQ 117

Query: 113 KTNSTGQ------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
            T           LD  W++DLFG+ +R IE+S A    A A +   ++++I++L+ +Y 
Sbjct: 118 TTQRVNSERYDLGLDMAWELDLFGRIQRQIEASEAQEAVAAADLQQLQVSLIAELVDAYG 177

Query: 166 DAR--HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
             R    +E+I++A+  L   +++  ++      G  + L +V+ +A +  +E+ +P L+
Sbjct: 178 QLRGAQLREKIALAN--LKTQQESRTITETLRDAGVGNDLDVVRADARLAGVEATVPQLQ 235

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
                  H I+TLLG         +   S    P +   + +G P +L+R RPDIR  E+
Sbjct: 236 AEQARARHRIATLLGQRPDALSVDL---SPKALPAIAKALPVGDPGELLRRRPDIRSAER 292

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTH-DNSFPGYNTH--WSFGPKLYLPIFDKGKI 340
           +LA + A +G+A +DL+P +SL+G +  T    S  G +    W+ GP +    FD G +
Sbjct: 293 QLAAATANVGVATADLFPRVSLSGFLGFTAARGSQIGSSAANAWALGPSITWAAFDLGSV 352

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++ +R A++ A+     +++ VL A++E  NA +  ++ ++ +  L    +  +K+  L+
Sbjct: 353 RARLRGAKADAEGALANYEQQVLLALEESANAFSDYDKTQQRLLSLMRQSDASRKAAELA 412

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            I YR+G    L +LD ER     E   +  + +L +  V +Y A+G G+ P
Sbjct: 413 SIRYREGTVDYLVLLDAERERLSAEDAQAQGEVELYRGIVSIYKALGGGWQP 464


>gi|218885142|ref|YP_002434463.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218756096|gb|ACL06995.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 538

 Score =  186 bits (472), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 124/461 (26%), Positives = 234/461 (50%), Gaps = 36/461 (7%)

Query: 20  VGPEYTKPHMPLLPTQFSIGNSKNLINIDTL--KWWESFNDTSLNKLVKIALQQNLT--- 74
           VGP+++ P    +PT +             +  +WW +F+D +LN L+  A   NL+   
Sbjct: 40  VGPDFSAPDT-AMPTGWQDAAVLGATATREVSEEWWRTFDDATLNGLLAEARGGNLSLQV 98

Query: 75  ----ILQATERINAAKENILSVR------------ADLFPSSYASISHRFIPNLKTNSTG 118
               +L+A  R+  A  N+   R            +D  P++    + R  P+    S G
Sbjct: 99  TALRVLEARARLGVAVGNLYPQRQQATGGLTWTHPSDRTPTAPQPGTGRGNPDYVQTSVG 158

Query: 119 QLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIA 177
            LD+ W++D +G+ RR +E++ A+L +A A  + A + V + +  SY+  R  +++++IA
Sbjct: 159 -LDAAWELDFWGKYRRGVEAADADLRAAAADYEAAMVAVTANVAQSYVLYRTLQQQLAIA 217

Query: 178 HQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLL 237
              + + ++++ ++  +F  GATS+  + +  + ++  E+ IP+L  S R   + +  LL
Sbjct: 218 DNNVAIQRESLRIATARFNYGATSERDMRQALSLLRDTEASIPSLAHSLREARNALCVLL 277

Query: 238 GYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKS 297
           G P  +    +        P     + +GIPADL+R RPD+R  E   A   A++G+AK+
Sbjct: 278 GKPPQDLAAMLGTAPI---PTAPAGLALGIPADLLRRRPDVRKAEYAAAGQCARLGVAKA 334

Query: 298 DLYPSLSLNGSIALTHDNSFPGYNTHWSF--------GPKLYLPIFDKGKIKSNIRRAES 349
           D YPS+SL G +  T  N    ++T  +F        GP L LP+F+ G+I +N+R  ++
Sbjct: 335 DFYPSISLGGFVGFTASN-VGAFSTGDTFSHGFTAYGGPGLTLPLFNYGRIANNVRAQDA 393

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             Q+    ++ETVL+A++E E+ +      +     L  +     +S+ L+M+ Y++G  
Sbjct: 394 RFQQALTAYRETVLSALRETEDGIDRYLNAQGRAALLTESAADAARSLELAMVQYQEGST 453

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
               +L   R  +  +  L+ A  ++++S V ++ A+G G+
Sbjct: 454 DFTTVLTAARDLSTRQDALAQASGEISQSLVAVFKALGGGW 494


>gi|296103248|ref|YP_003613394.1| RND efflux system, outer membrane lipoprotein [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
 gi|295057707|gb|ADF62445.1| RND efflux system, outer membrane lipoprotein [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
          Length = 495

 Score =  186 bits (472), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 129/481 (26%), Positives = 242/481 (50%), Gaps = 45/481 (9%)

Query: 13  VLLAGCTVGPEYTKPHMPLLPTQFSIGNS----KNLINIDTLKWWESFNDTSLNKLVKIA 68
           +LLAGC VGP+Y  P  P +      G+S    +        +WW++F    L+ L++ A
Sbjct: 1   MLLAGCAVGPDYQPPAPPAVTHWNDKGDSTVKSQTTSAATNPRWWKTFGSPQLDSLIERA 60

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPSSYASI--------------SHRFI----- 109
           +  NL++ Q   RI  A+E I       +PS   ++              SH        
Sbjct: 61  IAGNLSLQQTVLRIAGAREQINQAGGAFYPSVNGNLQATRQQLGLEGELKSHGVYDQLDN 120

Query: 110 --PNLKTN----------STGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNV 156
             P L+              G  D+ W+IDL+G+ RR +E++ A   +A  Q + A +++
Sbjct: 121 VDPELRGALGPLTQPINLYQGSFDAQWEIDLWGKVRRQVEAAEAQQKAAIEQRNDALVSL 180

Query: 157 ISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE 216
            +++  +++  R  +  I+  +  +   ++ ++L+  +   G + ++ +    A++ ++E
Sbjct: 181 EAEVARAWLQLRGAQSIIATLNTQIKSAQQTLDLTESRQRGGLSPQMDVENARAQLGNLE 240

Query: 217 SDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP--INIGIPADLIRN 274
           + +P  +   R  ++ ++ LLG P       +Q    + QP   +P  +  GIP+ L R 
Sbjct: 241 AQLPQYQAQERQAMNGLAILLGKPPGALDAELQ----SAQPMPALPDIVQTGIPSTLARR 296

Query: 275 RPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIAL--THDNSFPGYNTH-WSFGPKLY 331
           RPD+R  E  L  + A+IG++ ++L+PS +L+G   L  +  N    +++H +SFGP++ 
Sbjct: 297 RPDVREAEANLHAATAQIGVSVAELFPSFTLSGQFGLRNSESNWLTDWSSHFYSFGPQVS 356

Query: 332 LPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVE 391
           +PIF  G++ S+++ A +      + +++TVL A+ +VENAL S   D++    L   ++
Sbjct: 357 IPIFQGGRLVSSVKVARAQQGAAVLDYRQTVLTALGDVENALVSYRTDQQREAGLAKTID 416

Query: 392 LHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             + +  L+  +YRQG  S +D+LD +R  A+ E   + A+ Q A   V LY A+G G+ 
Sbjct: 417 ALQNAFDLASDSYRQGIASFIDVLDAQRQLAQAEQQRAQAQVQSALDLVALYKALGGGWE 476

Query: 452 P 452
           P
Sbjct: 477 P 477


>gi|291616843|ref|YP_003519585.1| NodT [Pantoea ananatis LMG 20103]
 gi|291151873|gb|ADD76457.1| NodT [Pantoea ananatis LMG 20103]
          Length = 514

 Score =  186 bits (471), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 131/477 (27%), Positives = 241/477 (50%), Gaps = 40/477 (8%)

Query: 10  LFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL----KWWESFNDTSLNKLV 65
           + +  L GC+VGP+Y  P  P LP  +   +S+      T     +WW +F D  L+ L+
Sbjct: 21  MLLFALTGCSVGPDYQAPK-PQLPGSYHALDSQETSRPQTSAVDSRWWRNFGDPQLDSLI 79

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPS--SYASISHRFIPN---LKTNSTGQL 120
             A++ NL++ QA  RI  A+E +   +  LFPS    A ++ + +     LK N   QL
Sbjct: 80  ARAIEGNLSLQQAVLRIAGAREQLSQAQGGLFPSLNGSAKVTRQQLGLEGLLKANGADQL 139

Query: 121 DSD----------------------WKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVI 157
           DS+                      W++DL+G+ RR IES+ A   +A  Q + A +++ 
Sbjct: 140 DSNVASQLNGLTHPVTLYQGSFDASWELDLWGKVRRQIESANAQQQAAIEQRNDALVSLE 199

Query: 158 SKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIES 217
           ++++ +++  R  +  +    Q + +  +  +L+  +   G     ++    A++ S+++
Sbjct: 200 AEVVRAWLQLRGAQATVKTLQQQIAVADQTWQLTESQQRNGLAPVTNVENARAQLSSLQA 259

Query: 218 DIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPD 277
            +P  +   R  ++ ++ LLG         + +      P L   +++GIP+ L R RPD
Sbjct: 260 QLPQYQAQTRQAMNGLAVLLGKTPGALDAELSE--PKALPALPAFVSVGIPSTLARRRPD 317

Query: 278 IRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIAL--THDNSFPGYNTH-WSFGPKLYLPI 334
           IR  E  L    A+IG++ + L+PSLSL G + +  T  +    +++H +S GP L +PI
Sbjct: 318 IRQAEATLHAQTAEIGVSVAQLFPSLSLTGQLGVRNTDVSYLDNWSSHFYSVGPSLSIPI 377

Query: 335 FD-KGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELH 393
           F  +G   ++  R  +    +++ +++TVL A+++VENAL S   D++ VT L       
Sbjct: 378 FQGEGWFPASGWRGRNRP-ARHLNYRQTVLTALQDVENALVSYRADQQRVTALDETTGAL 436

Query: 394 KKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +++  L+  +YRQG  + L++LD +R  A+ +   + A+ Q     V LY A+G G+
Sbjct: 437 QRTFDLASDSYRQGLSTFLEVLDAQRQLAQAQEQATQARMQSGLDLVALYKALGGGW 493


>gi|171912833|ref|ZP_02928303.1| outer membrane protein [Verrucomicrobium spinosum DSM 4136]
          Length = 479

 Score =  186 bits (471), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 128/456 (28%), Positives = 232/456 (50%), Gaps = 20/456 (4%)

Query: 10  LFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL-KWWESFNDTSLNKLVKIA 68
           L + LL+ C VGP    P   +   QF   N    +   T+ +WW  +ND  LN LV  A
Sbjct: 12  LSLCLLSACAVGPNPKTPETQV-GAQFDNKNQGGYVTAPTVAQWWRRYNDPKLNSLVDRA 70

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPSSYASISHR--------FIPNLKTNST--- 117
           +  NL +  A  R+  A+    +VR D FP+  ++ S+           P L   S    
Sbjct: 71  IASNLDLKIAAARVEEARALRAAVRYDYFPTVTSAASYTNQRQSKAASSPGLDRTSELYD 130

Query: 118 GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISI 176
             LD+ W++D +G+ RR   ++ A++ +A A V+   + V +++  +Y++ R  + ++++
Sbjct: 131 AGLDASWELDFWGRVRRSNWAARADVRAAEAAVEDGLVLVTAEVASTYLELRGLQHQLAV 190

Query: 177 AHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL 236
             +  D  ++ ++L+      G  ++L   +  A++ S  + IP +E     ++H +S L
Sbjct: 191 RRRNADNQQQTLKLTESLLQGGRGTELDTSRARAQLNSTLAAIPLIEGLIAQDIHRLSVL 250

Query: 237 LGY-PATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIA 295
           +G  P+T     ++ +     P L   + IG P++L+R RPDIR  E  L  +  ++G+A
Sbjct: 251 IGTTPSTLKPELIKPRP---IPTLPSIVRIGNPSELLRRRPDIRAVEADLEAATHRVGVA 307

Query: 296 KSDLYPSLSLNGSIALTHDNSFPG-YNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQ 354
            +DL+P ++ NG+ +L  D SF G ++   SFGP++    FD G++K+ I  A +    Q
Sbjct: 308 TADLFPRVTFNGTASLQAD-SFSGPWSGANSFGPRISWAAFDLGRVKAQINAANARVDAQ 366

Query: 355 YITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDI 414
             T+ +TVL A++E ENAL +    +     L  +    +++ +L+   Y+ G    L +
Sbjct: 367 VSTYYKTVLGALEETENALVTFGRQRARRNYLSESATASEQAANLARERYQNGVADFLTV 426

Query: 415 LDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           LD ER   + +  L+ ++   A S V +Y A+G G+
Sbjct: 427 LDAERVLLEAQSLLAESQTATATSQVAIYKALGGGW 462


>gi|149376918|ref|ZP_01894673.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Marinobacter algicola DG893]
 gi|149358810|gb|EDM47279.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Marinobacter algicola DG893]
          Length = 464

 Score =  186 bits (471), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 112/433 (25%), Positives = 211/433 (48%), Gaps = 36/433 (8%)

Query: 12  IVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQ 71
           + LL GC VGP+Y  P  P  P  FS G +      D  ++W+ F+D  L +L+  AL  
Sbjct: 11  LALLTGCAVGPDYQAPATPE-PNAFSEGRTMVAGGTDQQRFWQGFDDPLLARLIDDALAT 69

Query: 72  NLTILQATERINAAKENILSVRADLFPSSYASIS--HRFIPNLKTNSTGQ---------- 119
           NLT+  A  R   A   +     D +PS  AS S   +++ +++ +  G           
Sbjct: 70  NLTLEGAVARYERAAALLYGAERDQWPSVTASASGAEQYLADIEQSPPGAGPERVQRYQA 129

Query: 120 -LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIA 177
            + + W++DLFG+ RR  E+  A L++  A +   ++ +  +L  SY + R  +E+  +A
Sbjct: 130 GVAASWELDLFGRLRRATEAQRAELEAVGADLGAVQVAIAGQLASSYFELRGLQEQYQVA 189

Query: 178 HQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLL 237
            Q + L ++++++   +   G  ++   V+   +++   +++PTL+   R  +H IS L 
Sbjct: 190 LQSVALQQQSLDIVEARVEAGRGTEFDQVRARVQLERTRAELPTLQAGIRGAMHRISVLT 249

Query: 238 GYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKS 297
           G P    +  +       +    IP++   P +++R RPDI   E++LA S A+IG+A +
Sbjct: 250 GQPPMALVETLSPLGALPETLPTIPVD--SPGEVLRRRPDIAAAERRLAASTARIGVATA 307

Query: 298 DLYPSLSLN---GSIALTHDNSFPG--------YNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           DL+P  +L+   GS+A    + F G            W+F         D  ++K+ I  
Sbjct: 308 DLFPRFTLSGLIGSVAGDTSDLFTGPAETRRVALGIDWTF--------LDHDRVKARIEA 359

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
           A + ++    ++Q+TVL A++E E  L      ++   +L+ A+   ++++ L+   Y +
Sbjct: 360 AGADSRAALASYQQTVLEALEEAETRLVRYQRAQQREERLEQAMNNAEQAVELARARYEE 419

Query: 407 GRYSLLDILDIER 419
           G     ++L  E+
Sbjct: 420 GFIGYFEVLTAEQ 432


>gi|19716262|gb|AAL95702.1|AF360362_4 TrpC [Pseudomonas putida]
          Length = 484

 Score =  185 bits (470), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 124/458 (27%), Positives = 231/458 (50%), Gaps = 25/458 (5%)

Query: 17  GCTVGPEYTKPH----MPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQN 72
           GCT+GP++ +P         P Q     S+       L+WWE+F+D  L+ L++   ++N
Sbjct: 18  GCTLGPDFQRPESQAPQQWAPLQGEAAASQPQAEPLELRWWETFHDARLSALIQRVAERN 77

Query: 73  LTILQATERINAAKENILSVRADLFPS-------SYASISHRFI--PNLKTNS------T 117
           L +  A+ R+  ++    ++ AD  PS       S A  S   +  P+ K          
Sbjct: 78  LDLQMASARLLQSRALRSTLAADEVPSVDMNAGYSRARNSADGLSDPSGKAGKEAFNLWQ 137

Query: 118 GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISI 176
           G L + W++DL+G+ RR +E++ A ++ A        L ++S+   +YI  R  +  + +
Sbjct: 138 GDLVAGWELDLWGRVRRQVEAADATVEVAENDRRGVLLALLSETAGNYIQLRAVQHTLDV 197

Query: 177 AHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL 236
               L + + +++LS  +  +G  ++L + +  A++ SIE+ +P+LE + R ++ N  +L
Sbjct: 198 TQDNLRVARHSLKLSQDRQAEGVATRLDVAQASAQVASIEARLPSLE-ARRDDLINALSL 256

Query: 237 LGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
           L       L     QS    P       IG+P++L   RPDIR  E +L  + A IG+AK
Sbjct: 257 LAAEPPRSLQAELLQSGEL-PAPQQKFAIGLPSELAERRPDIRQAEARLHAATASIGVAK 315

Query: 297 SDLYPSLSLNGSIALT--HDNSFPGYNTH-WSFGPKLYLPIFDKGKIKSNIRRAESSAQE 353
           +D YPS+ L+GS+       + F G+++  ++FGP++ LPIF+ G++K  +   E+  QE
Sbjct: 316 ADFYPSIRLSGSVGFQALQLSDFGGWDSRRFAFGPQMSLPIFEGGRLKGTLELREAQQQE 375

Query: 354 QYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLD 413
             + +++ VL A  E+++ L   N  +     L  AV  ++ ++  +   Y +G    L+
Sbjct: 376 AALNYRKVVLGAWHEIDDVLRLYNASQLRRDHLAEAVRQNRIALETAQRQYVEGAVDFLN 435

Query: 414 ILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +L ++ A    E     +   ++++ V LY A+G G+ 
Sbjct: 436 VLTVQGALLTSEEQWIDSSAAVSQALVGLYKALGGGWQ 473


>gi|322419323|ref|YP_004198546.1| NodT family RND efflux system, outer membrane lipoprotein
           [Geobacter sp. M18]
 gi|320125710|gb|ADW13270.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Geobacter sp. M18]
          Length = 476

 Score =  185 bits (470), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 127/469 (27%), Positives = 232/469 (49%), Gaps = 24/469 (5%)

Query: 3   ILRAIFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINI------DTLKWWES 55
           + RA+     + LAGC TVGP Y  P +   P ++   + K           D  +WW S
Sbjct: 6   VARALILSAALGLAGCVTVGPHYLAPELKA-PAKWQQLDDKGATQTTAAEDYDLSRWWLS 64

Query: 56  FNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTN 115
             D  L+ L++ AL  +  +L A  ++  ++       AD  P+  AS S     + + +
Sbjct: 65  LKDPLLSDLIEQALSASPDLLSAQAKLRESRARRSVAAADRLPTVTASGSAARSRSSEKS 124

Query: 116 STGQ--------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYID 166
            +G          D+ W++D FG  RR +E++ A+LD++ A +   ++ + +++   Y++
Sbjct: 125 GSGSTSNLFSAGFDASWELDAFGGVRRSVEAAAADLDASQATLQGVQVTLAAEVAQIYVE 184

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
            R  ++R+ IA   L    + ++L+  +   G  S   + +  +  +   + IPTLE S 
Sbjct: 185 LRTLQKRLGIARDNLASQSETLQLTQWRAQAGLVSTQDVEQALSNSEQTRAQIPTLETSL 244

Query: 227 RMNVHNISTLLGY-PATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
               H +  LLG  P T  LH    ++    P+L   + +GIPA+++R RPD+R  E+KL
Sbjct: 245 FEAEHRLDLLLGQTPGT--LHERLSKAGEL-PSLPSQVAVGIPAEMLRQRPDVRGAERKL 301

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
           A   A++G+A++  YPS  L+GSI   ALT           +S    +  PIFD GK++S
Sbjct: 302 AAETARVGVAEAARYPSFKLSGSIGLEALTLGGVAGASAAKYSLLGGIAAPIFDAGKLRS 361

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            +   ++  ++  + ++++VL A++EVENAL +++ +++    L+ A    + +  ++  
Sbjct: 362 QVAIQDAVREQAQVAYEQSVLTALQEVENALVALSRNQEREKALKSASTAAQSAAEMARQ 421

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            Y  G      ++D ER    VE  L+  +     + + LY A+G G+ 
Sbjct: 422 RYSAGLIDFQSVVDTERNVLSVEDSLAGTRGDGVLALIALYKALGGGWR 470


>gi|319796323|ref|YP_004157963.1| rnd efflux system, outer membrane lipoprotein, nodt family
           [Variovorax paradoxus EPS]
 gi|315598786|gb|ADU39852.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Variovorax paradoxus EPS]
          Length = 477

 Score =  185 bits (470), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 126/464 (27%), Positives = 223/464 (48%), Gaps = 24/464 (5%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK--WWESFNDTSLNK 63
           A F L  ++LAGC VGP YT P     P   S    ++L   D ++  WW   +D  L+ 
Sbjct: 9   APFVLSALVLAGCAVGPTYTAPSDA--PVAIS-APERSLFANDAVQRDWWRQLDDPQLDA 65

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH-RFIPN----------- 111
           LV+ AL  N  I  A  R+  A+ +      D  P      S  R I             
Sbjct: 66  LVERALAANHDIRIAEARLLEARASQTEAELDRLPVVTVGASKTRGIAQGNSGAQPDARA 125

Query: 112 LKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
           L  +S    D+ W+IDLFG+ +R  E++ A  +++ A ++  ++  +++L  +Y + R  
Sbjct: 126 LAQSSRAGFDASWEIDLFGRLKRLNEAATARTEASAADLEQVRIVAVAELARNYYEMRGA 185

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           ++R+++  + L+  + ++ ++  +   G   +  L   +A + + ES +PT E + R   
Sbjct: 186 EQRLAVTRRTLESLRSSLLVTEAQVQTGRGLEGDLASAQANLATTESQLPTFETTRRQAA 245

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + ++ L G    E    ++ Q       L   + IG   DL+R RPD+   E+ LA S A
Sbjct: 246 YRVAVLAGLRPAELDPMLRPQQLRV---LDKRLPIGDVGDLLRRRPDVLRAERGLAASTA 302

Query: 291 KIGIAKSDLYPSLSLNGS---IALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            +G   ++LYP   + G    IAL   +     +  +S  P +  P F  G +K+ +R A
Sbjct: 303 DVGATTAELYPRFDIGGFLGFIALRGSDLGSSSSRAFSVTPGVSWPAFRLGSVKARVRGA 362

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E+ A+     +++TVL AI++VE+ALT   ++++ +  L  A     ++  L+ + YR+G
Sbjct: 363 EARAEGDRALYEQTVLRAIEDVESALTGYGQNQQRLQSLVQAAARSGRAAELAEVRYREG 422

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
               L +LD +R   + +  ++ A+     S V LY A+G G+ 
Sbjct: 423 AAPYLSVLDAQRTLLRAQDAVAEAETASYTSLVALYKALGGGWQ 466


>gi|91789298|ref|YP_550250.1| RND efflux system outer membrane lipoprotein NodT [Polaromonas sp.
           JS666]
 gi|91698523|gb|ABE45352.1| RND efflux system, outer membrane lipoprotein, NodT [Polaromonas
           sp. JS666]
          Length = 486

 Score =  185 bits (470), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 126/474 (26%), Positives = 231/474 (48%), Gaps = 32/474 (6%)

Query: 8   FSLFIV--LLAGCTVGPEYTKPHMPLLPTQF----SIGNSKNLINIDTLKWWESFNDTSL 61
            ++FIV  L AGC VGP+Y +P  P+ P Q+    ++       + D + WW  F D  L
Sbjct: 7   LAIFIVAGLSAGCAVGPDYVRPDTPM-PQQYLGQPAVDQRHATAHADLVTWWTGFGDPLL 65

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASI-SHRFIPNLKT------ 114
            + V +A++QNL + QA+ R+  A+  + +  A L PS   S  + R   +L+T      
Sbjct: 66  TRFVTLAVEQNLDLAQASARVTQARAELGAANAALLPSGNVSGQAARAYQSLETPLGKVL 125

Query: 115 -NSTG----------QLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIP 162
             S G           L + W++D+FG  RR  E++LA   ++ A     +L V ++   
Sbjct: 126 SASPGFDRHGSSYETNLGASWELDVFGGLRRGKEAALAGYQASEAGAAATRLAVAAQTAD 185

Query: 163 SYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTL 222
           +YI  R  + R+ +A   +   ++ +   +L + +G  ++L + + E  +  + + +P L
Sbjct: 186 TYIIIRGLQTRLGVARGQVQTQQELLSTINLLYGKGLAAELQVRQAEGALAQVRASVPVL 245

Query: 223 EKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQE 282
           E    + ++ +  +LG P     H M+       P        G P +L+R RPD+   E
Sbjct: 246 EAGLDVAMNALDVMLGTPPGT--HRMELADAGVIPAAPQITAAGSPGELLRRRPDLIVAE 303

Query: 283 KKLADSVAKIGIAKSDLYPSLSLNGSIA----LTHDNSFPGYNTHWSFGPKLYLPIFDKG 338
           ++LA S A+IG+A ++ YP LSL+G I     ++  N F    +  +    L   +FD G
Sbjct: 304 RRLAASNARIGVAIAEYYPKLSLSGLIGSATSVSGGNLFTSGASQAAGVLGLRWRLFDFG 363

Query: 339 KIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMS 398
           +I + I +A     E    ++  VL A ++VENA +++ + ++    L   V+   ++ S
Sbjct: 364 RINAQIDQARGQEAEMLAAYRLAVLRATEDVENAFSALVKREEQAVVLAQGVDSLGRARS 423

Query: 399 LSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            S   Y++G  SL+++L  +    +     + A+ + A++ V  + A+G G+ P
Sbjct: 424 ASFAAYQKGVLSLIEVLQADDNLLRASDARAQAQTESARAAVATFKALGGGWQP 477


>gi|254502896|ref|ZP_05115047.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [Labrenzia alexandrii DFL-11]
 gi|222438967|gb|EEE45646.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [Labrenzia alexandrii DFL-11]
          Length = 497

 Score =  185 bits (470), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 128/467 (27%), Positives = 226/467 (48%), Gaps = 40/467 (8%)

Query: 20  VGPEYTKPHMPLLPTQFSIGNSKNLINID-----------TLKWWESFNDTSLNKLVKIA 68
           VGP++ +P  P+L    S G   NL ++D           ++ WW  F D +LN L+  A
Sbjct: 2   VGPDFERPEAPVLD---SWGKGANL-SVDHRTGFTTRSAASVPWWHVFKDEALNGLIAEA 57

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPSSYA----SISHRF------IPNLK----- 113
            +QN+ +  A  R+  A+  +   R +LFP        S + RF      I +L+     
Sbjct: 58  YRQNVELQAAGVRVYQARAQLGIARGELFPQVQQLKGNSENIRFSTQDPIIRDLERAGLV 117

Query: 114 ----TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
               +  +   D+ W+ID++G+ RR ++S+ ANL++  A  D A + +   +  +Y+  R
Sbjct: 118 DSHISRVSAGFDAAWEIDIWGKIRRDVQSAKANLNANLASYDDALVTLTGDIAATYVTIR 177

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
             ++  + + +   L KK++ L+ L+   G  S+L + +      +  + IP  E     
Sbjct: 178 ELQQLAASSRKNAALQKKSLNLTQLRLENGVASQLDVHEATVLYNNTLAAIPGYEAELAQ 237

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
             + +S LL  P  +       +S    P +   + IG+PAD++R RPDIR  E      
Sbjct: 238 AYNAMSVLLSEPPGKMKARFSGRSGF--PRVPAEVAIGVPADMLRRRPDIRQAEYIAGAQ 295

Query: 289 VAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
            A+IG+AK+DL+P+ +++G+I +  D   N F G  T   F P       + G+I++N+R
Sbjct: 296 SAQIGVAKADLFPAFTISGAIGVRADDFSNLFTGGATTALFNPGFSWNFLNYGRIRNNVR 355

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
             ++  QE  +T++ TVL+A  EVENALT     K+    L+ ++   + S+      Y 
Sbjct: 356 VQDAKFQEALLTYENTVLSAYAEVENALTGFLRSKQQALYLRRSLRAARSSVGEVEAQYE 415

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            G  S   ++D +++    E  L  A+  +  + V +Y  +G G+ P
Sbjct: 416 DGTASYNRVVDAQKSLLVAEERLIAAEANVLTNLVAVYKGLGGGWAP 462


>gi|289670143|ref|ZP_06491218.1| outer membrane protein [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 467

 Score =  185 bits (470), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 117/429 (27%), Positives = 211/429 (49%), Gaps = 24/429 (5%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKI 67
            +L  ++L+GC VGP+Y +P  P   T     +           WW  F+D  L +LV+ 
Sbjct: 1   MALAALVLSGCAVGPDY-RPDPPAAVTLQGAQDPAYSAESPVGNWWSQFDDPVLEQLVRD 59

Query: 68  ALQQNLTILQATERINAAKENILSVRADLFPSSYASIS-------------HRFIPNLKT 114
           AL  N  +  A  R+  A+   +  R D  P   A  S              RF   L  
Sbjct: 60  ALFANHDLRIAVSRVKQARAVFVERRLDQAPHITAQSSFDRREQQQVVAGNQRF---LTE 116

Query: 115 NSTGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
            +T  LD+ W++DLFG QRR  E++ A+LD+  A +   ++ V +++  +Y   R  +++
Sbjct: 117 QTTLGLDAAWELDLFGRQRRASEAARADLDAEQANLQDVQVTVAAEVARNYFQLRGTQKQ 176

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
           + ++ + L       +L+  ++  GA S+L +    A +K+IE+DIP LE +     H +
Sbjct: 177 LEVSKRTLANLHDTQKLTQTRWDLGAGSELDVQSSLARLKAIEADIPLLETAEAQYRHRL 236

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
           + LLG         +  ++    P    P+ +G  A L+R RPD+R  E++LA + A++G
Sbjct: 237 AVLLGQQPDALDATLVART---MPAFARPLPLGDTAGLLRQRPDVRVAERRLAAATAQVG 293

Query: 294 IAKSDLYPSLSLNGSIALTHDNSF---PGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESS 350
           +A +DL+P +S++G +     ++     G    WS  P +    FD G +++ +R +++ 
Sbjct: 294 VATADLFPRISVSGFVGFLSGDAARLTEGNAKAWSITPSISWAAFDFGTVRARLRASKAQ 353

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
           A+     +Q+ VL A+++ ENAL      +  +  +    +  +++  L+ I YR+G   
Sbjct: 354 AEGALAQYQQAVLLALEDTENALIGYGRQQARLAIVVEQAKAARRAEQLAQIRYREGSED 413

Query: 411 LLDILDIER 419
            L +LD +R
Sbjct: 414 FLTLLDAQR 422


>gi|289663002|ref|ZP_06484583.1| outer membrane protein [Xanthomonas campestris pv. vasculorum
           NCPPB702]
          Length = 474

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 117/428 (27%), Positives = 211/428 (49%), Gaps = 24/428 (5%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIA 68
           +L  ++L+GC VGP+Y +P  P   T     +           WW  F+D  L +LV+ A
Sbjct: 9   ALAALVLSGCAVGPDY-RPDPPAAVTLQGAQDPAYSAESPVGNWWSQFDDPVLEQLVRDA 67

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPSSYASIS-------------HRFIPNLKTN 115
           L  N  +  A  R+  A+   +  R D  P   A  S              RF   L   
Sbjct: 68  LFANHDLRIAVSRVKQARAVFVERRLDQAPHITAQSSFDRREQQQVVAGNQRF---LTEQ 124

Query: 116 STGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
           +T  LD+ W++DLFG QRR  E++ A+LD+  A +   ++ V +++  +Y + R  ++++
Sbjct: 125 TTLGLDAAWELDLFGRQRRASEAARADLDAEQANLQDVQVTVAAEVARNYFELRGTQKQL 184

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
            ++ + L       +L+  ++  GA S+L +    A +K+IE+DIP LE +     H ++
Sbjct: 185 EVSKRTLANLHDTQKLTQTRWDLGAGSELDVQSSLARLKAIEADIPLLETAQAQYRHRLA 244

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
            LLG         +  ++    P    P+ +G  A L+R RPD+R  E++LA + A++G+
Sbjct: 245 VLLGQQPDALDATLVART---MPAFARPLPLGDTAGLLRQRPDVRVAERRLAAATAQVGV 301

Query: 295 AKSDLYPSLSLNGSIALTHDNSF---PGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           A +DL+P +S++G +     ++     G    WS  P +    FD G +++ +R +++ A
Sbjct: 302 ATADLFPRISVSGFVGFLSGDAARLTEGNAKAWSITPSISWAAFDFGTVRARLRASKAQA 361

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           +     +Q+ VL A+++ ENAL      +  +  +       +++  L+ I YR+G    
Sbjct: 362 EGALAQYQQAVLLALEDTENALIGYGRQQARLAIVVEQANAARRAEQLAQIRYREGSEDF 421

Query: 412 LDILDIER 419
           L +LD +R
Sbjct: 422 LTLLDAQR 429


>gi|313500498|gb|ADR61864.1| TrpC_2 [Pseudomonas putida BIRD-1]
          Length = 484

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 125/458 (27%), Positives = 232/458 (50%), Gaps = 25/458 (5%)

Query: 17  GCTVGPEYTKP--HMP--LLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQN 72
           GCT+GP++ +P    P    P Q     S+       L+WWE+F+D  L+ L++   ++N
Sbjct: 18  GCTLGPDFQRPDSQAPQQWAPLQGEAAASQPQAEPLELRWWETFHDARLSALIQRVAERN 77

Query: 73  LTILQATERINAAKENILSVRADLFPS-------SYASISHRFI--PNLKTNS------T 117
           L +  A+ R+  ++    ++ AD  PS       S A  S   +  P+ K          
Sbjct: 78  LDLQMASARLLQSRALRSTLAADEVPSVDMNAGYSRARNSADGLSDPSGKAGKEAFNLWQ 137

Query: 118 GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISI 176
           G L + W++DL+G+ RR +E++ A ++ A        L ++S+   +YI  R  +  + +
Sbjct: 138 GDLVAGWELDLWGRVRRQVEAADATVEVAENDRRGVLLALLSETAGNYIQLRAVQHTLDV 197

Query: 177 AHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL 236
               L + + +++LS  +  +G  ++L + +  A++ SIE+ +P+LE + R ++ N  +L
Sbjct: 198 TQDNLRVARHSLKLSQDRQAEGVATRLDVAQASAQVASIEARLPSLE-ARRDDLINALSL 256

Query: 237 LGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
           L       L     QS    P       IG+P++L   RPDIR  E +L  + A IG+AK
Sbjct: 257 LAAEPPRSLQAELLQSGEL-PAPQQKFAIGLPSELAERRPDIRQAEARLHAATASIGVAK 315

Query: 297 SDLYPSLSLNGSIALT--HDNSFPGYNTH-WSFGPKLYLPIFDKGKIKSNIRRAESSAQE 353
           +D YPS+ L+GS+       + F G+++  ++FGP++ LPIF+ G++K  +   E+  QE
Sbjct: 316 ADFYPSIRLSGSVGFQALQLSDFGGWDSRRFAFGPQMSLPIFEGGRLKGTLELREAQQQE 375

Query: 354 QYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLD 413
             + +++ VL A  E+++ L   N  +     L  AV  ++ ++  +   Y +G    L+
Sbjct: 376 AALNYRKVVLGAWHEIDDVLRLYNASQLRRDHLAEAVRQNRIALETAQRQYVEGAVDFLN 435

Query: 414 ILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +L ++ A    E     +   ++++ V LY A+G G+ 
Sbjct: 436 VLTVQGALLASEEQWIDSSAAVSQALVGLYKALGGGWQ 473


>gi|313498627|gb|ADR59993.1| RND efflux system outer membrane lipoprotein [Pseudomonas putida
           BIRD-1]
          Length = 471

 Score =  185 bits (469), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 136/471 (28%), Positives = 233/471 (49%), Gaps = 26/471 (5%)

Query: 1   MNILRAIF-SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK----WWES 55
           MN+L+ +  SL  + LA C VGP+Y  P     P Q  +G+       D  +    WW+ 
Sbjct: 1   MNLLKPLTPSLLALALAACAVGPDYQAPATE--PAQ--LGSDVQAKAYDRSRFESLWWKQ 56

Query: 56  FNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFP--SSYAS--ISHRFIPN 111
           F+D  LN+LV+ +L  N  +  A  R+ +A+        D FP  +S AS  I    IP 
Sbjct: 57  FDDPVLNQLVQASLDGNRDLRVAFARLKSARSIREDAENDPFPVVTSRASSDIGKGQIPG 116

Query: 112 LKTNSTGQ------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSY 164
             T           LD  W++DLFG+ +R IE+S A    A A +   ++++I++L+ +Y
Sbjct: 117 QTTERVNSERYDLGLDMAWELDLFGRIQRQIEASEAQEAVAAADLQQLQVSLIAELVDAY 176

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
              R  + R  IA   L   +++  ++      G  + L +V+ +A +  +E+ +P L+ 
Sbjct: 177 GQLRGAQLREKIALANLKTQQESRTITETLRDAGVGNDLDVVRADARLAGVEATVPQLQA 236

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
                 H I+TLLG         +   S    P +   + +G P +L+R RPDIR  E++
Sbjct: 237 EQARARHRIATLLGQRPDALSVDL---SPKALPAIAKALPVGDPGELLRRRPDIRSAERQ 293

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIALTH-DNSFPGYNTH--WSFGPKLYLPIFDKGKIK 341
           LA + A +G+A +DL+P +SL+G +  T    S  G +    W+ GP +    FD G ++
Sbjct: 294 LAAATANVGVATADLFPRVSLSGFLGFTAARGSQIGSSAANAWALGPSITWAAFDLGSVR 353

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           + +R A++ A+     +++ VL A++E  NA +  ++ ++ +  L    +  +K+  L+ 
Sbjct: 354 ARLRGAKADAEGALANYEQQVLLALEESANAFSDYDKTQQRLLSLMRQSDASRKAAELAS 413

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           I YR+G    L +LD ER     E   +  +  L +  V +Y A+G G+ P
Sbjct: 414 IRYREGTVDYLVLLDAERERLSAEDAQAQGEVDLYRGIVSIYKALGGGWQP 464


>gi|26990140|ref|NP_745565.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Pseudomonas putida KT2440]
 gi|24985075|gb|AAN69029.1|AE016535_3 multidrug efflux RND outer membrane protein OprN [Pseudomonas
           putida KT2440]
          Length = 471

 Score =  185 bits (469), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 135/470 (28%), Positives = 234/470 (49%), Gaps = 24/470 (5%)

Query: 1   MNILRAIF-SLFIVLLAGCTVGPEYTKPHMPLLPTQFSI---GNSKNLINIDTLKWWESF 56
           MN+L+ +  SL  + LA C VGP+Y  P     P Q S      + +    ++L WW+ F
Sbjct: 1   MNLLKPLTPSLLALALAACAVGPDYQAPATE--PAQLSSDVQAKAYDRSRFESL-WWKQF 57

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFP--SSYAS--ISHRFIPNL 112
           +D  LN+LV+ +L  N  +  A  R+ +A+        D FP  +S AS  +    IP  
Sbjct: 58  DDPVLNQLVQASLDGNRDLRVAFARLKSARSIREDAENDPFPVVTSRASSDLGKGQIPGQ 117

Query: 113 KTNSTGQ------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
            T           LD  W++DLFG+ +R IE+S A    A A +   ++++I++L+ +Y 
Sbjct: 118 TTERVNSERYDLGLDMAWELDLFGRIQRQIEASEAQEAVAAADLQQLQVSLIAELVDAYG 177

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
             R  + R  IA   L   +++  ++      G  + L +V+ +A +  +E+ +P L+  
Sbjct: 178 QLRGAQLREKIALANLKTQQESRTITETLRDAGVGNDLDVVRADARLAGVEATVPQLQAE 237

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
                H I+TLLG         +   S    P +   + +G P +L+R RPDIR  E++L
Sbjct: 238 QARARHRIATLLGQRPDALSVDL---SPKALPAIAKALPVGDPGELLRRRPDIRSAERQL 294

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTH-DNSFPGYNTH--WSFGPKLYLPIFDKGKIKS 342
           A + A +G+A +DL+P +SL+G +  T    S  G +    W+ GP +    FD G +++
Sbjct: 295 AAATANVGVATADLFPRVSLSGFLGFTAARGSQIGSSAANAWALGPSITWAAFDLGSVRA 354

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            +R A++ A+     +++ VL A++E  NA +  ++ ++ +  L    +  +K+  L+ I
Sbjct: 355 RLRGAKADAEGALANYEQQVLLALEESANAFSDYDKTQQRLLSLMRQSDASRKAAELASI 414

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            YR+G    L +LD ER     E   +  +  L +  V +Y A+G G+ P
Sbjct: 415 RYREGTVDYLVLLDAERERLSAEDAQAQGEVDLYRGIVSIYKALGGGWQP 464


>gi|299769419|ref|YP_003731445.1| RND efflux system, outer membrane lipoprotein, NodT [Acinetobacter
           sp. DR1]
 gi|298699507|gb|ADI90072.1| RND efflux system, outer membrane lipoprotein, NodT [Acinetobacter
           sp. DR1]
          Length = 478

 Score =  185 bits (469), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 132/472 (27%), Positives = 236/472 (50%), Gaps = 30/472 (6%)

Query: 7   IFSLFIVLLAGCTVGPEYTKPHMPLLPTQF---SIGNSKNLINIDTLKWWESFNDTSLNK 63
           +  +   +LA CTVGP Y +P + L P Q+    + +  +    D   WW+SFND  L +
Sbjct: 8   LLPILTSILAACTVGPNYKRPSISL-PEQYLGARLNSPSDETKADIEVWWKSFNDPQLTR 66

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFP---------SSYASISHRF------ 108
            V +AL+QNL + QA  R+  A+ ++ +V A L P          +Y S+          
Sbjct: 67  YVTLALKQNLDLTQAYTRVTQAQASLSAVNASLRPIGSVDAQAAKAYQSVETPLGQVLNS 126

Query: 109 IPNLKTNST---GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSY 164
           IPN   + +     L + W++D+FG  RR  ES+LAN  ++ A     +L V ++    Y
Sbjct: 127 IPNFDRHGSSYEANLSATWELDIFGGLRRDRESALANYQASNAGASAVRLMVAAQTANLY 186

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           I+ R  + R+ IA Q L   +K + +  L +++G  S+  + + +A +  +++ +P L  
Sbjct: 187 INIRGLQSRLDIAQQQLQTQQKLLSIIQLLYSKGLASEFQVKQAKANVAQVQAVVPALGM 246

Query: 225 SFRMNVHNISTLLG-YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +  + ++ +  +LG  P T      + +     PN+      G P DL+R RPD+   E+
Sbjct: 247 NLDIAMNALDVMLGTVPGTHRAELAEVKPIPVIPNI---TETGTPRDLLRRRPDLIMAER 303

Query: 284 KLADSVAKIGIAKSDLYPSLSLNG---SIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKI 340
           +LA S A+IG A ++ YP +SL G   S A    N F       +    L   +FD G+I
Sbjct: 304 QLAASNARIGSAIAEYYPKVSLGGLIGSAATVSGNLFSSGANQAAGLLGLRWRLFDFGRI 363

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
            S IR A+    E+   +Q  VL+A ++VEN+L+++++ ++ +  LQ        +  ++
Sbjct: 364 NSEIRLAKGQEAEKLAAYQLAVLHAAEDVENSLSTLSKRQEQLVALQDGENALHLAQKIA 423

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           +I Y++G  S +++L  + +  +       A+   A + V +Y ++G G+ P
Sbjct: 424 LIAYQKGINSRIEVLQADSSALQFTDRKVQAQTDSALAAVAIYKSLGGGWQP 475


>gi|307726120|ref|YP_003909333.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. CCGE1003]
 gi|307586645|gb|ADN60042.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. CCGE1003]
          Length = 523

 Score =  184 bits (468), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 132/466 (28%), Positives = 228/466 (48%), Gaps = 26/466 (5%)

Query: 7   IFSLFIVLLAGCTVGPEYTKPHMPLLPTQF-SIGNSKNLINIDTLKWWESFNDTSLNKLV 65
           + S+   L A  +VGP++ +P + L      S+             WW++FND  L+ L 
Sbjct: 17  VVSMSAALAACISVGPDFAEPELTLEKQWLESLPPLAQAAPPAQAAWWKAFNDPVLSALE 76

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSSYA-SISHRFIPNLKTNSTGQL---- 120
           + A Q+NL++  A   I  A+  +     +L P + + S+    I    T+  G L    
Sbjct: 77  ERAYQRNLSLQVAGLHIFKARAQLAISAENLLPQTGSVSVGANHI---NTSGVGPLPPTH 133

Query: 121 --------DSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
                   ++ W++D +G+ RR IE+  A L  + A  D A +++ + +  +YID R  +
Sbjct: 134 LWAEHFHANAGWELDFWGKYRRQIEADRAQLRVSEAAYDNALVSMFADVANAYIDLRALE 193

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
           +RI +A Q L   + ++ L+  ++ +GA+S+L + +    +   E+ IP L K+   +  
Sbjct: 194 QRIVVAQQNLKSVQDSLALTQARYKRGASSQLDVEQAATLVAETEAQIPPLIKARAQDRD 253

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
            ++ LL  P        Q + ++  P     I++GIPADL+R RPD+R      A   A 
Sbjct: 254 TLAVLLADPPDAV--DAQLKGSSAIPVAPTQIDVGIPADLLRRRPDVREAALNAAAQSAL 311

Query: 292 IGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWS------FGPKLYLPIFDKGKIKSNIR 345
           IG AK+ LYPSLSL G   L+         + W       F   + LPIFD+G++K+ +R
Sbjct: 312 IGAAKAKLYPSLSLTGLFGLSSGEQHGIGLSQWGSKTIGLFSAGISLPIFDRGQLKNAVR 371

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
             ++S QE  + +Q TVL A KEVE+A+ ++      +     A +  ++++ L+   YR
Sbjct: 372 IQDASFQEAVLDYQNTVLQAQKEVEDAIAALRTSLDALAASVRASDASQRALRLANAQYR 431

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            G  +   +LD  R+  +    L+  +   A + V LY A+G G+ 
Sbjct: 432 SGSVTYDSVLDASRSALRDGDALAQNQGIAALAAVSLYRALGGGWE 477


>gi|26988008|ref|NP_743433.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Pseudomonas putida KT2440]
 gi|24982726|gb|AAN66897.1|AE016318_4 multidrug efflux MFS outer membrane protein, putative [Pseudomonas
           putida KT2440]
          Length = 484

 Score =  184 bits (468), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 125/458 (27%), Positives = 230/458 (50%), Gaps = 25/458 (5%)

Query: 17  GCTVGPEYTKP--HMP--LLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQN 72
           GCT+GP++ +P    P    P Q     S+       L+WWE+F+D  L+ L++   ++N
Sbjct: 18  GCTLGPDFQRPDSQAPQQWAPLQGEAAASQPQAEPLELRWWETFHDARLSALIQRVAERN 77

Query: 73  LTILQATERINAAKENILSVRADLFPS-------SYASISHRFI--PNLKTNS------T 117
           L +  A+ R+  ++    ++ AD  PS       S A  S   +  P+ K          
Sbjct: 78  LDLQMASARLLQSRALRSTLAADEVPSVDVNAGYSRARNSADGLSDPSGKAGKEAFNLWQ 137

Query: 118 GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISI 176
           G L + W++DL+G+ RR +E++ A ++ A        L ++S+   +YI  R  +  + +
Sbjct: 138 GDLVAGWELDLWGRVRRQVEAADATVEVAENDRRGVLLALLSETAGNYIQLRAVQHTLDV 197

Query: 177 AHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL 236
               L + + +++LS  +  +G  ++L + +  A++ SIES +P+LE   R ++ N  +L
Sbjct: 198 TQDNLRVARHSLKLSQDRQAEGVATRLDVAQASAQVASIESRLPSLEAQ-RDDLINALSL 256

Query: 237 LGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
           L       L     Q     P       IG+P++L   RPDIR  E +L  + A IG+AK
Sbjct: 257 LAAEPPRSLQAELLQGGEL-PAPQQKFAIGLPSELAERRPDIRQAEARLHAATASIGVAK 315

Query: 297 SDLYPSLSLNGSIALT--HDNSFPGYNTH-WSFGPKLYLPIFDKGKIKSNIRRAESSAQE 353
           +D YPS+ L+GS+       + F G+++  ++FGP++ LPIF+ G++K  +   E+  QE
Sbjct: 316 ADFYPSIRLSGSVGFQALQLSDFGGWDSRRFAFGPQMSLPIFEGGRLKGTLELREAQQQE 375

Query: 354 QYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLD 413
             + +++ VL A  E+++ L   N  +     L  AV  ++ ++  +   Y +G    L+
Sbjct: 376 AALNYRKVVLGAWHEIDDVLRLYNASQLRRDHLAEAVRQNRIALETAQRQYVEGAVDFLN 435

Query: 414 ILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +L ++ A    E     +   ++++ V LY A+G G+ 
Sbjct: 436 VLTVQGALLASEEQWIDSSAAVSQALVGLYKALGGGWQ 473


>gi|162149558|ref|YP_001604019.1| outer membrane protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|161788135|emb|CAP57739.1| putative outer membrane protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 558

 Score =  184 bits (468), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 128/505 (25%), Positives = 238/505 (47%), Gaps = 62/505 (12%)

Query: 5   RAIFSLFIVLLAGCTVGPEYTKP---HMPLLPTQFSIGN--------SKNLINID----- 48
           RA      VL  GC VGP++ KP     P    Q  +G+        S+  ++ D     
Sbjct: 34  RAAIVGLSVLATGCAVGPDFHKPVAWAPPHWAGQHWVGSAPGSTSGASRPPVSSDISDAA 93

Query: 49  -TLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH- 106
               WW+ F+D  L+ L +    QNL++  AT R+  ++  +    A+ +P   A+ S+ 
Sbjct: 94  PDPAWWDVFHDPELSALERRVAGQNLSVAIATARLAQSRSQLRIAGAERYPGLSAAGSYT 153

Query: 107 ----------RFIPNLK------------TNSTGQ------------LDSDWKIDLFGQ- 131
                     R + ++              + +GQ            +D+ W++DL+G+ 
Sbjct: 154 RSQYSTKELQRIVSDVGKSGNLPLGGVNLADQSGQFTIPLLDQWRDSIDATWEVDLWGRV 213

Query: 132 RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELS 191
           RR  E++ A+L ++  +        +++L   Y+  R  + ++ I     D   ++++LS
Sbjct: 214 RRQYEAAGADLQASVEERRGVLTAQMAELARDYVALREAQAQLRILLDNRDTASRSLDLS 273

Query: 192 HLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQ 251
             +   G  S+L +   ++++ S+ + IP +E+   + V+ +S LLG P +     +   
Sbjct: 274 RQRNQAGLVSELDVQSAQSQLDSVTARIPQMEQQIALQVNALSLLLGAPPSALAGELL-- 331

Query: 252 SNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIAL 311
           ++   P +   +  G+P++L R RPDIR  E +L  + A++G A ++ YP ++++     
Sbjct: 332 TDRDIPPVPPRVPAGVPSELARRRPDIRQAEAQLHAATAQVGEAVAEFYPRVTIDAGFGF 391

Query: 312 T----HDNSFPGYNTH-WSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAI 366
                 D  F  +N   W+ GP + LPIF  G+++  +    ++ QE  IT++ TVL A 
Sbjct: 392 QSLSFRDFGF--WNARAWNVGPSISLPIFQGGRLRGQLELRHAAEQEAAITYRRTVLGAW 449

Query: 367 KEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEV 426
            EV+NALT+  +++     L   V   ++S+ L+   YR G  + L +LD ER     + 
Sbjct: 450 HEVDNALTAYRDEQMRHDSLARQVADDQRSLDLARDQYRHGMVTFLTVLDAERRVLGSQT 509

Query: 427 DLSIAKRQLAKSYVDLYIAIGSGYN 451
           DL+ +   L+   V LY A+G G+ 
Sbjct: 510 DLTSSTASLSTDLVQLYSALGGGWE 534


>gi|329113779|ref|ZP_08242550.1| Antibiotic efflux pump outer membrane protein ArpC [Acetobacter
           pomorum DM001]
 gi|326696789|gb|EGE48459.1| Antibiotic efflux pump outer membrane protein ArpC [Acetobacter
           pomorum DM001]
          Length = 547

 Score =  184 bits (468), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 123/488 (25%), Positives = 237/488 (48%), Gaps = 52/488 (10%)

Query: 11  FIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKN---LINIDTLK-----WWESFNDTSLN 62
            + +LAGC VGP+Y KP     P+Q+    +K+   ++++ T +     WW  FND  L 
Sbjct: 50  LVFMLAGCMVGPDYKKPDT-WSPSQWQRAANKDTSQMLSVPTTQAPDPQWWAIFNDPELT 108

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHR-----------FIPN 111
            L K    QNL + QATE+   ++  +L   A+ FP   AS S+R            +  
Sbjct: 109 SLEKRLADQNLDVQQATEQFAVSRGQLLLAGAERFPDLAASGSYRRAQYSSKQLQRIVER 168

Query: 112 LKTNSTGQ------------------------LDSDWKIDLFGQ-RRHIESSLANLDSAY 146
           +  N+ G                         + + W++DL+G+ RR  E++ A +++  
Sbjct: 169 IGENAAGTGMGEMLSAQSSSISIPLLNQWQDGVQASWEVDLWGRVRRQYEAAKAYMNATM 228

Query: 147 AQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLV 206
            +     +   ++L   Y+  R+ +E++ I  +  D     ++LS  ++  G  S+L + 
Sbjct: 229 EERRGILIARQAELASDYMTLRNLQEQLRITKENRDAASAILQLSSSRYKSGLVSELDVD 288

Query: 207 KLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIG 266
              +E++   + IP  E+   M ++ I+ L+G P       +++ +      +   + +G
Sbjct: 289 SARSEVERTSALIPQFEQRIAMQINAINLLMGAPPGGLNTELEQTAGIP--PVPPQVPVG 346

Query: 267 IPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALT----HDNSFPGYNT 322
           +P++L   RPDIR   ++L  + A++G A++D YP ++++           D  F   + 
Sbjct: 347 LPSELAERRPDIREAGEELHAATAEVGQAEADFYPKVTIDAGFGFQSFSFRDMGF-WSSR 405

Query: 323 HWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKI 382
            W+ GP + LPIF  G++   +   ++S +   + +++TVLNA KEV+NALT+   ++K 
Sbjct: 406 MWNVGPAITLPIFQGGRLTGQLHIKKASQKAAALRYRKTVLNAWKEVDNALTAYQAEQKR 465

Query: 383 VTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDL 442
              +++ V    +S+ L+   Y+ G  S L +LD +R   + +  L+ +   ++ + V L
Sbjct: 466 NQNIRNQVAADARSLELAQSQYKHGLQSYLQVLDTQRRLLQSQTQLADSTATISGNLVQL 525

Query: 443 YIAIGSGY 450
           Y A+G G+
Sbjct: 526 YNALGGGW 533


>gi|209543964|ref|YP_002276193.1| NodT family RND efflux system, outer membrane lipoprotein
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209531641|gb|ACI51578.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 482

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 133/472 (28%), Positives = 229/472 (48%), Gaps = 32/472 (6%)

Query: 6   AIFSL-FIVLLAGCTVGPEYTKPHM---PLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
           A F+L   + LA CTVGP + +P +   P    +   G+      IDT +WW SF+D  L
Sbjct: 9   AAFALPLAIALASCTVGPAFHRPRIDAPPAWGAEPKAGSQTYAGAIDT-RWWRSFDDAEL 67

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSS-------YASISHRFIPNLKT 114
             LV    +QNL +  A +RI  A+  + +V A   P +       Y  +S   I +L  
Sbjct: 68  TGLVDRLGRQNLDLQIAAQRIREARAQMKAVAAAGLPQANWSGSYAYRQLSTHGIFSLAE 127

Query: 115 NSTGQ----------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPS 163
            S G           L + W +DLFG  RR +E+  A+  +A A    A L  +S L  S
Sbjct: 128 PSPGASLNFNLYSNVLSTSWDLDLFGAIRRGVEAQRADQAAALAARRAAALAAVSDLAAS 187

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  R  +    I    + L + N++L   +F  G  + L + +  A++ S+ES +P LE
Sbjct: 188 YMQLRGVQAPQVILQSNIALARTNLQLVRDRFANGVAANLDVSQAAAQLASMESGLPELE 247

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
            +    ++ I  LL  P       ++ ++   QP L + + +G+P DL R RPD+   E 
Sbjct: 248 NAEAALINAIGLLLSEPPRALEGELKNRAP--QPRLPVSVPVGLPLDLTRRRPDVLEAEA 305

Query: 284 KLADSVAKIGIAKSDLYPSLSLNG-----SIALTHDNSFPGYNTHWSFGPKLYLPIFDKG 338
           +L  + A++G A +  YP ++L G     S A +   S P     +S GP L +P+F  G
Sbjct: 306 RLHAATAEVGAAIAAFYPDITLAGNMGTESFAASDFFSLPA--KQFSVGPTLNVPVFQGG 363

Query: 339 KIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMS 398
           ++ + +   +++ QE  +TW+ TVLNA +E ++ALT+  + +      + A+   + + +
Sbjct: 364 RLIARLAFRKAAQQEAVLTWRNTVLNAWREADDALTAYAKSQSTHALTEQALLQDRAAYT 423

Query: 399 LSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            +   Y +G    L+++  + A    +  L+ ++ +   + V LY A+G G+
Sbjct: 424 AARQRYGEGATDYLNVVATQAALLSTQSALADSQTRSETTLVALYRALGGGW 475


>gi|114048311|ref|YP_738861.1| RND efflux system outer membrane lipoprotein [Shewanella sp. MR-7]
 gi|113889753|gb|ABI43804.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Shewanella sp. MR-7]
          Length = 517

 Score =  184 bits (467), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 133/467 (28%), Positives = 233/467 (49%), Gaps = 28/467 (5%)

Query: 3   ILRAIFSLFIVLLAGCTV-GPEYTKPHMPLLPTQ-------FSIGNSKNLINIDTLKWWE 54
           + R +      LL+GCTV GP+Y +P +P + T        FS   S +    D  +WW 
Sbjct: 7   VPRLVIGGACALLSGCTVLGPDYQQPEVPEIQTWQSASSQLFSAAPSAS----DYQQWWS 62

Query: 55  SFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKT 114
              D  L+ L+  AL +N  +  A  RI  A+   L +   L        + +++   +T
Sbjct: 63  QLQDPVLSSLIDEALLKNPDVRIAGLRILEAQAQ-LGIAESLRNPQLTQATAQWLGAGQT 121

Query: 115 ---NST------GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSY 164
              NST         +  W++D +G+ +R IES+ AN  +  AQ D  ++ +I+++   Y
Sbjct: 122 QSGNSTSGSSYGAAFNLGWELDFWGKFQRGIESADANYFATIAQYDDVQVLMIAQVAQLY 181

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           +  R  + R+ IAH    + K+++E++  +F  G T++L + + + +     S IPTLE 
Sbjct: 182 VTIRTLEARLQIAHDNAQIQKRSLEITQHQFHSGNTAELDVQQAKTQYLGTLSTIPTLET 241

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
           + R + + +STLL   A   L  M   +    P   + +   +PADL+R RPD+R  E++
Sbjct: 242 NLRQSQNALSTLLAR-APGPLPEMASNTGVL-PQGQLALVTEMPADLLRRRPDVRTAERQ 299

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNT-HWSFGPKLYLPIFDKGKIKSN 343
           LA    +IGIA+SDLYPS++L G++ L    S  G++   W  GP +   I D G++ + 
Sbjct: 300 LATQSGQIGIAESDLYPSITLAGTLGLNATGS--GHSIFSWGVGPSISWNILDSGRLTNQ 357

Query: 344 IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
           I   ++  ++ +  ++ETV  A +EV++A  +       +T L    E   +S+ ++   
Sbjct: 358 ILVQDARFEQLHEVYRETVFKAAREVDDAAIAFANSATEITLLTQTGEAASRSLEIANTQ 417

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           YR+G      +LD +RA    +  L  ++     + + LY A+G G+
Sbjct: 418 YREGMADFQRVLDSQRALFSQQERLVNSRGAHIGNLITLYKALGGGW 464


>gi|209544795|ref|YP_002277024.1| NodT family RND efflux system, outer membrane lipoprotein
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532472|gb|ACI52409.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 532

 Score =  184 bits (467), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 128/505 (25%), Positives = 238/505 (47%), Gaps = 62/505 (12%)

Query: 5   RAIFSLFIVLLAGCTVGPEYTKP---HMPLLPTQFSIGN--------SKNLINID----- 48
           RA      VL  GC VGP++ KP     P    Q  +G+        S+  ++ D     
Sbjct: 8   RAAIVGLSVLATGCAVGPDFHKPVAWAPPHWAGQHWVGSAPGSTSGASRPPVSSDISDAA 67

Query: 49  -TLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH- 106
               WW+ F+D  L+ L +    QNL++  AT R+  ++  +    A+ +P   A+ S+ 
Sbjct: 68  PDPAWWDVFHDPELSALERRVAGQNLSVAIATARLAQSRSQLRIAGAERYPGLSAAGSYT 127

Query: 107 ----------RFIPNLK------------TNSTGQ------------LDSDWKIDLFGQ- 131
                     R + ++              + +GQ            +D+ W++DL+G+ 
Sbjct: 128 RSQYSTKELQRIVSDVGKSGNLPLGGVNLADQSGQFTIPLLDQWRDSIDATWEVDLWGRV 187

Query: 132 RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELS 191
           RR  E++ A+L ++  +        +++L   Y+  R  + ++ I     D   ++++LS
Sbjct: 188 RRQYEAAGADLQASVEERRGVLTAQMAELARDYVALREAQAQLRILLDNRDTASRSLDLS 247

Query: 192 HLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQ 251
             +   G  S+L +   ++++ S+ + IP +E+   + V+ +S LLG P +     +   
Sbjct: 248 RQRNQAGLVSELDVQSAQSQLDSVTARIPQMEQQIALQVNALSLLLGAPPSALAGELL-- 305

Query: 252 SNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIAL 311
           ++   P +   +  G+P++L R RPDIR  E +L  + A++G A ++ YP ++++     
Sbjct: 306 TDRDIPPVPPRVPAGVPSELARRRPDIRQAEAQLHAATAQVGEAVAEFYPRVTIDAGFGF 365

Query: 312 T----HDNSFPGYNTH-WSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAI 366
                 D  F  +N   W+ GP + LPIF  G+++  +    ++ QE  IT++ TVL A 
Sbjct: 366 QSLSFRDFGF--WNARAWNVGPSISLPIFQGGRLRGQLELRHAAEQEAAITYRRTVLGAW 423

Query: 367 KEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEV 426
            EV+NALT+  +++     L   V   ++S+ L+   YR G  + L +LD ER     + 
Sbjct: 424 HEVDNALTAYRDEQMRHDSLARQVADDQRSLDLARDQYRHGMVTFLTVLDAERRVLGSQT 483

Query: 427 DLSIAKRQLAKSYVDLYIAIGSGYN 451
           DL+ +   L+   V LY A+G G+ 
Sbjct: 484 DLTSSTASLSTDLVQLYSALGGGWE 508


>gi|322832624|ref|YP_004212651.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rahnella sp. Y9602]
 gi|321167825|gb|ADW73524.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rahnella sp. Y9602]
          Length = 483

 Score =  184 bits (466), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 131/467 (28%), Positives = 219/467 (46%), Gaps = 30/467 (6%)

Query: 13  VLLAGCTVGPEYTKPHMPL---LPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIAL 69
            LLAGC VGP+Y +P  PL      Q ++             WW+ F D  L++ V  AL
Sbjct: 14  ALLAGCAVGPDYHRPDAPLPERYQAQSAVQQRSASRPASFAVWWDGFGDPLLSQYVTDAL 73

Query: 70  QQNLTILQATERINAAKE-------------NILSVRADLFPSSYASISHRFIPNLKTNS 116
            QNL + QAT R+  ++              N+    A  + S+   +          N 
Sbjct: 74  AQNLDLAQATARMAQSRAGLGAATAALLPSGNVSGQAARAYQSAETPLGQVLSATPDYNR 133

Query: 117 TG-----QLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
            G      L++ W+ID+FG  RR  +++LA+  ++ A V   +L V ++   +YI  R  
Sbjct: 134 YGNSYETDLNASWEIDVFGGLRRGRQAALADYQASEAGVAATRLAVAAQTADTYITLRGL 193

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           + R+SIA + +   ++ +E   L   +G      + + E E+  +++ +P L       +
Sbjct: 194 QTRLSIAEKQVSTQQELLEKVQLLNAKGLAPAYQVRQTEGELAQVQATVPVLRTGLDAAM 253

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  +LG P     H  Q       P      + G PADL+R RPDI   E+ LA S A
Sbjct: 254 NALDVMLGTP--PGTHRSQLALPGAIPQAPQITSTGTPADLLRRRPDIIVAERHLAASSA 311

Query: 291 KIGIAKSDLYPSLSLNG----SIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           +IG+A S+ YP  SL+     + A++ DN F G  +  +    L   +FD G+I + I +
Sbjct: 312 RIGVAISEYYPKFSLSALLGSATAMSGDNLFSGGASQSAAVLGLRWRLFDFGRINAQIDQ 371

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTS-INEDKKIVTKLQHAVELHKKSMSLSMINYR 405
           A+    E    ++ +VL A ++VENA ++ +N + +  T  +    L     S S I YR
Sbjct: 372 AKGQEAEALAAYRLSVLRATEDVENAFSALVNRETQAATLTRGETALASARQS-SFIAYR 430

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           QG  SL+D+L  +    +     + A+ + A++ V  + A+G G+ P
Sbjct: 431 QGTASLMDVLHNDENLLQASDARAQAQTESARAAVATFRALGGGWQP 477


>gi|331016496|gb|EGH96552.1| outer membrane efflux protein [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 465

 Score =  184 bits (466), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 131/449 (29%), Positives = 233/449 (51%), Gaps = 24/449 (5%)

Query: 21  GPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATE 80
           GP+Y  P         +   + +   ++TL WW+ F D +LNKLV  +L  N  +  A  
Sbjct: 22  GPDYKAPVTATATLASAAKGNYDRSKVNTL-WWQQFEDPTLNKLVAQSLDGNRDLRVAFA 80

Query: 81  RINAAKENILSVRADLFP--SSYAS----------ISHRFIPNLKTNSTGQLDSDWKIDL 128
           R+ AA+     V  D+ P  +S AS          I+ R + N +    G LD  W++DL
Sbjct: 81  RLKAARAIRDDVANDVMPVVTSRASSDIGKGQQPGITERRV-NSERYDLG-LDMAWELDL 138

Query: 129 FGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKN 187
           FG+ +R +E+S A+ ++A A +   ++ +I++++ +Y   R  + R +IA   L   +K+
Sbjct: 139 FGRIQRQLEASDADQEAAEANLYQLQVTLIAEVVDAYGQLRGAQLREAIARDNLTNQQKS 198

Query: 188 IELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG-YPATEFLH 246
             ++      G  ++L +V+ +A + ++E+ +P L+       + I+TLLG  P T  + 
Sbjct: 199 QGITTQLRDAGVGNELDVVRADARLAAVEATVPQLQAEQARQRNRIATLLGERPDTLSVD 258

Query: 247 YMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLN 306
                S +  P +   + IG    ++RNRPDIR  E++LA S A+IG+A +DL+P +SL+
Sbjct: 259 L----SPSKLPAIAKALPIGDATQVLRNRPDIRAAERQLAASTARIGVATADLFPRVSLS 314

Query: 307 GSIALTHD-NSFPGYNTH--WSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVL 363
           G +  T    S  G +    WS GP +    FD G +++ IR A++ A+     +++ VL
Sbjct: 315 GFLGYTAGRGSQIGSSAARAWSLGPSITWAAFDLGSVRAQIRSADADAEGALANYEQQVL 374

Query: 364 NAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAK 423
            A++E ENA +  ++ ++ +  L    +  + +  L+ + YR+G    L +LD ER    
Sbjct: 375 LALEESENAFSDYDKRQQRLVALMRQSDASRSAARLASVQYREGTADFLVLLDAERERLA 434

Query: 424 VEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            E   + A+ +L +  V +Y A+G G+ P
Sbjct: 435 AEDSQAQAEIELYRGIVAIYKALGGGWQP 463


>gi|323529603|ref|YP_004231755.1| NodT family RND efflux system, outer membrane lipoprotein
           [Burkholderia sp. CCGE1001]
 gi|323386605|gb|ADX58695.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. CCGE1001]
          Length = 523

 Score =  184 bits (466), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 132/458 (28%), Positives = 226/458 (49%), Gaps = 27/458 (5%)

Query: 15  LAGC-TVGPEYTKPHMPLLPTQF-SIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQN 72
           LAGC +VGP++ +P   L    F S+  +          WW++FND  L  L + A Q+N
Sbjct: 24  LAGCASVGPDFKEPETTLEKQWFESLPPAAQAAPAAEAAWWKAFNDPVLTALEERAYQRN 83

Query: 73  LTILQATERINAAKENILSVRADLFPSSYA-SISHRFIPNLKTNSTGQL----------- 120
           L++  A   I  A+  + S   +L P + + S+    I    T+  G L           
Sbjct: 84  LSLQVAGLHIFKARAQLASGVENLLPQTGSVSVGANHI---NTSGVGPLPPTHLWAEHFH 140

Query: 121 -DSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAH 178
            ++ W++D +G+ RR IES  A L  + A  D A +++ + +  +YID R  ++RI +A 
Sbjct: 141 ANAGWELDFWGKYRRQIESDRAQLRVSEAAYDNALVSMFADVANAYIDLRALEQRIVVAQ 200

Query: 179 QILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG 238
           Q L   + ++ L+  ++T+GA+S+L + +    +   E+ IP L K+   +   ++ LL 
Sbjct: 201 QNLKSVQDSLALTKARYTRGASSQLDVEQAATLVAETEAQIPPLIKARAQDRDTLAVLLA 260

Query: 239 YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSD 298
            P        Q + ++  P     I++GIPADL+R RPD+R      A   A IG AK+ 
Sbjct: 261 DPPDAV--DAQLKGSSAVPVAPTQIDVGIPADLLRRRPDVRQAALNAAAQSALIGAAKAK 318

Query: 299 LYPSLSLNGSIALTHDNSFPGYNTHWS------FGPKLYLPIFDKGKIKSNIRRAESSAQ 352
           LYPS SL G   L+         + W           + LPIFD+ ++++ +R  +++ Q
Sbjct: 319 LYPSFSLTGLFGLSSGEQHGIGLSQWGSKTIGLLSAGVSLPIFDRAQLQNAVRIQDAAFQ 378

Query: 353 EQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLL 412
           E  + +Q TVL A KEVE+A+ ++      +     A +  ++++ L+   YR G  +  
Sbjct: 379 EAVLDYQNTVLQAQKEVEDAIAALRTSLDALAASARASDASQRALRLANAQYRSGSVTYD 438

Query: 413 DILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            +LD  R+  +    L+  +   A + V LY A+G G+
Sbjct: 439 SVLDASRSALRDGDSLAQNQGIAALAAVSLYRALGGGW 476


>gi|152984148|ref|YP_001347688.1| outer membrane protein [Pseudomonas aeruginosa PA7]
 gi|150959306|gb|ABR81331.1| probable outer membrane protein [Pseudomonas aeruginosa PA7]
          Length = 479

 Score =  184 bits (466), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 116/460 (25%), Positives = 233/460 (50%), Gaps = 25/460 (5%)

Query: 15  LAGCTVGPEYTKP--HMPLLPTQFSIGNSKNLINIDTL--KWWESFNDTSLNKLVKIALQ 70
           L  C++GP++T+P    P    Q +  ++ + +    L  +WW  F D  L+ L++   +
Sbjct: 14  LGACSLGPDFTRPAQDAPAAWPQPTAHDTPSRLAAAPLAAQWWTLFGDARLSALLERVQR 73

Query: 71  QNLTILQATERINAAKENILSVRADLFPSSYASISHR---------FIPNLKTN------ 115
            NL +  A  R+  ++    S+  D  PS  AS +++         F P+ K        
Sbjct: 74  TNLDLRSAAARLQQSRAIRHSLGGDALPSVDASGTYQRQRTTSAGLFDPSGKAGKGNYNH 133

Query: 116 STGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
           +    D+ W++D +G+ RR +E++ A ++++  ++   +++V+++    YI  R  + R 
Sbjct: 134 ALAGFDASWELDFWGRVRRELEAADATVEASENELRDVQVSVLAEAARDYIQLRGEQNRE 193

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
            I    L+  ++++EL+  +   G  + L + +  A++ S+E+ +P LEK     ++ + 
Sbjct: 194 RIVRDNLETARRSLELTRTRLANGVATDLEVAQALAQVASMEARLPELEKRQAHLLNALG 253

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
            L+G      L  +       +P   +P+  G+P++L + RPDIR  E +L  + A IG+
Sbjct: 254 YLVGASPGSLLAELGPAREIPRPPGSVPV--GLPSELAQRRPDIRIAEARLHAATASIGV 311

Query: 295 AKSDLYPSLSLNGSIALT--HDNSFPGYN-THWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           AK+D YP ++LNG+        +S   ++   ++ GP   LPIF+ G+++  +   E+  
Sbjct: 312 AKADFYPRITLNGNFGFESLQLSSLGDWDHRQFAIGPAFSLPIFEGGRLRGRLELREAQQ 371

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           QE  I +Q TVL A +EV++A+     +++   +L  AV  +++++  +   YR G    
Sbjct: 372 QEAAIDYQRTVLRAWQEVDDAMHDYAANQRRQERLGEAVMQNRRALESAREQYRAGAVDF 431

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           L +LD +R     +     +   ++ + V+LY A+G G++
Sbjct: 432 LSVLDSQRQLLDNQEQQVGSVEAVSLTLVNLYKALGGGWS 471


>gi|146311525|ref|YP_001176599.1| RND efflux system outer membrane lipoprotein [Enterobacter sp. 638]
 gi|145318401|gb|ABP60548.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Enterobacter sp. 638]
          Length = 485

 Score =  184 bits (466), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 129/465 (27%), Positives = 224/465 (48%), Gaps = 28/465 (6%)

Query: 14  LLAGCTVGPEYTKPHMPLLP---TQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQ 70
           LLAGC VGP+Y +P  PL      Q ++             WW+ F D  L++ V  AL 
Sbjct: 15  LLAGCAVGPDYQRPDAPLAERYQAQSAVQQRTASRPARFAVWWDGFGDPLLSQFVMDALA 74

Query: 71  QNLTILQATERINAAKENILSVRADLFPSS----YASISHRFI-----------PNLK-- 113
           QNL + QAT R+  ++  + +  A L PS      A+ +H+ +           P+    
Sbjct: 75  QNLDLAQATARMAQSRAGLGNATAALLPSGNISGQAARAHQSVETPLGQVLSSTPDYSRY 134

Query: 114 TNS-TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
            NS    L++ W+ID+FG  RR  +++LA+  ++ A V   +L V ++    YI  R  +
Sbjct: 135 GNSYETDLNATWEIDVFGGLRRGRQAALADYQASEAGVVATRLAVAAQTADIYITLRGLQ 194

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
            R++IA + +   +  +E   L   +G   +  + + E E+  +++ +P L       ++
Sbjct: 195 ARLAIAEKKVRTQQALLEKVQLLHRKGLAPEYQVRQTEGELAQVQAIVPALRTGLDAAMN 254

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
            +  +LG P     H  Q  S    P      + G PADL+R RPDI   E+ LA S A+
Sbjct: 255 ALDVMLGTPPGT--HRAQLDSPGVIPQAPQITSTGTPADLLRRRPDIIVAERHLAASSAR 312

Query: 292 IGIAKSDLYPSLSLNG----SIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
           IG+A S+ YP+ SL+     + A++ +N F G  +  +    L   +FD G+I + I +A
Sbjct: 313 IGVAVSEYYPTFSLSALLGSATAISSNNLFSGSASQSAGVLGLRWRLFDFGRINAEIDQA 372

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
                E    ++ +VL+A ++VENA +++   +   T L +       +   S + ++QG
Sbjct: 373 NGQEAEALAAYRLSVLHATEDVENAFSALVNSESQATTLTNGESALASARQSSFVAFQQG 432

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
             SL+D+L  +    +     + A+   A++ V  + A+G G+ P
Sbjct: 433 TASLIDVLRNDETLLQASDARAQAQTDSARAAVATFRALGGGWQP 477


>gi|330875376|gb|EGH09525.1| outer membrane efflux protein [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 465

 Score =  184 bits (466), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 134/450 (29%), Positives = 235/450 (52%), Gaps = 26/450 (5%)

Query: 21  GPEYTKP-HMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQAT 79
           GP+Y  P   P      + GN  +   ++TL WW+ F D +LNKLV  +L  N  +  A 
Sbjct: 22  GPDYKAPVTAPATLASAAKGN-YDRSKVNTL-WWQQFEDPTLNKLVAHSLDGNRDLRVAF 79

Query: 80  ERINAAKENILSVRADLFP--SSYAS----------ISHRFIPNLKTNSTGQLDSDWKID 127
            R+ AA+     V  D+ P  +S AS          I+ R + N +    G LD  W++D
Sbjct: 80  ARLKAARAIRDDVANDVMPVVTSRASSDLGKGQQPGITERRV-NSERYDLG-LDMAWELD 137

Query: 128 LFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKK 186
           LFG+ +R +E+S A+ ++A A +   ++ +I++++ +Y   R  + R +IA   L   +K
Sbjct: 138 LFGRIQRQLEASNADQEAAEANLYQLQVTLIAEVVDAYGQLRGAQLREAIARDNLTNQQK 197

Query: 187 NIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG-YPATEFL 245
           +  ++      G  ++L +V+ +A + ++E+ +P L+       + I+TLLG  P T  +
Sbjct: 198 SQGITTQLRDAGVGNELDVVRADARLAAVEATVPQLQAEQARQRNRIATLLGERPDTLSV 257

Query: 246 HYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSL 305
                 S +  P +   + IG    ++RNRPDIR  E++LA S A+IG+A +DL+P +SL
Sbjct: 258 DL----SPSKLPAIVKALPIGDATQVLRNRPDIRAAERQLAASTARIGVATADLFPRVSL 313

Query: 306 NGSIALTHD-NSFPGYNTH--WSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETV 362
           +G +  T    S  G +    WS GP +    FD G +++ IR A++ A+     +++ V
Sbjct: 314 SGFLGYTAGRGSQIGSSAARAWSLGPSITWAAFDLGSVRAQIRSADADAEGALANYEQQV 373

Query: 363 LNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATA 422
           L A++E ENA +  ++ ++ +  L    +  + +  L+ + YR+G    L +LD ER   
Sbjct: 374 LLALEESENAFSDYDKRQQRLVALMRQSDASRSAARLASVQYREGTADFLVLLDAERERL 433

Query: 423 KVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
             E   + A+ +L +  V +Y A+G G+ P
Sbjct: 434 AAEDSQAQAQIELYRGIVAIYKALGGGWQP 463


>gi|152984713|ref|YP_001348103.1| outer membrane protein OprN precursor [Pseudomonas aeruginosa PA7]
 gi|150959871|gb|ABR81896.1| outer membrane protein OprN precursor [Pseudomonas aeruginosa PA7]
          Length = 472

 Score =  184 bits (466), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 134/461 (29%), Positives = 233/461 (50%), Gaps = 20/461 (4%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
            +FSL    L+ CTVGP+Y  P         +     +    ++L WW+ F+D +LN+LV
Sbjct: 16  GLFSLLA--LSACTVGPDYRTPDTAAAKIDATASEPYDRSRFESL-WWKQFDDPTLNQLV 72

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFP----SSYASISHRFIPNLKTNSTGQ-- 119
           + +L  N  +  A  R+ AA+     V  D FP     + A I     P +  +      
Sbjct: 73  EQSLTGNRDLRVAFARLRAARALRDDVANDRFPVVTSRASADIGKGQQPGVTEDRVNSER 132

Query: 120 ----LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
               LD+ W++DLFG+ RR +ESS A  ++A A +   ++++I++L+ +Y   R  + R 
Sbjct: 133 YDLGLDTAWELDLFGRIRRQLESSDALSEAAEADLQQLQVSLIAELVDAYGQLRGAQLRE 192

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
            IA   L+  K++ +L+      G  ++L +++ +A + +  + +P L+     + H I+
Sbjct: 193 KIALSNLENQKESRQLTEQLRDAGVGAELDVLRADARLAATAASVPQLQAQAERSRHRIA 252

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
           TLLG    E    +   S    P +   + IG P +L+R RPDIR  E++LA S A++G+
Sbjct: 253 TLLGQRPEELTVDL---SPRDLPAISKALPIGDPGELLRRRPDIRAAERRLASSTAEVGV 309

Query: 295 AKSDLYPSLSLNGSIALTHD-NSFPGYNTH--WSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           A +DL+P +SL+G +  T    S  G N    WS GP +    FD G +++ +R A + A
Sbjct: 310 ATADLFPRVSLSGFLGFTAGRGSQIGSNAARAWSVGPSISWAAFDLGSVRARLRGARADA 369

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
                ++++ VL A++E  NA +   + ++ +  L    E  + +   + I YR+G    
Sbjct: 370 DAALASYEQQVLLALEESANAFSDYGKRQERLVSLVRQSEASRAAAQQAAIRYREGTTDF 429

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           L +LD ER     E   + A+ +L +  V +Y ++G G+ P
Sbjct: 430 LVLLDAEREQLSAEDAQAQAEVELYRGIVAIYRSLGGGWQP 470


>gi|148547556|ref|YP_001267658.1| RND efflux system outer membrane lipoprotein [Pseudomonas putida
           F1]
 gi|148511614|gb|ABQ78474.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Pseudomonas putida F1]
          Length = 471

 Score =  184 bits (466), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 135/471 (28%), Positives = 233/471 (49%), Gaps = 26/471 (5%)

Query: 1   MNILRAIF-SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK----WWES 55
           MN+L+ +  SL  + LA C VGP+Y  P     P Q  +G+       D  +    WW+ 
Sbjct: 1   MNLLKPLTPSLLALALAACAVGPDYQAPATE--PAQ--LGSDVQAKAYDRSRFESLWWKQ 56

Query: 56  FNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFP--SSYAS--ISHRFIPN 111
           F+D  LN+LV+ +L  N  +  A  R+ +A+        D FP  +S AS  +    IP 
Sbjct: 57  FDDPVLNQLVQASLDGNRDLRVAFARLKSARSIREDAENDPFPVVTSRASSDLGKGQIPG 116

Query: 112 LKTNSTGQ------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSY 164
             T           LD  W++DLFG+ +R IE+S A    A A +   ++++I++L+ +Y
Sbjct: 117 QTTERVNSERYDLGLDMAWELDLFGRIQRQIEASEAQEAVAAADLQQLQVSLIAELVDAY 176

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
              R  + R  IA   L   +++  ++      G  + L +V+ +A +  +E+ +P L+ 
Sbjct: 177 GQLRGAQLREKIALANLKTQQESRTITETLRDAGVGNDLDVVRADARLAGVEATVPQLQA 236

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
                 H I+TLLG         +   S    P +   + +G P +L+R RPDIR  E++
Sbjct: 237 EQARARHRIATLLGQRPDALSVDL---SPKALPAIAKALPVGDPGELLRRRPDIRSAERQ 293

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIALTH-DNSFPGYNTH--WSFGPKLYLPIFDKGKIK 341
           LA + A +G+A +DL+P +SL+G +  T    S  G +    W+ GP +    FD G ++
Sbjct: 294 LAAATANVGVATADLFPRVSLSGFLGFTAARGSQIGSSAANAWALGPSITWAAFDLGSVR 353

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           + +R A++ A+     +++ VL A++E  NA +  ++ ++ +  L    +  +K+  L+ 
Sbjct: 354 ARLRGAKADAEGALANYEQQVLLALEESANAFSDYDKTQQRLLSLMRQSDASRKAAELAS 413

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           I YR+G    L +LD ER     E   +  +  L +  V +Y A+G G+ P
Sbjct: 414 IRYREGTVDYLVLLDAERERLSAEDAQAQGEVDLYRGIVSIYKALGGGWQP 464


>gi|114328120|ref|YP_745277.1| type I secretion outer membrane protein [Granulibacter bethesdensis
           CGDNIH1]
 gi|114316294|gb|ABI62354.1| type I secretion outer membrane protein [Granulibacter bethesdensis
           CGDNIH1]
          Length = 521

 Score =  184 bits (466), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 128/485 (26%), Positives = 230/485 (47%), Gaps = 46/485 (9%)

Query: 9   SLFIVLLAGCTVGPEYTKPHM-----PLLPTQFSIGN----SKNLINIDTLKWWESFNDT 59
           +L ++ LAGC +GP +  P       P  P           S  +       WW SF D 
Sbjct: 18  TLIVLALAGCKIGPTFVPPRQDEAAKPWAPRAGHFEAQPIASHVVPEPTEASWWSSFTDP 77

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS--- 116
            L  L +     NL +  AT R+  ++  +   RA LFPS   + S++ +  +   S   
Sbjct: 78  VLTSLEQRVAANNLDVQTATVRLAESRAQLGGTRAALFPSLNGAASYQRLKPVSDRSLQV 137

Query: 117 -------------TGQ-------------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQV 149
                        +GQ             +D+ W+IDL+G+ RRHIE+  A +       
Sbjct: 138 GLGKAGLNGLLAESGQKIEVPPIDYFRYGIDASWEIDLWGRVRRHIEAGEAQIQQNQEAR 197

Query: 150 DIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLE 209
               ++ ++++   Y+  R+ +  I I  +  ++ ++N+ L+  + T G  S L +    
Sbjct: 198 RATLVSAMAEVALDYMRLRNVQADIDIVRRNAEVARQNLNLARQRQTGGLGSDLDVQNAR 257

Query: 210 AEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPA 269
           A++   ES +P LE      ++ +S LLG         +          +   + +G+P+
Sbjct: 258 AQLALTESALPALETQQTALINALSLLLGQAPQALSGELIVPRPVPP--VPPRVPVGLPS 315

Query: 270 DLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSI---ALTH-DNSFPGYNTHWS 325
           DL+R RPD+R  E  L ++ A IG+A++   P + +N ++   ALT  D    G NT+  
Sbjct: 316 DLVRRRPDVRQAEATLHEATANIGVAEASFLPRVIINANLMMSALTFADMGNWGSNTY-G 374

Query: 326 FGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTK 385
            GP + LPIF+ G++K+N+  A    +E  I +++TVL A  +V NA+ +  ++++    
Sbjct: 375 IGPMITLPIFEGGRLKANLDMATQQQKEAAIAYRKTVLQAFHDVSNAMAAYEDEQRRNEA 434

Query: 386 LQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIA 445
           L+ +V+  ++++ L+   YR G  + LD+L+ ER     E DL+ +   ++ + V LY A
Sbjct: 435 LRQSVDADRRAVGLAQNAYRNGLVTFLDVLNAERQLLAAERDLADSDAAISTNLVQLYKA 494

Query: 446 IGSGY 450
           +G G+
Sbjct: 495 LGGGW 499


>gi|317484498|ref|ZP_07943407.1| NodT family efflux transporter [Bilophila wadsworthia 3_1_6]
 gi|316924216|gb|EFV45393.1| NodT family efflux transporter [Bilophila wadsworthia 3_1_6]
          Length = 458

 Score =  183 bits (465), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 121/461 (26%), Positives = 226/461 (49%), Gaps = 25/461 (5%)

Query: 7   IFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVK 66
           +  L ++ LAGC+  P+Y +P M L       G  + L      +WW+ F+D++LN LV+
Sbjct: 5   VVGLMMLGLAGCSFAPDYQRPQMELPQAWKDPGKGEQLDE----QWWKRFDDSTLNALVQ 60

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFP--SSYASISHRFIPNLKTNSTGQ----- 119
            AL  N  I  A  R++ A+  +   RA+L P  S  A  +  ++ N K  +  Q     
Sbjct: 61  EALIANRDIAAAVARVDYARAQLGVARAELLPLLSGQAQGTQTWVDNTKITNGSQSPFSA 120

Query: 120 -LDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIA 177
              + W++DL+G+ R+  E+++  +    A     +L++ ++   +Y   R    ++S A
Sbjct: 121 GFGATWELDLWGKLRNAKEAAMYQVLGTEAAQRGMRLSIAAQTSNAYFLLRSLDLQLSTA 180

Query: 178 HQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLL 237
            + +      + +   ++ QG  S+L L + + E+++ ++ +     S       +  LL
Sbjct: 181 ERTVKTRTDALRIYTARYEQGLISELDLSRAKTEVETAKTALYQTRISRDAAESALEALL 240

Query: 238 GYPATEFLHYMQKQSNNFQPNLYIP-INIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
           G    + +    ++    +     P I  G+P+DL+  RPDI+  E  +  + A IG+AK
Sbjct: 241 GRSPKDIMDGTVQRGMTLESIPTPPVIPAGVPSDLLERRPDIQQAEMSVKSANANIGVAK 300

Query: 297 SDLYPSLSLNGSIALTHDNSFPGYNT-------HWSFGPKLYLPIFDKGKIKSNIRRAES 349
           +  +P++SL G   +      P  +T        WS+G    +P+ D G++K  +  AE+
Sbjct: 301 AAWFPAISLTGLFGVVS----PELHTLMSNPLQTWSYGGAASVPLLDFGRVKYGVEAAEA 356

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             +E   T+++TV  A KE+ +ALT   E   +V  L+  V+  + S+ L+   Y  G  
Sbjct: 357 KQRESLATYEKTVQGAFKEMRDALTRQQEMSNVVASLERMVKELRLSVELANTRYDNGYS 416

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S L++LD ER+    E+ L+ A+ +   S V++ +A+G G+
Sbjct: 417 SYLEVLDAERSLFDSEMQLAAARSERLSSIVNVCLALGGGW 457


>gi|28870274|ref|NP_792893.1| outer membrane efflux protein [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|301381179|ref|ZP_07229597.1| outer membrane efflux protein [Pseudomonas syringae pv. tomato
           Max13]
 gi|302058554|ref|ZP_07250095.1| outer membrane efflux protein [Pseudomonas syringae pv. tomato K40]
 gi|302132592|ref|ZP_07258582.1| outer membrane efflux protein [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|28853521|gb|AAO56588.1| outer membrane efflux protein [Pseudomonas syringae pv. tomato str.
           DC3000]
          Length = 465

 Score =  183 bits (465), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 134/450 (29%), Positives = 235/450 (52%), Gaps = 26/450 (5%)

Query: 21  GPEYTKP-HMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQAT 79
           GP+Y  P   P      + GN  +   ++TL WW+ F D +LNKLV  +L  N  +  A 
Sbjct: 22  GPDYKAPVTAPATLASAAKGN-YDRSKVNTL-WWQQFEDPTLNKLVAQSLDGNRDLRVAF 79

Query: 80  ERINAAKENILSVRADLFP--SSYAS----------ISHRFIPNLKTNSTGQLDSDWKID 127
            R+ AA+     V  D+ P  +S AS          I+ R + N +    G LD  W++D
Sbjct: 80  ARLKAARAIRDDVANDVMPVVTSRASSDIGKGQQPGITERRV-NSERYDLG-LDMAWELD 137

Query: 128 LFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKK 186
           LFG+ +R +E+S A+ ++A A +   ++ +I++++ +Y   R  + R +IA   L   +K
Sbjct: 138 LFGRIQRQLEASDADQEAAEANLYQLQVTLIAEVVDAYGQLRGAQLREAIARDNLTNQQK 197

Query: 187 NIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG-YPATEFL 245
           +  ++      G  ++L +V+ +A + ++E+ +P L+       + I+TLLG  P T  +
Sbjct: 198 SQGITTQLRDAGVGNELDVVRADARLAAVEATVPQLQAEQARQRNRIATLLGERPDTLSV 257

Query: 246 HYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSL 305
                 S +  P +   + IG    ++RNRPDIR  E++LA S A+IG+A +DL+P +SL
Sbjct: 258 DL----SPSKLPAIAKALPIGDATQVLRNRPDIRAAERQLAASTARIGVATADLFPRVSL 313

Query: 306 NGSIALTHD-NSFPGYNTH--WSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETV 362
           +G +  T    S  G +    WS GP +    FD G +++ IR A++ A+     +++ V
Sbjct: 314 SGFLGYTAGRGSQIGSSAARAWSLGPSITWAAFDLGSVRAQIRSADADAEGALANYEQQV 373

Query: 363 LNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATA 422
           L A++E ENA +  ++ ++ +  L    +  + +  L+ + YR+G    L +LD ER   
Sbjct: 374 LLALEESENAFSDYDKRQQRLVALMRQSDASRSAARLASVQYREGTADFLVLLDAERERL 433

Query: 423 KVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
             E   + A+ +L +  V +Y A+G G+ P
Sbjct: 434 AAEDSQAQAEIELYRGIVAIYKALGGGWQP 463


>gi|308186189|ref|YP_003930320.1| RND efflux system, outer membrane protein [Pantoea vagans C9-1]
 gi|308056699|gb|ADO08871.1| RND efflux system, outer membrane protein [Pantoea vagans C9-1]
          Length = 509

 Score =  183 bits (465), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 130/469 (27%), Positives = 237/469 (50%), Gaps = 39/469 (8%)

Query: 18  CTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL----KWWESFNDTSLNKLVKIALQQNL 73
           C VGP+Y  P  P +P  ++  +S+      T     +WW SFND  L+ L++ A+  NL
Sbjct: 23  CAVGPDYQAPK-PAVPGSYNTLDSQEASKPQTAAINSRWWRSFNDPQLDSLIERAIAGNL 81

Query: 74  TILQATERINAAKENILSVRADLFPSSYASI--------------SHRFIPNLKTNSTGQ 119
           ++ Q   RI  A+E +   +  LFPS   S               S+     L +N   Q
Sbjct: 82  SLQQTVLRIAGAREQLTQAQGSLFPSLSGSAKVTRQQLGLKGLLESNGATDQLDSNVASQ 141

Query: 120 L--------------DSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSY 164
           L              D+ W++DL+G+ RR +E++ A   +A  Q + A +++ +++  ++
Sbjct: 142 LNGLTQPVNLYQGSFDASWELDLWGKVRRQVEAANAQQQAAIEQRNDALVSLEAEVARAW 201

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           +  R  +  I    Q +++ ++  EL+  +   G      +    A++ ++++ +P  + 
Sbjct: 202 LQLRGAQSTIQTLQQQIEVAQQTTELTQSQQQNGLAPLTDVENARAQLSTLQAQLPQYQS 261

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
             R  ++ ++ LLG   T      +  +    P L   + +GIP+ L R RPDIR  E  
Sbjct: 262 QARQAMNGLAVLLG--KTPGALDAELSTPKALPPLPQFVPVGIPSTLARRRPDIRQAEAT 319

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIAL--THDNSFPGYNTH-WSFGPKLYLPIFDKGKIK 341
           L    A+IG++ + L+PSLSL G + +  T  +    +++H +S+GP L +PIF  G++ 
Sbjct: 320 LHAQTAEIGVSVAQLFPSLSLTGQLGVRNTDVSYLDNWSSHFYSYGPSLSIPIFQGGQLV 379

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           S+++ A +      + +++TVL A+++VENAL S   D++ VT L       +++  L+ 
Sbjct: 380 SSVKLARAQQASAALDYRQTVLTALQDVENALVSYRADQQRVTALDETTGALQRAFDLAS 439

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            +YRQG  + L++LD +R  A+ +   + A+ Q A   V LY A+G G+
Sbjct: 440 DSYRQGLSTFLEVLDAQRQLAQAQEQATQARMQSALDLVALYKALGGGW 488


>gi|21230898|ref|NP_636815.1| outer membrane protein [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66769103|ref|YP_243865.1| outer membrane protein [Xanthomonas campestris pv. campestris str.
           8004]
 gi|188992250|ref|YP_001904260.1| outer membrane efflux protein [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21112509|gb|AAM40739.1| outer membrane protein [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66574435|gb|AAY49845.1| outer membrane protein [Xanthomonas campestris pv. campestris str.
           8004]
 gi|167734010|emb|CAP52216.1| outer membrane efflux protein [Xanthomonas campestris pv.
           campestris]
          Length = 474

 Score =  183 bits (465), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 116/421 (27%), Positives = 209/421 (49%), Gaps = 24/421 (5%)

Query: 16  AGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTI 75
           +GC VGP+Y +P  P   T     ++          WW  F+D  L +LV+ AL  N  +
Sbjct: 16  SGCAVGPDY-RPEPPAAVTLQGAQDAAYSAESPVGNWWSQFDDPVLEQLVRDALFANHDL 74

Query: 76  LQATERINAAKENILSVRADLFPSSYASIS-------------HRFIPNLKTNSTGQLDS 122
             A  R+  A+   +  R D  P   A  S              RF   L   +T  LD+
Sbjct: 75  RIAVSRVKQARAVFVERRLDQAPHITAQGSFDRREQQQVIAGNQRF---LTEQTTLGLDA 131

Query: 123 DWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQIL 181
            W++DLFG QRR  E++ A+L++  A +   ++ V +++  +Y + R  ++++ ++ + L
Sbjct: 132 AWELDLFGRQRRASEAARADLEAEQAGLQDVQVTVAAEVARNYFELRGTQKQLDVSKRTL 191

Query: 182 DLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPA 241
              +   +L+  ++  GA S+L +    A +K+IE+DIP LE +     H I+ LLG   
Sbjct: 192 TNLRDTQKLTQTRWDLGAGSELDVQSSLARLKAIEADIPLLETAEAQYRHRIAVLLGQQP 251

Query: 242 TEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYP 301
                 +  ++    P     + +G  A L+R RPD+R  E++LA + A++G+A +DL+P
Sbjct: 252 NALDATLVARTA---PPFARALPLGDTASLLRQRPDVRTAERRLAAATAQVGVATADLFP 308

Query: 302 SLSLNGSIALTHDNSF---PGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITW 358
            +S++G +     ++     G    WS  P +    FD G +++ +R +++ A+     +
Sbjct: 309 RISVSGFVGFLSGDAARLTQGNAKAWSITPSISWAAFDFGTVRARLRASKAQAEGALAQY 368

Query: 359 QETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIE 418
           Q+TVL A+++ ENALT     +  +  +       +++  L+ I YR+G    L +LD +
Sbjct: 369 QQTVLLALEDTENALTGYGRQQARLAIVVDQANAARRAEQLAQIRYREGSEDFLTLLDAQ 428

Query: 419 R 419
           R
Sbjct: 429 R 429


>gi|50121856|ref|YP_051023.1| putative outer membrane efflux lipoprotein [Pectobacterium
           atrosepticum SCRI1043]
 gi|49612382|emb|CAG75832.1| putative outer membrane efflux lipoprotein [Pectobacterium
           atrosepticum SCRI1043]
          Length = 490

 Score =  183 bits (465), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 133/474 (28%), Positives = 234/474 (49%), Gaps = 41/474 (8%)

Query: 14  LLAGCTVGPEYTKPHMPLL-------PTQFSI---GNSKNLINIDTLKWWESFNDTSLNK 63
           ++AGC VGP+Y +P  PL          Q S    GN+    NI    WWESFND  L++
Sbjct: 15  VMAGCAVGPDYHRPDAPLADRYQAQSAAQQSFAKQGNANQTANIAV--WWESFNDPLLSE 72

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQ---- 119
           LV  AL QNL + QA+ R+  A+  + +  A L PS   ++S +     ++  T Q    
Sbjct: 73  LVSRALAQNLDLAQASARMTQARAGLGAATAALLPS--GNVSGQATRAYQSVETAQGRLL 130

Query: 120 ----------------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIP 162
                           L++ W+ID+FG  RR  +++LA+  ++ A V   +L V ++   
Sbjct: 131 NSVPGYNRYGNAYETDLNASWEIDVFGGLRRDRQAALADYQASEAGVTATRLAVAAQTAD 190

Query: 163 SYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTL 222
            YI  R  + R+ IA++ ++  ++ +E   L  ++G  ++  + + E  +  +++ +P L
Sbjct: 191 IYIALRGLQTRLKIANRQVNTQQELLEKVQLLHSKGLAAEYQVRQTEGSLSQVQATVPVL 250

Query: 223 EKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQE 282
           +      ++ +  +LG P   + + +       QP   I  + G PADL+R RPDI   E
Sbjct: 251 QTGIDAAMNALDVMLGTPPGTYRNQLASSGPIPQPPQLI--STGTPADLLRRRPDIIVAE 308

Query: 283 KKLADSVAKIGIAKSDLYPSLSLNG----SIALTHDNSFPGYNTHWSFGPKLYLPIFDKG 338
           + LA S A+IG+A S+ YP  SLN     + +++  N F    +  +    L   +FD G
Sbjct: 309 RHLAASNARIGVAISEYYPKFSLNALLGSATSVSSGNLFSNGASQSAGVLGLRWRLFDFG 368

Query: 339 KIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMS 398
           +I + I +A+    E    ++ +VL+A ++VENAL+++   +   T L         +  
Sbjct: 369 RINAQIDQAKGQEAEALAAYRLSVLSATEDVENALSALLNRETQTTTLTAGETALASARQ 428

Query: 399 LSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            S I Y++G  SL+D+L  +    +     + A+ + A++ V  + A+G G+ P
Sbjct: 429 SSFIAYQKGTASLIDVLHNDETLLQTSDARAQAQTESARAAVATFRALGGGWQP 482


>gi|113971077|ref|YP_734870.1| RND efflux system outer membrane lipoprotein [Shewanella sp. MR-4]
 gi|113885761|gb|ABI39813.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Shewanella sp. MR-4]
          Length = 517

 Score =  183 bits (465), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 133/467 (28%), Positives = 233/467 (49%), Gaps = 28/467 (5%)

Query: 3   ILRAIFSLFIVLLAGCTV-GPEYTKPHMPLLPTQ-------FSIGNSKNLINIDTLKWWE 54
           + R +      LL+GCTV GP+Y +P +P + T        FS   S +    D  +WW 
Sbjct: 7   VPRLVIGGACALLSGCTVLGPDYQQPEVPEIQTWQSASSQLFSAAPSAS----DYQQWWS 62

Query: 55  SFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKT 114
              D  L+ L+  AL +N  +  A  RI  A+   L +   L        + +++   +T
Sbjct: 63  QLQDPVLSSLIDEALLKNPDVRIAGLRILEAQAQ-LGIAESLRNPQLTQATAQWLGAGQT 121

Query: 115 ---NST------GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSY 164
              NST         +  W++D +G+ +R IES+ AN  +  AQ D  ++ +I+++   Y
Sbjct: 122 QSGNSTSGSSYGAAFNLGWELDFWGKFQRGIESADANYFATIAQYDDVQVLMIAQVAQLY 181

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           +  R  + R+ IAH    + K+++E++  +F  G T++L + + + +     S IPTLE 
Sbjct: 182 VTIRTLEARLQIAHDNAQIQKRSLEITQHQFHSGNTAELDVQQAKTQYLGTLSTIPTLET 241

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
           + R + + +STLL   A   L  M   +    P   + +   +PADL+R RPD+R  E++
Sbjct: 242 NLRHSQNALSTLLAR-APGPLPEMASNTGVI-PQGQLALVTEMPADLLRRRPDVRTAERQ 299

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNT-HWSFGPKLYLPIFDKGKIKSN 343
           LA    +IGIA+SDLYPS++L G++ L    S  G++   W  GP +   I D G++ + 
Sbjct: 300 LATQSGQIGIAESDLYPSITLAGTLGLNATGS--GHSIFSWGVGPSISWNILDSGRLTNQ 357

Query: 344 IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
           I   ++  ++ +  ++ETV  A +EV++A  +       +T L    E   +S+ ++   
Sbjct: 358 ILVQDARFEQLHEVYRETVFKAAREVDDAAIAFANSATEITLLTQTGEAASRSLEIANTQ 417

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           YR+G      +LD +RA    +  L  ++     + + LY A+G G+
Sbjct: 418 YREGMADFQRVLDSQRALFSQQERLVNSRGAHIGNLITLYKALGGGW 464


>gi|299137787|ref|ZP_07030968.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Acidobacterium sp. MP5ACTX8]
 gi|298600428|gb|EFI56585.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Acidobacterium sp. MP5ACTX8]
          Length = 480

 Score =  183 bits (464), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 127/476 (26%), Positives = 235/476 (49%), Gaps = 41/476 (8%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL-----INIDTLKWWESF 56
           +IL  +FSL    L GC+VGP Y +P + +LP QF+  ++ ++      + D  ++W SF
Sbjct: 6   SILATVFSLG---LTGCSVGPHYKQPTL-VLPQQFTAPDTASVDVSPHADADDPEFWHSF 61

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS---HRFIPNL- 112
           ND  L+ LV+ +L  N  +  A    ++A   +   + D +P+   S S    +F  N  
Sbjct: 62  NDPELSSLVQRSLTANNDLRVALAHYDSANALLREAKFDRYPTVTMSTSVGRQKFGANQA 121

Query: 113 ----KTNS--TGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
               + N   T  +++ W++D FG+ RH IE+      +  + +   ++ V+ ++  +YI
Sbjct: 122 FGYPRNNRFFTPGINASWELDFFGRVRHNIEAQRQQTLADASNLAAMQVTVVGEVASTYI 181

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
           D R  +E + IA + ++  ++ + L    ++ G  ++    +  A +++  S IP L  +
Sbjct: 182 DLRGRQELLRIARENVENEQETVRLVEAAYSAGRGTEFDTSRARALLETTTSRIPELLSA 241

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
             ++ H ++ L G      +  ++       P+L   I++G PADL+R RPD+   E++L
Sbjct: 242 IALDEHRLAVLCGLSPEALVSELEVAKP--LPDLPQRIDLGTPADLVRRRPDVSASEERL 299

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGY--------NTHWSFGPKLYLPI 334
             +  +IGIA +DL+P ++  G + L     D  F G         N  WSF        
Sbjct: 300 HAATEQIGIATADLFPRVNFAGLLGLNEFHGDTPFDGVSAVNLAALNIDWSF-------- 351

Query: 335 FDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHK 394
            D+G++++ I    +    Q   +Q++VL A+++VENAL S    +    +LQ A    K
Sbjct: 352 LDRGRVRARIAAKRADGDAQLAQYQQSVLLALEDVENALVSYARSQDRDVQLQLAANDSK 411

Query: 395 KSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           ++  L+ + ++ G   LLD+LD +R   + E   + +    A S V LY ++  G+
Sbjct: 412 RAADLASVRFKNGATGLLDLLDAQRVQLQAEDAYAESHSNSAISAVLLYKSLAGGW 467


>gi|330809923|ref|YP_004354385.1| outer membrane component of multidrug efflux system, OprN precursor
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327378031|gb|AEA69381.1| outer membrane component of multidrug efflux system, OprN precursor
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 473

 Score =  183 bits (464), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 128/471 (27%), Positives = 232/471 (49%), Gaps = 23/471 (4%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK----WWESF 56
           M++   + SL ++ L+ C VGP+Y  P         +   +    N D  +    WW+ F
Sbjct: 1   MSLKAFVPSLLVLALSACAVGPDYKAPQTEAANITTATDGAAGQKNFDRARFEGIWWQQF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS----SYASISHRFIPNL 112
           +D +LN LV  +L+ N  +  A  R+ AA+        D  P+    + +++    IP  
Sbjct: 61  DDPTLNALVTRSLEGNRELRVAFARLRAARAIRDDASNDAMPTITSRASSNLGKGQIPGQ 120

Query: 113 KTNSTGQ------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
            T+          LD  W++DLFG+ +R++E++ AN  +  A +   ++ +I++L+ +Y 
Sbjct: 121 TTDRVNTERYDLGLDMAWELDLFGRIQRNLEATDANQQAIEADLYQLQVTMIAELVDAYG 180

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
             R  + R  IA   L   + + +++      G   +L +V+ +A + S+E+ +P L+  
Sbjct: 181 QLRGAQLREKIALANLKNQQDSRKITESLRDAGVGDQLDVVRADARLASVEASVPQLQAE 240

Query: 226 FRMNVHNISTLLG-YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
                + I+TLLG  P    +    KQ     P +   + IG P +L++ RPDI   E++
Sbjct: 241 QVRQRNRIATLLGERPDKLSVDLSPKQL----PAIAKALPIGDPGELLQRRPDILSAERQ 296

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIK 341
           LA + A+IG+AK+DL+P +SL+G +  T              W+ GP +    FD G ++
Sbjct: 297 LAAATARIGVAKADLFPRVSLSGFLGFTAGRGSQIGSSAANAWALGPSITWAAFDLGSVR 356

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           + +R A++ A     T+++ VL A++E ENA +   + ++ +  L    E  + +  L+ 
Sbjct: 357 ARLRGADAEADGALATYEQQVLLALEESENAFSDYGKRQQRLISLIRQSESSRAAADLAE 416

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           I YR+G    L +LD +R     E   + A+  L +  V +Y A+G G+ P
Sbjct: 417 IRYREGTVDFLVLLDAQRERLAAEDTQAQAEVDLYRGIVAIYKALGGGWKP 467


>gi|149912533|ref|ZP_01901067.1| nodulation protein [Roseobacter sp. AzwK-3b]
 gi|149812939|gb|EDM72765.1| nodulation protein [Roseobacter sp. AzwK-3b]
          Length = 470

 Score =  182 bits (463), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 131/448 (29%), Positives = 233/448 (52%), Gaps = 28/448 (6%)

Query: 13  VLLAGCTVGPEYTKPHMPL---LPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIAL 69
           +LLAGC    E    H PL   LP ++S+         +  +WW +FND  L++LV   +
Sbjct: 11  ILLAGCA---EIGMAHRPLEADLPDRYSVLAPVKAPTREDTEWWRNFNDPVLDQLVVRGM 67

Query: 70  QQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSDWKIDLF 129
             NL++ +A  R+  A+ N     A++  S  A+ S R   N+  + T +   + +I+L 
Sbjct: 68  SDNLSVAEARARLREAEANARG--ANVPVSGNANASVRAPSNV--SETSEFSINGQINLA 123

Query: 130 GQRR-HIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNI 188
           G+      ++ A L++A      A+  V+S++  +Y D R F+   S A +  DL  +  
Sbjct: 124 GETGFRSRAAQARLEAAEFNTIEARRTVLSEVAQAYADLRFFQS--SRAFRARDLRSRQR 181

Query: 189 ELSHL--KFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEF-- 244
            L+ +  +   GA ++L L++ ++ +    ++IP L+       + +STLLG P      
Sbjct: 182 TLTDIETQLGAGAATRLDLLRAQSLLAETRAEIPQLDARIIQMRNRLSTLLGVPVGSLGI 241

Query: 245 -LHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSL 303
            L Y  +Q     P     I+ G+PADL+R RPDIR  E+  A +V+ +G A +  YPSL
Sbjct: 242 DLGYRGQQ-----PMPKGTIDAGVPADLLRARPDIRRAEQLYAAAVSDVGAADAARYPSL 296

Query: 304 SLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVL 363
           +L+G I+   +    G +   +    L +P+F++  + +    A +  ++ Y+ W+  VL
Sbjct: 297 NLSGLISAPTN----GGSRTETLLAGLVMPVFNQPALLAEKDAAAARVEQTYLQWRIAVL 352

Query: 364 NAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM-INYRQGRYSLLDILDIERATA 422
           +A++EVENA T +   +K V   + AV L+++++ LS  +    G  ++LD+LD ERA +
Sbjct: 353 DAVEEVENAQTLLTSARKSVAAAREAVTLNRQALDLSRELLSSGGNITVLDVLDRERALS 412

Query: 423 KVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
                L+   R +A +++ LY+A+G G+
Sbjct: 413 SSRTALAQNTRDVASAFIQLYVALGRGH 440


>gi|325914021|ref|ZP_08176377.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [Xanthomonas vesicatoria ATCC 35937]
 gi|325539790|gb|EGD11430.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [Xanthomonas vesicatoria ATCC 35937]
          Length = 470

 Score =  182 bits (463), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 116/421 (27%), Positives = 207/421 (49%), Gaps = 24/421 (5%)

Query: 16  AGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTI 75
           +GC VGP+Y +P  P   T     ++          WW  F+D  L +LV+ AL  N  +
Sbjct: 12  SGCAVGPDY-RPDPPASVTLQGAQDASFSAESPVGNWWSQFDDPVLEQLVRDALFANHDL 70

Query: 76  LQATERINAAKENILSVRADLFPSSYASIS-------------HRFIPNLKTNSTGQLDS 122
             A  R+  A+   +  R D  P   A  S              RF   L   +T  LD+
Sbjct: 71  RIAVSRVKQARAVFVERRLDQAPHITAQSSFDRREQQQVIAGNQRF---LTEQTTLGLDA 127

Query: 123 DWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQIL 181
            W++DLFG QRR  E++ A+LD+  A +   ++ V +++  +Y + R  ++++ ++ + L
Sbjct: 128 AWELDLFGRQRRASEAARADLDAEQANLQDVQVTVAAEVARNYFELRGTQKQLDVSKRTL 187

Query: 182 DLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPA 241
              +   +L+  ++  GA S+L +    A +K+IE+DIP LE +     H ++ LLG   
Sbjct: 188 TNLRDTQKLTQTRWDLGAGSELDVQSSLARLKAIEADIPLLETAEAQYRHRLAVLLGQQP 247

Query: 242 TEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYP 301
                 +  +S    P    P+ +G  A L+R RPD+R  E++LA + A++G+A +DL+P
Sbjct: 248 NALDATLVARS---MPAFARPLPLGDTAGLLRQRPDVRSAERRLAAATAQVGVAMADLFP 304

Query: 302 SLSLNGSIALTHDNSF---PGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITW 358
            +S++G +     ++     G    WS  P +    FD G +++ +R +++ A      +
Sbjct: 305 RISVSGFVGFLSGDAARLTQGNAKAWSITPSISWAAFDFGTVRARLRASKAQADGALAQY 364

Query: 359 QETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIE 418
           Q+ VL A+++ ENAL      +  +  +       +++  L+ I YR+G    L +LD +
Sbjct: 365 QQAVLLALEDTENALIGYGRQQARLAIVVDQANAARRAEQLAQIRYREGSEDFLTLLDAQ 424

Query: 419 R 419
           R
Sbjct: 425 R 425


>gi|330965812|gb|EGH66072.1| outer membrane efflux protein [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 465

 Score =  182 bits (463), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 132/450 (29%), Positives = 235/450 (52%), Gaps = 26/450 (5%)

Query: 21  GPEYTKP-HMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQAT 79
           GP+Y  P   P      + GN  +   ++TL WW+ F+D +LNKLV  +L  N  +  A 
Sbjct: 22  GPDYKAPVTAPATLASAAKGN-YDRSKVNTL-WWQQFDDPTLNKLVAQSLDGNRDLRVAF 79

Query: 80  ERINAAKENILSVRADLFP--SSYAS----------ISHRFIPNLKTNSTGQLDSDWKID 127
            R+ A +     V  D+ P  +S AS          ++ R + N +    G LD  W++D
Sbjct: 80  ARLKAVRAIRDDVANDIMPVVTSRASSDLGKGQQPGVTERRV-NSERYDLG-LDMAWELD 137

Query: 128 LFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKK 186
           LFG+ +R +E+S A+ ++A A +   ++ +I++++ +Y   R  + R +IA   L   +K
Sbjct: 138 LFGRIQRQLEASNADQEAAEANLYQLQVTLIAEVVDAYGQLRGAQLREAIARDNLTNQQK 197

Query: 187 NIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG-YPATEFL 245
           +  ++      G  ++L +V+ +A + ++E+ +P L+       + I+TLLG  P T  +
Sbjct: 198 SQGITTQLRDAGVGNELDVVRADARLAAVEATVPQLQAEQARQRNRIATLLGERPDTLSV 257

Query: 246 HYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSL 305
                 S +  P +   + IG    ++RNRPDIR  E++LA S A+IG+A +DL+P +SL
Sbjct: 258 DL----SPSKLPAIAKALPIGDATQVLRNRPDIRAAERQLAASTARIGVATADLFPRVSL 313

Query: 306 NGSIALTHD-NSFPGYNTH--WSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETV 362
           +G +  T    S  G +    WS GP +    FD G +++ IR A++ A+     +++ V
Sbjct: 314 SGFLGYTAGRGSQIGSSAARAWSLGPSITWAAFDLGSVRAQIRSADADAEGALANYEQQV 373

Query: 363 LNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATA 422
           L A++E ENA +  ++ ++ +  L    +  + +  L+ + YR+G    L +LD ER   
Sbjct: 374 LLALEESENAFSDYDKRQQRLVALMRQSDASRSAARLASVQYREGTADFLVLLDAERERL 433

Query: 423 KVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
             E   + A+ +L +  V +Y A+G G+ P
Sbjct: 434 AAEDSQAQAQIELYRGIVAIYKALGGGWQP 463


>gi|78222875|ref|YP_384622.1| RND efflux system, outer membrane lipoprotein, NodT [Geobacter
           metallireducens GS-15]
 gi|78194130|gb|ABB31897.1| RND efflux system, outer membrane lipoprotein, NodT [Geobacter
           metallireducens GS-15]
          Length = 546

 Score =  182 bits (462), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 134/492 (27%), Positives = 234/492 (47%), Gaps = 56/492 (11%)

Query: 3   ILRAIFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLIN-IDTLKWWESFNDTS 60
           +L A+F     +L+GC  VGP++ +P + +       G ++      D   WW  FND  
Sbjct: 18  VLAAVF-----ILSGCIKVGPDFHRPDVAVPSDWTEAGENQGETGPADYRSWWRVFNDPI 72

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS--HRFIPNLKTNSTG 118
           L++L+ +A ++NLT+  A  R+  A+  +  V  + FP +       H    +  +  TG
Sbjct: 73  LDRLIDLAYRENLTLRIAGARVLEARALLGIVVGEYFPQTQQGFGSVHYNRTSRGSVQTG 132

Query: 119 Q--------------------------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDI 151
                                      L + W++D +G+ RR IES+ A+  ++ A  D 
Sbjct: 133 TQQSSASQSSASLGGGSGLSFWQSQIGLTASWELDFWGKYRRAIESADASWLASVADYDN 192

Query: 152 AKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAE 211
           A + + + +  SYI  R  + R+ IA +     ++N+ ++  +F  G  ++L L + E  
Sbjct: 193 ALVALTADVANSYITIRTLETRLDIARRNTQTQRENLNIAEARFKYGTATQLDLDQAETS 252

Query: 212 IKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPIN-----IG 266
           + +  +  P+LE   R   H +S LLG    +   Y+   +        IP++      G
Sbjct: 253 LNTTLATTPSLEAQLRQTKHGLSVLLGMAPGDLSGYLNGPAT-------IPVSPPQVVFG 305

Query: 267 IPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIA-LTHDNSFPGYNT--H 323
           IPADL+R RPDIR  E + A   A+IG+AK+DLYP+ SL+G+   L+ D      +   +
Sbjct: 306 IPADLLRRRPDIRAAEHRAAAQSAQIGVAKADLYPAFSLSGTFGFLSTDIGGASLSDMFN 365

Query: 324 WS-----FGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINE 378
           WS      GP     I + G+I +N+R  ++  QE  IT+Q  VL A +EVE+ L +   
Sbjct: 366 WSSRFIQAGPSFQWNILNYGRISNNVRLQDARLQELLITYQNMVLTAQQEVEDNLVAFLR 425

Query: 379 DKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKS 438
            +     L  +     +S++L+++ Y+QG      +L  +++    +  L+     +A S
Sbjct: 426 ARDRAEFLARSTAAAARSLNLAVLQYQQGIKDFTTVLIAQQSLLNEQDSLATTMGSIASS 485

Query: 439 YVDLYIAIGSGY 450
            V +Y A+G G+
Sbjct: 486 LVGVYRALGGGW 497


>gi|206890101|ref|YP_002249206.1| RND efflux system, outer membrane lipoprotein, NodT
           [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206742039|gb|ACI21096.1| RND efflux system, outer membrane lipoprotein, NodT
           [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 434

 Score =  182 bits (462), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 127/422 (30%), Positives = 223/422 (52%), Gaps = 18/422 (4%)

Query: 45  INIDT---LKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS-- 99
           IN DT    KWWESFND +L++L++IA++ NL + QA  RI  AK       A LFPS  
Sbjct: 6   INNDTENLAKWWESFNDKTLSQLIEIAIKNNLDLKQAQARIKEAKARREVAGAKLFPSID 65

Query: 100 --SYASISHRFIPNLKTNSTGQL-----DSDWKIDLFG-QRRHIESSLANLDSAYAQVDI 151
             S AS S      ++ N+   L     D+ W+ D+FG +R+ +E+  A  +++      
Sbjct: 66  AKSSASYSKTRGTKIEDNTVEHLYSAGIDASWEADIFGGKRKSLEAYQAEFEASQWDFKA 125

Query: 152 AKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAE 211
             +++IS++  +YI+ + ++ RI IA + L+   +   L+  K+  G    + + + E  
Sbjct: 126 TIVSLISEVALNYIELKTYQNRIEIAEKNLNSQTETYNLTKWKYMAGLNDAIDVTQAEYS 185

Query: 212 IKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADL 271
           +++  + +P+L  +    ++ I+ LLG    +    ++K  ++ +P +   I++ IPAD+
Sbjct: 186 MENTRAQLPSLRTAIEEKINTIAVLLGKQPQQISEELKK--SHTKPLISEKISLRIPADV 243

Query: 272 IRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALT--HDNSFPGYNTHWSFGPK 329
           ++ RPDIR  E++LA   A++  A +  YP  +L+GS  +     NS     T    G  
Sbjct: 244 LKMRPDIRKAERQLAAQSARVDEAIAGFYPKFTLSGSFGIEALSLNSLVKAATKIITGDF 303

Query: 330 LY-LPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQH 388
           L  LPIF   +I+ N+    +  ++  + ++ TVLNAIKEVENAL +  E++K    L+ 
Sbjct: 304 LISLPIFHADEIRQNVEIQTALQEQALLNYEATVLNAIKEVENALVAYAEEQKRKQALEK 363

Query: 389 AVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGS 448
           AVE  + S +L++  Y  G      +L+ +R+   ++  L  +K  +    + LY A G 
Sbjct: 364 AVEASQLSFALALQKYEVGLTDFSTVLETQRSLLNLQDQLEQSKGNIFIYLIKLYKAFGG 423

Query: 449 GY 450
           G+
Sbjct: 424 GW 425


>gi|330503451|ref|YP_004380320.1| RND efflux system outer membrane lipoprotein [Pseudomonas mendocina
           NK-01]
 gi|328917737|gb|AEB58568.1| RND efflux system outer membrane lipoprotein [Pseudomonas mendocina
           NK-01]
          Length = 462

 Score =  182 bits (462), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 125/459 (27%), Positives = 228/459 (49%), Gaps = 20/459 (4%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINID-TLKWWESFNDTSLNKLVKI 67
           +L  + L+ C VGP+Y  P     P + +   + +         WW+ F+D +LN+LV+ 
Sbjct: 7   ALLTLALSACAVGPDYRAPATD--PARIAALEAADYDRSRFEAAWWQQFDDPTLNQLVQR 64

Query: 68  ALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQ-------- 119
           +LQ N  +  A  R+ AA+     V  D  P+  +  S  F    +  +T +        
Sbjct: 65  SLQDNRELRVAFNRLRAARAIRDDVANDRLPTVTSRASGEFGKAQQPPTTDERVRQERYD 124

Query: 120 --LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISI 176
             LD  W++DLFG+ +R +E+S A ++ A A     ++++I++L+ +Y   R  + R SI
Sbjct: 125 LGLDMAWEVDLFGRIQRQLEASEARIEVAEADYYQLQVSLIAELVDAYGTLRGAQLRESI 184

Query: 177 AHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL 236
           A + L   + +  ++      G  ++L +++ +A + + E+ +P L+       + I+TL
Sbjct: 185 ARENLKNQQDSRAITEQLRDAGVGTELDVLRADARLAATEASLPQLQAQQVRAQNRIATL 244

Query: 237 LGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
           LG    +    +  +     P +   + IG PA+L+R RPDI+  E++LA + A +G+A 
Sbjct: 245 LGQRPEQLQVDLAPRP---LPVIAKALPIGNPAELLRRRPDIQAAERQLAAATADVGVAT 301

Query: 297 SDLYPSLSLNGSIALTHD-NSFPGYNTH--WSFGPKLYLPIFDKGKIKSNIRRAESSAQE 353
           +DL+P +SL+G +  T    S  G +    W   P +    FD G +++ +R AE+ A  
Sbjct: 302 ADLFPRVSLSGFLGFTAGRGSQLGASAARAWGVAPSISWAAFDLGSVRARLRGAEAQADG 361

Query: 354 QYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLD 413
               +++ VL A++E ENA +   + ++ +  L    E  + +   + I YR+G    L 
Sbjct: 362 ALAQYEQQVLLALEESENAFSDYAKRQQRLVSLVRQAEASRAAADQAAIRYREGTVDFLV 421

Query: 414 ILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           +LD ER     E   + A+ +L    V +Y A+G G+ P
Sbjct: 422 LLDAERERLAAEDAQASAETELYSGIVAIYKALGGGWQP 460


>gi|253689056|ref|YP_003018246.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251755634|gb|ACT13710.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 490

 Score =  182 bits (462), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 132/474 (27%), Positives = 235/474 (49%), Gaps = 43/474 (9%)

Query: 15  LAGCTVGPEYTKPHMPLL---PTQFSI-------GNSKNLINIDTLKWWESFNDTSLNKL 64
           +AGC VGP+Y +P  PL     TQ +I       GN     N+    WWESFND  L++L
Sbjct: 16  IAGCAVGPDYHRPDAPLADRYQTQSAIKSSLAEQGNVTQAANLAV--WWESFNDPLLSEL 73

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQ----- 119
           V  AL QNL + QA+ R++ A+  + +    L PS   +IS +     ++  T Q     
Sbjct: 74  VSRALTQNLDLAQASARMSQARAGLGTATTALLPSG--NISGQAARAYQSVETAQGQLLN 131

Query: 120 ---------------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPS 163
                          L++ W+ID+FG  RR  +++LA+  ++ A V   +L + ++   +
Sbjct: 132 AVPGYNRYGNAYETDLNASWEIDVFGGLRRDRQAALADYQASEAGVTATRLAIAAQTADT 191

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           YI  R  + R++IA+  ++  ++ ++      ++G  ++  + + E  +  +++ +P ++
Sbjct: 192 YITLRGLQTRLAIANMQVNTQQELLDKVQRLHSKGLAAEYQVRQTEGALSQVQATVPAIQ 251

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
                 ++ +  +LG P     H +Q  ++   P     I  G PADL+R RPDI   E+
Sbjct: 252 TGIDAAMNALDVILGTP--PGTHQVQLSASGDIPQPPSLIATGTPADLLRRRPDIIVAER 309

Query: 284 KLADSVAKIGIAKSDLYPSLSLNG----SIALTHDNSFPGYNTHWSFGPKLYLPIFDKGK 339
            LA S A+IG+A S+ YP  SLN     + +++  N F    +  +    L   +FD G+
Sbjct: 310 HLAASNARIGVAISEYYPKFSLNALLGSATSVSSGNLFSSGASQSAGVLGLRWRLFDFGR 369

Query: 340 IKSNIRRAESSAQEQYITWQETVLNAIKEVENALTS-INEDKKIVTKLQHAVELHKKSMS 398
           I + I RA+    E    ++ +VL A ++VENAL++ +N + +  T       L     S
Sbjct: 370 INAQIDRAKGQEAEALAAYRLSVLRATEDVENALSAVVNREAQSATLTAGETALTSARQS 429

Query: 399 LSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            S I Y++G  SL+D+L  +    +     + A+ + A++ +  + A+G G+ P
Sbjct: 430 -SFIAYQKGTASLIDVLHADETLLQASDARAQAQTEAARAAIAAFKALGGGWQP 482


>gi|304397008|ref|ZP_07378887.1| RND efflux system, outer membrane lipoprotein, NodT family [Pantoea
           sp. aB]
 gi|304355157|gb|EFM19525.1| RND efflux system, outer membrane lipoprotein, NodT family [Pantoea
           sp. aB]
          Length = 509

 Score =  182 bits (462), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 127/469 (27%), Positives = 238/469 (50%), Gaps = 39/469 (8%)

Query: 18  CTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL----KWWESFNDTSLNKLVKIALQQNL 73
           C VGP+Y  P  P +P  ++  +S+            +WW SFND  L+ L++ A+  NL
Sbjct: 23  CAVGPDYQAPK-PAVPGSYNTLDSQEASKPQNAAINSRWWRSFNDPQLDSLIERAIAGNL 81

Query: 74  TILQATERINAAKENILSVRADLFPSSYASI--------------SHRFIPNLKTNSTGQ 119
           ++ Q   RI  A+E +   +  LFPS   S               S+     L +N   Q
Sbjct: 82  SLQQTVLRIAGAREQLTQAQGSLFPSLSGSAKVTRQQLGLKGLLESNGATDQLDSNVASQ 141

Query: 120 L--------------DSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSY 164
           L              D+ W++DL+G+ RR +E++ A   +A  Q + A +++ +++  ++
Sbjct: 142 LNGLTQPVNLYQGSFDASWELDLWGKVRRQVEAANAQQQAAIEQRNDALVSLEAEVARAW 201

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           +  R  +  +    + +++ ++  EL+  +   G      +    A++ ++++ +P  + 
Sbjct: 202 LQLRGAQSTVQTLQEQINVAQQTTELTQSQQRNGLAPLTDVENARAQLSTLQAQLPQYQS 261

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
             R  ++ ++ LLG   T      +  +    P L   + +GIP+ L R RPDIR  E  
Sbjct: 262 QARQAMNGLAVLLG--KTPGALDAELSTPKALPPLPQFVPVGIPSTLARRRPDIRQAEAT 319

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIALTHDNS--FPGYNTH-WSFGPKLYLPIFDKGKIK 341
           L    A+IG++ + L+PSLSL G + + + ++     +++H +S+GP L +PIF  G++ 
Sbjct: 320 LHAQTAEIGVSVAQLFPSLSLTGQLGVRNTDASYLDNWSSHFYSYGPSLSIPIFQGGQLV 379

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           S+++ A +      + +++TVL A+++VENAL S   D++ VT L       +++ +L+ 
Sbjct: 380 SSVKLARAQQASAALDYRQTVLTALQDVENALVSYRADQQRVTALDETTGALQRAFNLAS 439

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            +YRQG  + LD+LD +R  A+ +   + A+ Q A   V LY A+G G+
Sbjct: 440 DSYRQGLSTFLDVLDAQRQLAQAQEQATQARMQSALDLVALYKALGGGW 488


>gi|91203027|emb|CAJ72666.1| similar to multicomponent efflux pump (outer membrane subunit, RND
           family of ABC transporters) [Candidatus Kuenenia
           stuttgartiensis]
          Length = 493

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 123/466 (26%), Positives = 234/466 (50%), Gaps = 31/466 (6%)

Query: 10  LFIVLLAGCT-VGPEYTKPHMP---LLPTQFSIGNSKNLINIDTL-KWWESFNDTSLNKL 64
           L   LLA CT VGP+Y KP          Q   G ++  ++ +TL +WW+S  D  L+  
Sbjct: 27  LLFTLLASCTTVGPDYKKPDRASPEAWVGQLEGGLTQQQLDPETLSQWWKSLGDPVLSGF 86

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSYA---SISHRFIPNLKTNSTGQL- 120
           V+ A+  NL +  A  ++  A+     + +  FP+  A   +I      N    ST +L 
Sbjct: 87  VERAIAANLDLRTAEAQLCQARAQRGIIGSTRFPTIDAEGFAIRTGSSENTGAGSTSELY 146

Query: 121 ----DSDWKIDLFGQR-RHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERIS 175
               D+ W++D+FG R R +E++ A+  +A        ++V++++  +YI+ R F+ + +
Sbjct: 147 SSSFDAAWELDIFGGRHRALEAAEADFQAAQEARRDVLVSVLAEVAVNYIELRTFQAQYA 206

Query: 176 IAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIST 235
           +A Q L +    +E+   +F  GA  +L L +  +  ++  S++P L ++     + ++ 
Sbjct: 207 VAKQNLLVQLDTLEIVQAQFDAGAVLELDLERAVSNAETTRSELPRLNQAITQAKNRLAV 266

Query: 236 LLGY-PAT-----EFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
           L+G  P T     + L  M   S        + I +G+PA+ +R RPD+R  E++LA   
Sbjct: 267 LIGQTPGTVDKELDGLRLMSTPS--------VQIAVGVPAETLRRRPDVRRAERQLAAET 318

Query: 290 AKIGIAKSDLYPSLSLNGSIAL---THDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           A+IG+A + LYP  +L G+I L   +  N     +  W  GP +   IFD G+ +  I  
Sbjct: 319 ARIGVATAVLYPKFTLAGTIGLESLSPSNLIASDSRTWGIGPSVQWNIFDGGRTRQKIAV 378

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
             +  ++  + ++ ++LNA++EVENA+T+  +++     L  +    +++ +++   Y  
Sbjct: 379 QNALQEQAMVQYEASILNALEEVENAITAFTQEQLRYRSLVESAAAAERAANIAQTRYEA 438

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           G  + L +LD +R     +   + ++  +  + V LY ++G G+ P
Sbjct: 439 GASNFLTVLDTQRTLLSTQNRQAASQGAIMSNLVRLYKSLGGGWTP 484


>gi|300716019|ref|YP_003740822.1| RND efflux system, outer membrane lipoprotein, NodT [Erwinia
           billingiae Eb661]
 gi|299061855|emb|CAX58971.1| RND efflux system, outer membrane lipoprotein, NodT [Erwinia
           billingiae Eb661]
          Length = 517

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 135/497 (27%), Positives = 239/497 (48%), Gaps = 52/497 (10%)

Query: 1   MNI----LRAIFSLFIVLLA--GCTVGPEYTKPHMPLLPTQF-SIGN---SKNLINIDTL 50
           MN+    LR+  S  +  LA   C+VGP+Y  P  P  P  F SI N   S    +    
Sbjct: 1   MNVYLPFLRSRLSAVVATLALSACSVGPDYQAPK-PSTPAAFNSIKNDSGSNPQASATNA 59

Query: 51  KWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHR--- 107
            WW+SFND  L+ L+  A+  NL++ QA  RI  A++ +   R   +PS  A+ S +   
Sbjct: 60  NWWKSFNDPQLDSLIDRAIAGNLSLQQAVLRIAGARQQLNQARGAWYPSVNANASAKREQ 119

Query: 108 --FIPNLKTNST--------------------------GQLDSDWKIDLFGQ-RRHIESS 138
                 L++N                            G  D+ W++DL+G+ RR +E +
Sbjct: 120 LGLKGELESNGVYDQADNVDPQVSSALNGLTKPVALYQGSFDASWELDLWGKVRRQVEMA 179

Query: 139 LANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQG 198
            A    +    + A +++ +++  +Y+  R  +         +D+ ++  EL+  +   G
Sbjct: 180 DAQQQESVESRNDALVSLEAEVARTYLQLRGAQSVSQTLQTQIDVAQQTFELTQSQQRNG 239

Query: 199 ATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPN 258
              ++ +    A++ S+ + +P  E      ++ ++ L+G P       +   ++   P 
Sbjct: 240 LAPQMDVENARAQLNSLRAQLPQYESQVHQALNGLAVLIGKPPGALDAELI--ASKPLPP 297

Query: 259 LYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFP 318
           L   + +G+P+ L R RPD+R  E KL  + A IG++ + L+P LSL G   +   NS  
Sbjct: 298 LPKVVPVGLPSTLARRRPDVRQAEAKLHAATANIGVSVAQLFPDLSLTGQFGMR--NSDI 355

Query: 319 GYNTHWS-----FGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENAL 373
            Y  +WS     FGP + +PIF  G++ S+++ A +      + +++TVL A+++VENAL
Sbjct: 356 SYLDNWSSNFYSFGPSVSIPIFQGGRLISSVKLARADQASAALGYRQTVLTALQDVENAL 415

Query: 374 TSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKR 433
            S   D++ V  L   VE  + +  L+  +Y+QG  + +D LD +R  A+ +   + A+ 
Sbjct: 416 VSYRTDQQQVEGLDRTVEAMQNAFDLASDSYKQGLSTFIDALDAQRQLAQAKQQAAQARV 475

Query: 434 QLAKSYVDLYIAIGSGY 450
           Q +   V LY A+G G+
Sbjct: 476 QSSLDLVALYKALGGGW 492


>gi|301058955|ref|ZP_07199924.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [delta proteobacterium NaphS2]
 gi|300446951|gb|EFK10747.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [delta proteobacterium NaphS2]
          Length = 468

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 121/434 (27%), Positives = 218/434 (50%), Gaps = 32/434 (7%)

Query: 48  DTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSS--YASIS 105
           D   WW  FND  LN LV+ AL QNLT+  A  RI  A+  +      L+P      + +
Sbjct: 10  DVTNWWTVFNDPVLNSLVEKALNQNLTLQVAGLRIFEARAELGFTTGLLYPQQQRLQAGA 69

Query: 106 HRFIPNLKTNSTGQLDSD-----------WKIDLFGQ-RRHIESSLANLDSAYAQVDIAK 153
            R   +    +T  LD+D           W++D +G+ RR +E++ A+L ++ A  D A 
Sbjct: 70  SRVKSSKNAANTMLLDTDYVDYDVGFDAAWELDFWGRYRRAVEAADASLHASIADYDNAM 129

Query: 154 LNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIK 213
           + +++++  +Y+  R F++RI++A +   + ++++E++  +F  G  ++L + +  A +K
Sbjct: 130 VTLVAEVARTYVLIRTFEKRIALARENTGIQQRSLEIAQRRFKGGIVTELDVQQATALLK 189

Query: 214 SIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIR 273
           + ++ +P   K+ +   H +S LLG P  E    +        P +   + +G+PA+L+R
Sbjct: 190 NTQALVPRFTKNLQEAKHALSVLLGLPPGELPESLVDSRK--VPMVLPQVVVGVPAELLR 247

Query: 274 NRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIAL-------THDNSFPGYNTHWSF 326
            RPDIR  E   A     IG+AK+DLYP   L GSI L       T      G N    F
Sbjct: 248 RRPDIRRAEMMAAAQCDLIGVAKADLYPHFILIGSIGLRTSTSLFTKAGGIDGSNFSDLF 307

Query: 327 ---------GPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSIN 377
                    GP +   IF+ G++K+ +R  ++  Q+  + +Q TVLNA +EVE+A+    
Sbjct: 308 SSDSFQLFAGPSIRWDIFNYGRLKNKVRVQDARFQQLIVQYQNTVLNAAREVEDAIVGFL 367

Query: 378 EDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAK 437
             +     L+  V+  K+++ +S++ YR+G      +L  +    + +   +     +A 
Sbjct: 368 RSQDENAFLKSGVQASKRAVDISLLQYREGLVDYQRVLSAQSFLTQQQDQQTSTSSLVAL 427

Query: 438 SYVDLYIAIGSGYN 451
           + + LY A+G G++
Sbjct: 428 NLISLYKALGGGWD 441


>gi|148549654|ref|YP_001269756.1| RND efflux system outer membrane lipoprotein [Pseudomonas putida
           F1]
 gi|148513712|gb|ABQ80572.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Pseudomonas putida F1]
          Length = 484

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 126/463 (27%), Positives = 236/463 (50%), Gaps = 35/463 (7%)

Query: 17  GCTVGPEYTKP--HMP--LLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQN 72
           GCT+GP++ +P    P    P Q     S+       L+WWE+F+D  L+ L++   ++N
Sbjct: 18  GCTLGPDFLRPDSQAPQQWAPLQGEAAASQPQAEPLELRWWETFHDARLSALIQRVAERN 77

Query: 73  LTILQATERINAAKENILSVRADLFPS-------SYASISHRFI--PNLKTNS------T 117
           L +  A+ R+  ++    ++ AD  PS       S A  S   +  P+ K          
Sbjct: 78  LDLQMASARLLQSRALRSTLAADEVPSVDVNAGYSRARNSADGLSDPSGKAGKEAFNLWQ 137

Query: 118 GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISI 176
           G L + W++DL+G+ RR +E++ A ++ A        L ++S+   +YI  R  +  + +
Sbjct: 138 GDLVAGWELDLWGRVRRQVEAADATVEVAENDRRGVLLALLSETAGNYIQLRAVQHTLDV 197

Query: 177 AHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL 236
               L + + +++LS  +  +G  ++L + +  A++ SIE+ +P+LE + R ++ N  +L
Sbjct: 198 TQDNLRVARHSLKLSQDRQAEGVATRLDVAQASAQVASIEARLPSLE-ARRDDLINALSL 256

Query: 237 LGYPATEFLHYMQKQSNNFQPNLYIP-----INIGIPADLIRNRPDIRYQEKKLADSVAK 291
           L   A E    +Q +     P   +P       IG+P++L   RPDIR  E +L  + A 
Sbjct: 257 L---AAEPPRSLQAE---LLPGGELPAPQQKFAIGLPSELAERRPDIRQAEARLHAATAS 310

Query: 292 IGIAKSDLYPSLSLNGSIALT--HDNSFPGYNTH-WSFGPKLYLPIFDKGKIKSNIRRAE 348
           IG+AK+D YPS+ L+GS+       + F G+++  ++FGP++ LPIF+ G++K  +   E
Sbjct: 311 IGVAKADFYPSIRLSGSVGFQAMQLSDFGGWDSRRFAFGPQMSLPIFEGGRLKGTLELRE 370

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           +  QE  + +++ VL A  E+++ L   N  +     L  AV  ++ ++  +   Y +G 
Sbjct: 371 AQQQEAALNYRKVVLGAWHEIDDVLRLYNASQLRRDHLAEAVRQNRIALETAQRQYVEGA 430

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
              L++L ++ A    E     +   ++++ V LY A+G G+ 
Sbjct: 431 VDFLNVLTVQGALLASEEQWIDSSAAVSQALVGLYKALGGGWQ 473


>gi|325922880|ref|ZP_08184600.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [Xanthomonas gardneri ATCC 19865]
 gi|325546634|gb|EGD17768.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [Xanthomonas gardneri ATCC 19865]
          Length = 474

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 115/428 (26%), Positives = 211/428 (49%), Gaps = 24/428 (5%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIA 68
           +L  ++L+GC VGP+Y +P  P   T     ++          WW  F+D  L +LV+  
Sbjct: 9   ALAALVLSGCAVGPDY-RPDPPAAVTLQGAQDAAYSAESPVGNWWSQFDDPVLEQLVRDG 67

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPSSYASIS-------------HRFIPNLKTN 115
           L  N  +  A  R+  A+   +  R D  P   A  S              RF   L   
Sbjct: 68  LFANHDLRIAVSRVKQARAVFVERRLDQAPHITAQGSFDRREQQQVIAGNQRF---LTEQ 124

Query: 116 STGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
           +T  LD+ W++DLFG QRR  E++ A+L++  A +   ++ V +++  +Y + R  ++++
Sbjct: 125 TTLGLDAAWELDLFGRQRRASEAARADLEAEQAGLLDVQVTVAAEIARNYFELRGTQKQL 184

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
            ++ + L       +L+  ++  GA S+L +    A +K+IE+DIP LE +     H ++
Sbjct: 185 DVSKRTLTNLHDTQKLTQTRWDLGAGSELEVQSSLARLKAIEADIPLLETAEAQYRHRLA 244

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
            LLG         +  ++    P     + +G  A L+R RPD+R  E++LA + A++G+
Sbjct: 245 VLLGQAPDALDATLVPRTT---PAFARALPLGDTAGLLRQRPDVRSAERRLAAATAQVGV 301

Query: 295 AKSDLYPSLSLNGSIALTHDNSF---PGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           A +DL+P +S++G +     ++     G    WS  P +    FD G +++ +R +++ A
Sbjct: 302 ATADLFPRISVSGFVGFLSGDAARLTEGSGKAWSITPSISWAAFDFGTVRARLRASKAQA 361

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           +     +Q+ VL A+++ ENALT     +  +  +       +++  L+ I YR+G    
Sbjct: 362 EGALAQYQQAVLLALEDTENALTGYGRQQARLAIVVEQANAARRAEQLAQIRYREGSEDF 421

Query: 412 LDILDIER 419
           L +LD +R
Sbjct: 422 LTLLDAQR 429


>gi|328954054|ref|YP_004371388.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfobacca acetoxidans DSM 11109]
 gi|328454378|gb|AEB10207.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfobacca acetoxidans DSM 11109]
          Length = 477

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 117/471 (24%), Positives = 234/471 (49%), Gaps = 33/471 (7%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIG----NSKNLINIDTLKWWESFNDTSL 61
            +  L  +L+ GCT+GP+Y +P  P+ PT    G         ++   LKW+E F D  L
Sbjct: 4   CLIMLLFMLVCGCTLGPDYQRPGYPVPPTFRGAGPDLSKQPAEVSFGDLKWFEVFKDQKL 63

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL- 120
            +L+ IALQ+N  +  A +R+ AA+E +   R+ LFP+     ++  + +L+T+  G   
Sbjct: 64  QELIHIALQENYDVQIAAQRVMAAREQVTIQRSYLFPTLN---TNGQLESLRTSERGFSV 120

Query: 121 --------------DSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
                         D  W++D FG+ RR  E++ A   ++          +++ L  +YI
Sbjct: 121 LAPQQERMAGLIFGDLSWELDFFGRIRRATEAARAEFYASEENRKFVIQTLVTDLARAYI 180

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
           + R   +++ I+++ + + +++++L   +F  G  S+  ++  E  +    + +P L+++
Sbjct: 181 ELRALDQQLDISNRTVKVREESLKLVKARFDYGWDSQTPVLMTENLVYGARAVVPDLQRA 240

Query: 226 FRMNVHNISTLLGY-PATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
                + I+TLLG  P       + +     +  L + I  G+ + L+  RPD+R+ E+ 
Sbjct: 241 IEQQENRITTLLGRNPGP-----VSRGKPLLKQKLSVTIPPGMTSALLERRPDVRFAEES 295

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSF----GPKLYLPIFDKGKI 340
           L  + A+IG AK+ L+P++ + G            ++ H SF     P +  PIF+ G++
Sbjct: 296 LVAANARIGEAKALLFPNIRITGVAGWESAALKSLFSAHASFWDVISPGITQPIFNAGRL 355

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++N+R  E+  QE  + +++++  A +EV +AL  +   +++  + +  V+   K   L+
Sbjct: 356 RANVRATEALQQEALLNYKKSIQQAFREVSDALVGVRRLREVRLEAEKQVQALTKQTDLA 415

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
              Y  G    L++LD +R   + E+ L+  +     + + LY A+G G+ 
Sbjct: 416 NQRYFGGVTPYLEVLDSDRQLFEAELRLTQVQANELLAVIALYRALGGGWQ 466


>gi|330809913|ref|YP_004354375.1| outer membrane component of multidrug efflux system [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327378021|gb|AEA69371.1| putative outer membrane component of multidrug efflux system
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 486

 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 137/471 (29%), Positives = 235/471 (49%), Gaps = 40/471 (8%)

Query: 14  LLAGCTVGPEYTKP-----HMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIA 68
           L+ GCTVGP+Y +P     H  L   Q S+       +   + WWE F D  L+ L+  A
Sbjct: 15  LMTGCTVGPDYQRPDAAPGHRYL--GQASVEQRSAATSASLVAWWEGFADPVLSDLIAQA 72

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPS---------SYASISHRFIPNLKTNSTGQ 119
           L+QNL + QA+ R+  A+  + +  A L PS         SY S+       L  NST  
Sbjct: 73  LEQNLDLAQASARVTQARAGLGAANAALLPSGNINGQAARSYQSVETPLGQVL--NSTPG 130

Query: 120 LD-----------SDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
            D           + W+IDLFG  RR  E++LA   ++ A V   +L V ++    YI A
Sbjct: 131 YDRYGNAYELNVGASWEIDLFGGLRRGREAALAQYQASEAGVAATRLVVAAQTADLYITA 190

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
           R  + R+ IA+Q +   +  +E   L +++G  +   + ++E  +  +++ +P L+    
Sbjct: 191 RGLQARLDIANQQVKTQQDLLEKVQLLYSKGLAANYQVHQVEGALSQVQATVPVLQTGLD 250

Query: 228 MNVHNISTLLGYP-ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLA 286
             ++ +  +LG P  T     +  +S    P +     +G PADL+R RPD+   E++LA
Sbjct: 251 AAMNALDVMLGTPPGTHRTQLVNGRSIPLAPQI---TAMGTPADLLRRRPDLIVAERRLA 307

Query: 287 DSVAKIGIAKSDLYPSLSLNG----SIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
            S A+IG A ++ YP  SL+     + A++  N F G ++  +    L   +FD G+I +
Sbjct: 308 ASNARIGEAVAEYYPKFSLSALLGSATAVSGGNLFTGDSSQAAGALGLRWRLFDFGRINA 367

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTS-INEDKKIVTKLQHAVELHKKSMSLSM 401
            I +A+    E    ++++VL A ++VENA ++ +N + +  T  Q    L +   S S 
Sbjct: 368 QIDQAKGQEAEALAAYRQSVLRATEDVENAFSALVNRESQASTLTQGETSLTQARQS-SF 426

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           I Y++G  SL+D+L+ +    +V    + A+ + A++ V  + A+G G+ P
Sbjct: 427 IAYQKGTASLIDVLNADATLLQVSDARAQARMESARAAVAAFRALGGGWQP 477


>gi|46578479|ref|YP_009287.1| RND efflux system outer membrane lipoprotein [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|46447890|gb|AAS94546.1| RND efflux system, outer membrane protein, NodT family
           [Desulfovibrio vulgaris str. Hildenborough]
 gi|311232407|gb|ADP85261.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfovibrio vulgaris RCH1]
          Length = 504

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 127/464 (27%), Positives = 235/464 (50%), Gaps = 30/464 (6%)

Query: 10  LFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIAL 69
           L   LL+GC +GP+Y +P M L P+ +    S +   +   KWW  F D +L+ L + AL
Sbjct: 10  LGAALLSGCAIGPDYQRPGMDL-PSAWR-AESADAGMVAGEKWWTLFGDATLDALEEEAL 67

Query: 70  QQNLTILQATERINAAKENILSVRADLFPS---SYASISHRFI-----PNLKTNSTGQLD 121
             N  +  A   ++A++  +    + L PS     +S+  R       P ++      L 
Sbjct: 68  AANGDLATAMANVDASRAQLTVATSYLLPSITGQGSSVRQRGSERGQNPPVEGREVTDLH 127

Query: 122 -----SDWKIDLFGQ-RRHIESSLANL---DSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                + +++DL+G+ RR  E++ A L   ++AYA V   +L V+S++  SY   R    
Sbjct: 128 KASALASFELDLWGKYRRAHEAARAGLLGTEAAYATV---RLAVVSQVAQSYFGLRAADR 184

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
           ++ IA Q L   ++++++   +F  G TS+L   + +AE  S  + +  LE++       
Sbjct: 185 QLDIARQTLTSREESLKIREARFNSGLTSELDYRQAQAETASARASVRQLEQAVAAAETA 244

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIP-INIGIPADLIRNRPDIRYQEKKLADSVAK 291
           +S+LLG    + +    ++  + +     P I  G+PA L+  RPD+   E  L  + A 
Sbjct: 245 LSSLLGRSPRDIVERSPERGLDIETFAVPPQIPAGLPAGLLARRPDVARAEADLHYATAS 304

Query: 292 IGIAKSDLYPSLSLNG-----SIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           IG+AK+DL P++SL G     SI LT   S    +  WS+G    +P+ D G+  +NI  
Sbjct: 305 IGVAKADLLPAISLTGLMGYESIDLTRLVS--SSSGTWSYGASATMPLLDFGRTLANIDM 362

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
           A++  +     +++ V +A +E ++AL +  + +++V      V   ++S++L+ + Y  
Sbjct: 363 ADAKQRAALAAYEQAVRDAFRETQDALVANRKTRQVVDAQATQVAALERSLTLARLRYEN 422

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           G  S L++LD ER+  + +++L  A+R    + V +  ++G G+
Sbjct: 423 GYSSYLEVLDAERSLFQAQLNLVEARRNQLDAVVQVCKSLGGGW 466


>gi|120603937|ref|YP_968337.1| RND efflux system outer membrane lipoprotein [Desulfovibrio
           vulgaris DP4]
 gi|120564166|gb|ABM29910.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfovibrio vulgaris DP4]
          Length = 504

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 127/464 (27%), Positives = 235/464 (50%), Gaps = 30/464 (6%)

Query: 10  LFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIAL 69
           L   LL+GC +GP+Y +P M L P+ +    S +   +   KWW  F D +L+ L + AL
Sbjct: 10  LGAALLSGCAIGPDYQRPDMDL-PSAWR-AESADAGMVAGEKWWTLFGDATLDALEEEAL 67

Query: 70  QQNLTILQATERINAAKENILSVRADLFPS---SYASISHRFI-----PNLKTNSTGQLD 121
             N  +  A   ++A++  +    + L PS     +S+  R       P ++      L 
Sbjct: 68  AANGDLATAMANVDASRAQLTVATSYLLPSITGQGSSVRQRGSERGQNPPVEGREVTDLH 127

Query: 122 -----SDWKIDLFGQ-RRHIESSLANL---DSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                + +++DL+G+ RR  E++ A L   ++AYA V   +L V+S++  SY   R    
Sbjct: 128 KASALASFELDLWGKYRRAHEAARAGLLGTEAAYATV---RLAVVSQVAQSYFGLRAADR 184

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
           ++ IA Q L   ++++++   +F  G TS+L   + +AE  S  + +  LE++       
Sbjct: 185 QLDIARQTLTSREESLKIREARFNSGLTSELDYRQAQAETASARASVRQLEQAVAAAETA 244

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIP-INIGIPADLIRNRPDIRYQEKKLADSVAK 291
           +S+LLG    + +    ++  + +     P I  G+PA L+  RPD+   E  L  + A 
Sbjct: 245 LSSLLGRSPRDIVERSPERGLDIETFAVPPQIPAGLPAGLLARRPDVARAEADLHYATAS 304

Query: 292 IGIAKSDLYPSLSLNG-----SIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           IG+AK+DL P++SL G     SI LT   S    +  WS+G    +P+ D G+  +NI  
Sbjct: 305 IGVAKADLLPAISLTGLMGYESIDLTRLVS--SSSGTWSYGASATMPLLDFGRTLANIDM 362

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
           A++  +     +++ V +A +E ++AL +  + +++V      V   ++S++L+ + Y  
Sbjct: 363 ADAKQRAALAAYEQAVRDAFRETQDALVANRKTRQVVDAQATQVAALERSLTLARLRYEN 422

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           G  S L++LD ER+  + +++L  A+R    + V +  ++G G+
Sbjct: 423 GYSSYLEVLDAERSLFQAQLNLVEARRNQLDAVVQVCKSLGGGW 466


>gi|296389086|ref|ZP_06878561.1| Multidrug efflux outer membrane protein OprN precursor [Pseudomonas
           aeruginosa PAb1]
          Length = 472

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 134/461 (29%), Positives = 232/461 (50%), Gaps = 20/461 (4%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
            +FSL    L+ CTVGP+Y  P         +     +    ++L WW+ F+D +LN+LV
Sbjct: 16  GLFSLLA--LSACTVGPDYRTPDTAAAKIDATASKPYDRSRFESL-WWKQFDDPTLNQLV 72

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFP----SSYASISHRFIPNLKTNSTGQ-- 119
           + +L  N  +  A  R+ AA+     V  D FP     + A I     P +  +      
Sbjct: 73  EQSLSGNRDLRVAFARLRAARALRDDVANDRFPVVTSRASADIGKGQQPGVTEDRVNSER 132

Query: 120 ----LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
               LDS W++DLFG+ RR +ESS A  ++A A +   ++++I++L+ +Y   R  + R 
Sbjct: 133 YDLGLDSAWELDLFGRIRRQLESSDALSEAAEADLQQLQVSLIAELVDAYGQLRGAQLRE 192

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
            IA   L+  K++ +L+      G  ++L +++ +A + +  + +P L+       H I+
Sbjct: 193 KIALSNLENQKESRQLTEQLRDAGVGAELDVLRADARLAATAASVPQLQAEAERARHRIA 252

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
           TLLG    E    +   S    P +   + IG P +L+R RPDIR  E++LA S A +G+
Sbjct: 253 TLLGQRPEELTVDL---SPRDLPAITKALPIGDPGELLRRRPDIRAAERRLAASTADVGV 309

Query: 295 AKSDLYPSLSLNGSIALTHD-NSFPGYNTH--WSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           A +DL+P +SL+G +  T    S  G +    WS GP +    FD G +++ +R A++ A
Sbjct: 310 ATADLFPRVSLSGFLGFTAGRGSQIGSSAARAWSVGPSISWAAFDLGSVRARLRGAKADA 369

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
                ++++ VL A++E  NA +   + ++ +  L    E  + +   + I YR+G    
Sbjct: 370 DAALASYEQQVLLALEESANAFSDYGKRQERLVSLVRQSEASRAAAQQAAIRYREGTTDF 429

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           L +LD ER     E   + A+ +L +  V +Y ++G G+ P
Sbjct: 430 LVLLDAEREQLSAEDAQAQAEVELYRGIVAIYRSLGGGWQP 470


>gi|116050439|ref|YP_790742.1| multidrug efflux outer membrane protein OprN precursor [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|313107389|ref|ZP_07793580.1| multidrug efflux outer membrane protein OprN precursor [Pseudomonas
           aeruginosa 39016]
 gi|115585660|gb|ABJ11675.1| multidrug efflux outer membrane protein OprN precursor [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|310880082|gb|EFQ38676.1| multidrug efflux outer membrane protein OprN precursor [Pseudomonas
           aeruginosa 39016]
          Length = 472

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 134/461 (29%), Positives = 232/461 (50%), Gaps = 20/461 (4%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
            +FSL    L+ CTVGP+Y  P         +     +    ++L WW+ F+D +LN+LV
Sbjct: 16  GLFSLLA--LSACTVGPDYRTPDTAAAKIDATASKPYDRSRFESL-WWKQFDDPTLNQLV 72

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFP----SSYASISHRFIPNLKTNSTGQ-- 119
           + +L  N  +  A  R+ AA+     V  D FP     + A I     P +  +      
Sbjct: 73  EQSLSGNRDLRVAFARLRAARALRDDVANDRFPVVTSRASADIGKGQQPGVTEDRVNSER 132

Query: 120 ----LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
               LDS W++DLFG+ RR +ESS A  ++A A +   ++++I++L+ +Y   R  + R 
Sbjct: 133 YDLGLDSAWELDLFGRIRRQLESSDALSEAAEADLQQLQVSLIAELVDAYGQLRGAQLRE 192

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
            IA   L+  K++ +L+      G  ++L +++ +A + +  + +P L+       H I+
Sbjct: 193 KIALSNLENQKESRQLTEQLRDAGVGAELDVLRADARLAATAASVPQLQAEAERARHRIA 252

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
           TLLG    E    +   S    P +   + IG P +L+R RPDIR  E++LA S A +G+
Sbjct: 253 TLLGQRPEELTVDL---SPRDLPAITKALPIGDPGELLRRRPDIRAAERRLAASTADVGV 309

Query: 295 AKSDLYPSLSLNGSIALTHD-NSFPGYNTH--WSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           A +DL+P +SL+G +  T    S  G +    WS GP +    FD G +++ +R A++ A
Sbjct: 310 ATADLFPRVSLSGFLGFTAGRGSQIGSSAARAWSVGPSISWAAFDLGSVRARLRGAKADA 369

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
                ++++ VL A++E  NA +   + ++ +  L    E  + +   + I YR+G    
Sbjct: 370 DAALASYEQQVLLALEESANAFSDYGKRQERLVSLVRQSEASRAAAQQAAIRYREGTTDF 429

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           L +LD ER     E   + A+ +L +  V +Y ++G G+ P
Sbjct: 430 LVLLDAEREQLSAEDAQAQAEVELYRGIVAIYRSLGGGWQP 470


>gi|15597691|ref|NP_251185.1| Multidrug efflux outer membrane protein OprN precursor [Pseudomonas
           aeruginosa PAO1]
 gi|107101941|ref|ZP_01365859.1| hypothetical protein PaerPA_01002988 [Pseudomonas aeruginosa PACS2]
 gi|218891527|ref|YP_002440394.1| Multidrug efflux outer membrane protein OprN precursor [Pseudomonas
           aeruginosa LESB58]
 gi|254235493|ref|ZP_04928816.1| Multidrug efflux outer membrane protein OprN precursor [Pseudomonas
           aeruginosa C3719]
 gi|254240926|ref|ZP_04934248.1| Multidrug efflux outer membrane protein OprN precursor [Pseudomonas
           aeruginosa 2192]
 gi|9948547|gb|AAG05883.1|AE004676_15 Multidrug efflux outer membrane protein OprN precursor [Pseudomonas
           aeruginosa PAO1]
 gi|126167424|gb|EAZ52935.1| Multidrug efflux outer membrane protein OprN precursor [Pseudomonas
           aeruginosa C3719]
 gi|126194304|gb|EAZ58367.1| Multidrug efflux outer membrane protein OprN precursor [Pseudomonas
           aeruginosa 2192]
 gi|218771753|emb|CAW27527.1| Multidrug efflux outer membrane protein OprN precursor [Pseudomonas
           aeruginosa LESB58]
          Length = 472

 Score =  181 bits (458), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 134/461 (29%), Positives = 232/461 (50%), Gaps = 20/461 (4%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
            +FSL    L+ CTVGP+Y  P         +     +    ++L WW+ F+D +LN+LV
Sbjct: 16  GLFSLLA--LSACTVGPDYRTPDTAAAKIDATASKPYDRSRFESL-WWKQFDDPTLNQLV 72

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFP----SSYASISHRFIPNLKTNSTGQ-- 119
           + +L  N  +  A  R+ AA+     V  D FP     + A I     P +  +      
Sbjct: 73  EQSLSGNRDLRVAFARLRAARALRDDVANDRFPVVTSRASADIGKGQQPGVTEDRVNSER 132

Query: 120 ----LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
               LDS W++DLFG+ RR +ESS A  ++A A +   ++++I++L+ +Y   R  + R 
Sbjct: 133 YDLGLDSAWELDLFGRIRRQLESSDALSEAAEADLQQLQVSLIAELVDAYGQLRGAQLRE 192

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
            IA   L+  K++ +L+      G  ++L +++ +A + +  + +P L+       H I+
Sbjct: 193 KIALSNLENQKESRQLTEQLRDAGVGAELDVLRADARLAATAASVPQLQAEAERARHRIA 252

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
           TLLG    E    +   S    P +   + IG P +L+R RPDIR  E++LA S A +G+
Sbjct: 253 TLLGQRPEELTVDL---SPRDLPAITKALPIGDPGELLRRRPDIRAAERRLAASTADVGV 309

Query: 295 AKSDLYPSLSLNGSIALTHD-NSFPGYNTH--WSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           A +DL+P +SL+G +  T    S  G +    WS GP +    FD G +++ +R A++ A
Sbjct: 310 ATADLFPRVSLSGFLGFTAGRGSQIGSSAARAWSVGPSISWAAFDLGSVRARLRGAKADA 369

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
                ++++ VL A++E  NA +   + ++ +  L    E  + +   + I YR+G    
Sbjct: 370 DAALASYEQQVLLALEESANAFSDYGKRQERLVSLVRQSEASRAAAQQAAIRYREGTTDF 429

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           L +LD ER     E   + A+ +L +  V +Y ++G G+ P
Sbjct: 430 LVLLDAEREQLSAEDAQAQAEVELYRGIVAIYRSLGGGWQP 470


>gi|302343867|ref|YP_003808396.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfarculus baarsii DSM 2075]
 gi|301640480|gb|ADK85802.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfarculus baarsii DSM 2075]
          Length = 495

 Score =  181 bits (458), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 124/453 (27%), Positives = 231/453 (50%), Gaps = 24/453 (5%)

Query: 17  GC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL---KWWESFNDTSLNKLVKIALQQN 72
           GC  VGP+Y  P     P  + + + K  +  D     +WWE F D  LN+L+  A Q N
Sbjct: 25  GCLKVGPDYKTPETKT-PASWDLPDDK-FLKPDPAAIQRWWEVFGDPQLNELIVRAGQSN 82

Query: 73  LTILQATERINAAKENILSVRADLFPSSYASISHRF--------IPNLKTNSTGQLDSD- 123
           L +  A  R+  A  NI  VR ++ P+  AS S+           P   T    Q+ ++ 
Sbjct: 83  LDLRTAHARVKEAWANIGVVRGEIMPALSASGSYARQRGSEYAPTPGGVTFDNYQIGANA 142

Query: 124 -WKIDLFGQ-RRHIESSLANLDSAYA-QVDIAKLNVISKLIPSYIDARHFKERISIAHQI 180
            W+IDLFG+  R IE++ A+  ++   +VD+  +++ +++  +Y   R  + +++  ++ 
Sbjct: 143 SWEIDLFGRISRSIEAATADYQASEEDRVDV-MVSLYAQVATTYFTIRATQAQLAATNEN 201

Query: 181 LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP 240
           +   K+ + L+  +F  G  + L + + E  + S ++++P L+ +       +  LLG P
Sbjct: 202 IQSQKQVLALTQSRFRNGLANDLDVSQAETVLASTQAEVPPLKITLAKAYSAMDLLLGQP 261

Query: 241 ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLY 300
                  + +     QP   +   +G PAD++R RPDIR  E++LA + A++G   + LY
Sbjct: 262 PGASAKLLGEVEPIAQPPRMV--AVGAPADILRQRPDIRRAERQLAAATARVGQDTARLY 319

Query: 301 PSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYIT 357
           PS SL G+I L   N+   F   +  +S GP+    +F  G I++ I+  ++  ++  + 
Sbjct: 320 PSFSLLGNIGLASTNASDLFRSGSYLFSLGPQFNWNVFQGGAIRAQIQVRDAQTEQALLN 379

Query: 358 WQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDI 417
           +++TVL+A+KE ++A T+  +    V  L   V   ++++ L +  Y++G      +LD 
Sbjct: 380 YEQTVLSALKEAQDAQTAYVQQLARVEHLARTVSASRRTLKLGLELYKEGLTDFQSVLDA 439

Query: 418 ERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +R   + +  L+ A+ + A + V LY A+G G+
Sbjct: 440 QRTLFQYDNQLAQARGEAAGNLVGLYKALGGGW 472


>gi|70733651|ref|YP_257291.1| outer membrane efflux protein [Pseudomonas fluorescens Pf-5]
 gi|68347950|gb|AAY95556.1| outer membrane efflux protein [Pseudomonas fluorescens Pf-5]
          Length = 493

 Score =  181 bits (458), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 120/460 (26%), Positives = 224/460 (48%), Gaps = 32/460 (6%)

Query: 18  CTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL---KWWESFNDTSLNKLVKIALQQNLT 74
           C VGP++ +P    +    +   +     +D+    +WWE FND  L+ L    L  NL 
Sbjct: 28  CNVGPDFRRPQATQVQAWSAPAQAAASQAVDSAMQERWWEVFNDPQLSALSHRVLSDNLD 87

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLD------------- 121
           +  AT R+  ++     + A+ +PS+ A+  +      K NS   L+             
Sbjct: 88  LQLATSRLQQSRAARQVITAERYPSTSANGGY----GRKRNSAEGLNDPSGNNGKSAFNL 143

Query: 122 ------SDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
                 + W++D +G+ RR  E++ A L+ A        L+V+++    YI  R  +   
Sbjct: 144 WEAGFSASWELDFWGRVRRETEAADATLEVAENDRRGVLLSVLAETAQDYIQLRGVQSTR 203

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
           ++  Q L++ + +++LS L+   G  + L + +  A++ +IE+ +P L++     ++ +S
Sbjct: 204 AVTEQNLEVARHSLKLSQLRLADGVATDLDVAEAAAQVATIEAQLPELQQRQAQLINALS 263

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
            LLG P  + LH  +  S+   P     + IG+P+ L   RPDIR  E +L  + A IG+
Sbjct: 264 LLLGEP-PQALH-QELASDAPVPQPPSQVAIGLPSQLAERRPDIRQAEARLHAATASIGV 321

Query: 295 AKSDLYPSLSLNG---SIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           AK D YP ++L+G   S AL   +     +  +  GP+  LP+FD G+++  ++  E+  
Sbjct: 322 AKGDFYPRITLSGNFGSQALQLADFGSWSSRQFGIGPQFSLPLFDGGRLRGMLQLREAQQ 381

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           QE  + +Q+TVL A  E+++ LT  N  +     L  AV  ++ ++  +   Y +G    
Sbjct: 382 QEAALAYQQTVLRAWHEIDDQLTRYNASQLRRDSLAEAVRQNQIALRTAQQQYIEGVVDF 441

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +++L ++ A    +  L  +   ++ + V LY A+G G+ 
Sbjct: 442 VNVLTVQGALLATQEQLVESSAGVSLAMVGLYKALGGGWQ 481


>gi|310767124|gb|ADP12074.1| RND efflux system, outer membrane lipoprotein, NodT [Erwinia sp.
           Ejp617]
          Length = 515

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 125/478 (26%), Positives = 238/478 (49%), Gaps = 46/478 (9%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQF----SIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQ 70
           L+GC +GP+Y  P  P +P  F    +   +K L +     WW++FND  L+ L++ A+Q
Sbjct: 22  LSGCVLGPDYQPPR-PAMPEVFNSMQAQQGAKPLASATRADWWKAFNDPQLDSLIERAVQ 80

Query: 71  QNLTILQATERINAAKENILSVRADLFPS--SYASISHRFI------------------- 109
            NL++ QA  RI  A++ +   R    PS    A  S + +                   
Sbjct: 81  GNLSLQQAVLRIAGARQQLNQARGAWAPSLSGNARFSRQQLGVKGELESQGIDDRLNGVD 140

Query: 110 ------PNLKTNS------TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNV 156
                 P L +         G  D+ W++DL+G+ RR +E + A    +  + + A +++
Sbjct: 141 NADSVRPALDSLEKPIGLYQGSFDASWELDLWGKVRRQVEMADARQQQSVEERNDALVSL 200

Query: 157 ISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE 216
            +++  +Y+  R  +         +D+ ++ + L+  +   G   + ++    A++ S+ 
Sbjct: 201 EAEVARAYLQLRGAQAITQTIETQIDVAQQTLVLTQSQQHNGLAPQTNVENARAQLSSLR 260

Query: 217 SDIPTLEKSFRMNVHNISTLLG-YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNR 275
           + +P  +      ++ ++ L G  P         +++    P L   +++G+P+ L R R
Sbjct: 261 AQLPQYQAQIHQAMNGLAVLTGQVPGALDAELTPRKA---LPVLPPAVSVGVPSVLARRR 317

Query: 276 PDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS--FPGYNTH-WSFGPKLYL 332
           PD+R  E  L  + A IG++ + L+PSLSL+G   + + ++     +++H +SFGP + L
Sbjct: 318 PDVRAAEASLHAATASIGVSVAQLFPSLSLSGQFGMRNSDASYLDNWSSHFYSFGPSVTL 377

Query: 333 PIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVEL 392
           PIF  G++ S+++ A +      + +++TVL A+++VENAL S   D++ VT L  +V+ 
Sbjct: 378 PIFQGGRLVSSVKLARAQQASAALQYRQTVLTALQDVENALVSYRSDRQQVTGLDESVQA 437

Query: 393 HKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            + + +L+   YRQG  S ++ LD +R  A+V+     A+ Q     V LY A+G G+
Sbjct: 438 LQNAFNLASDGYRQGLSSFIEPLDAQRQLAQVQQQAEQARVQSRLDLVALYKALGGGW 495


>gi|91778867|ref|YP_554075.1| RND efflux system outer membrane lipoprotein [Burkholderia
           xenovorans LB400]
 gi|91691527|gb|ABE34725.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia xenovorans LB400]
          Length = 486

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 118/460 (25%), Positives = 216/460 (46%), Gaps = 27/460 (5%)

Query: 11  FIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQ 70
             + L+GC +GP+Y +P +   P  F   +S     +DT  WW  F D  LN+L+  AL 
Sbjct: 16  LCLCLSGCLMGPDYVRPSVET-PATFRFSDSTQAQIVDT-AWWAQFGDPVLNELISTALA 73

Query: 71  QNLTILQATERINAAKENILSVRADLFP---SSYASISHRFIPNLKTNSTGQLDSD---- 123
           QN  +  A  R++  +   ++ R+ LFP   + + +   R  P  +++    + +D    
Sbjct: 74  QNRDLKIAAARVDEFRGQFVTTRSQLFPQISAGFNAGRQRVSPLAQSSLPAGIGTDYTSF 133

Query: 124 -------WKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERIS 175
                  W+ID+FG+ RR  E++ ANL ++        L +++ +  SYI+ R   +++ 
Sbjct: 134 NATLPISWEIDVFGRVRRQTEAARANLLASEEGQRATLLTLVASVATSYINLRSLDQQLE 193

Query: 176 IAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIST 235
           IA         ++++  L+F  G  S++ L + ++E ++  +DIP +E         +S 
Sbjct: 194 IARATAASRASSVKVFELRFKGGQISQVELAQSQSEYEASLADIPAIEAQIGQQEDALSV 253

Query: 236 LLGYPATEFLHYMQKQSNNFQPNLYIP-INIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
           LLG      L             L  P +  G+P++L+  RPD+   E+ L  + A IG 
Sbjct: 254 LLGRNPGPILR------GRTLDELQAPGVPAGLPSELLARRPDVLQAEQNLVAANALIGA 307

Query: 295 AKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           A++  +P +SL G +  +       F G    W+F   L  PIF  G I   + +A++  
Sbjct: 308 ARALYFPQISLTGLLGSSSTQLSRLFSGPANTWAFAGALTQPIFSAGNIAGQVEQAKARQ 367

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           Q+    +Q+ V +A +EV +AL  + + ++ +   +  V+       L+   Y  G  S 
Sbjct: 368 QQALYAYQKAVQSAFQEVSDALLGVGKSRERLAAQERQVDALSTYAKLARQRYEGGYTSY 427

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +++LD ER+    ++  +  +     S V LY A+G G+ 
Sbjct: 428 MEVLDAERSLFSAQLAYTQTRGNEYTSLVTLYKALGGGWG 467


>gi|227327455|ref|ZP_03831479.1| putative outer membrane efflux lipoprotein [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 500

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 134/483 (27%), Positives = 236/483 (48%), Gaps = 49/483 (10%)

Query: 14  LLAGCTVGPEYTKPHMPLLPTQFS------------------IGNSKNLINI-DTLKWWE 54
           L+AGC VGP+Y +P  PL P ++                   +  S N     D   WWE
Sbjct: 15  LMAGCAVGPDYHRPDAPL-PARYQAQSAAERSVSKQPVSKQPVTTSGNAAQAADVAVWWE 73

Query: 55  SFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSS-YASISHRFIPNLK 113
           SFND  L++LV  AL QNL + QA+ R+N A+  + +  A L PS   +    R   +++
Sbjct: 74  SFNDPLLSQLVSSALAQNLDLAQASARMNQAQAGLGAATAALLPSGNISGQGARAYQSVE 133

Query: 114 TNSTGQL------------------DSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKL 154
           T S GQL                  ++ W++D+FG  RR  +++LA+  ++ A V   +L
Sbjct: 134 T-SQGQLLNAVPGYSRYGNAYEADLNASWELDVFGGLRRGRQAALADYQASEAGVAATRL 192

Query: 155 NVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKS 214
            V ++    YI  R  + R++IA + ++  ++ ++   L  ++G  ++  + + E  +  
Sbjct: 193 AVAAQTADIYITLRGLQTRLAIATRQVNTQQQLLDKVQLLHSKGLAAEYQIRQTEGTLSQ 252

Query: 215 IESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRN 274
           +++++P L+      ++ +  +LG P     H  Q  ++   P     I  G PADL+R 
Sbjct: 253 VQANVPVLQTGIDAAMNALDVMLGTP--PGTHRAQLSTSQAIPQSPTLIATGTPADLLRR 310

Query: 275 RPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNG----SIALTHDNSFPGYNTHWSFGPKL 330
           RPDI   E+ LA S A+IG+A S+ YP  SL+     + +++  N F    +  +    L
Sbjct: 311 RPDIIVAERHLAASNARIGVAISEYYPKFSLSALLGSATSVSSGNLFSNGASQSAGVLGL 370

Query: 331 YLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTS-INEDKKIVTKLQHA 389
              +FD G+I + I +A+    E    ++ +VL A ++VENA ++ +N + +  T     
Sbjct: 371 RWRLFDFGRINAQIDQAKGQEAEALAAYRLSVLRATEDVENAFSALVNRETQATTLTAGE 430

Query: 390 VELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
             L     S S I Y++G  SL+D+L  +    +     + A+ + A++ V  + A+G G
Sbjct: 431 TSLASARQS-SFIAYQKGTSSLIDVLHADETLLQTSDARAQAQTESARAAVATFKALGGG 489

Query: 450 YNP 452
           + P
Sbjct: 490 WQP 492


>gi|226946648|ref|YP_002801721.1| Outer membrane protein [Azotobacter vinelandii DJ]
 gi|226721575|gb|ACO80746.1| Outer membrane protein [Azotobacter vinelandii DJ]
          Length = 479

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 121/465 (26%), Positives = 229/465 (49%), Gaps = 35/465 (7%)

Query: 15  LAGCTV-GPEYTKPHMPL-----LPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIA 68
           L GC++ GP++  P          P +  + +   L  +D  +WW+ F+D  L+ L + A
Sbjct: 14  LGGCSMLGPDFVAPDRGAEERWERPAEPGVYSRPTLQPLDP-QWWKLFDDPLLSSLQERA 72

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQ--------- 119
           +  NL +  A+ R+  ++    ++  +  P   A+    F+   + +++G+         
Sbjct: 73  MAGNLDLRTASARLRQSRAIFQTLSGEALPEVGANA---FVQRQRNSNSGRVDQSGREGK 129

Query: 120 ---------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                    LD+ W++D +G+  R IES+ A+++++        + +++     YI  R 
Sbjct: 130 EAYNHGYASLDATWEMDFWGRVGRQIESAEASVEASEELRRSVLVLILADTASHYIRLRG 189

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIP-TLEKSFRM 228
            +   ++    L++ ++N+EL+ ++F  G  ++L + + EAE+ ++E+ +P T E+  R+
Sbjct: 190 EQAFEAVIRDNLEIARRNLELTGIRFDNGVATRLEVAQAEAEVATVEARLPATRERQARL 249

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
            ++ +S LLG         +Q   +   P   +P+  G+P++L   RPDIR  E +L  +
Sbjct: 250 -INALSFLLGAGPNALRAELQASRDIPVPPKAVPL--GLPSELALRRPDIRAAEARLHAA 306

Query: 289 VAKIGIAKSDLYPSLSLNGSIALTHDNSFP--GYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
            A IG+A++D YP ++LNG          P    N  +  G  LYLPIF+ G++K  +  
Sbjct: 307 TASIGVAQADFYPRITLNGGFGFESSQFLPFEWQNRLFLLGSSLYLPIFEGGRLKGRLAL 366

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
            E+  QE  + ++ TVL A  EV++ALT     ++   KL  AV  +++ +  +   Y  
Sbjct: 367 REAEQQEAAVAYRHTVLKAWHEVDDALTDYGTRQQRRVKLNEAVRQNEEVLGNARQQYLA 426

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           G    L++L  +R    VE     +   +A   VDLY A+G G+ 
Sbjct: 427 GTVDFLNVLGAQRELLSVEEQRVRSDEAVALGIVDLYRALGGGWE 471


>gi|282891183|ref|ZP_06299686.1| hypothetical protein pah_c048o007 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281498876|gb|EFB41192.1| hypothetical protein pah_c048o007 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 472

 Score =  180 bits (457), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 125/439 (28%), Positives = 228/439 (51%), Gaps = 41/439 (9%)

Query: 50  LKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH--- 106
            +WWE F D  L + +++A   N  I  A   +  A+   +   A LFP   A  +    
Sbjct: 28  CEWWEVFEDPLLIEYIRMAALHNNDIRVAEANVCRARATRMVAAAPLFPQLSADFNGSRT 87

Query: 107 ---------------------------RF---IPNLKTNSTGQLDSDWKIDLFGQ-RRHI 135
                                      +F   +P  +T     LD  W++DLFG+ RR++
Sbjct: 88  MFSKNGPLFQIPAPNAPTTPGATTPNAQFTIQVPQFQTLYNATLDMTWELDLFGKTRRNV 147

Query: 136 ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKF 195
           ES+ A + ++  Q++   ++V +++  +Y++AR  +E+IS+  + +++ +K+ ++   + 
Sbjct: 148 ESADAKVSASIEQMNDRLISVFAEVARNYLEARTAQEKISLTKENINVLEKSADIIGRRV 207

Query: 196 TQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG-YPATEFLHYMQKQSNN 254
             G +++L L ++EAE+  + + IP  E     +++ +S L G  P T     +  +S  
Sbjct: 208 KAGLSNQLDLERIEAEVAQVYATIPNFEALLFQSIYALSVLTGNLPETLVAELLPYRS-- 265

Query: 255 FQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSL---NGSIAL 311
             P +   ++IGI +D++R RPDIR  E++LA + A IG+A ++ +P++SL    G  +L
Sbjct: 266 -LPPIPSEVSIGIRSDILRRRPDIRAAERQLASATADIGVAVANFFPTISLFGDEGFQSL 324

Query: 312 THDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVEN 371
              N F G +  WS+G  + LPIF  GK+  N+R AE+SA     T+++TVL A++E E+
Sbjct: 325 MFSNLFQGASNTWSYGGDINLPIFQGGKLVGNLRVAEASATAAAYTYRQTVLQALQETES 384

Query: 372 ALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIA 431
           ++ +  ED K + +   +V  ++K + LS   Y +G  S+ D+LD ER    ++ +   A
Sbjct: 385 SMVTFLEDLKTMRRYGDSVGRNEKIVQLSNERYVKGLVSITDLLDSERQLISIQQNRLDA 444

Query: 432 KRQLAKSYVDLYIAIGSGY 450
           +       V LY A+G G+
Sbjct: 445 ESAALLDLVRLYKALGGGW 463


>gi|21241209|ref|NP_640791.1| outer membrane protein [Xanthomonas axonopodis pv. citri str. 306]
 gi|21106520|gb|AAM35327.1| outer membrane protein [Xanthomonas axonopodis pv. citri str. 306]
          Length = 503

 Score =  180 bits (457), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 125/446 (28%), Positives = 217/446 (48%), Gaps = 30/446 (6%)

Query: 1   MNILRAIFSLFIV-LLAGCTVGPEYTKPHMPLLP----TQFSIGNSKNLINIDTLKWWES 55
           M+ LR + +L +  L+ GC VGP+Y +P  PL P     Q  +   +  +  +   W + 
Sbjct: 1   MSSLRTLAALVVASLVTGCAVGPDYARPEAPL-PDRYIGQADVAQRQAAVPTELSTWRDG 59

Query: 56  FNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH-RFIPNLKT 114
           FND  L++ V  AL QNL + QA  R++ A+  + +  A L P+   S S  R   +L+T
Sbjct: 60  FNDPDLSRYVNAALAQNLDLAQAGARVDPARAGLSAATAALLPAGNVSGSATRAYQSLET 119

Query: 115 ------NSTGQLD-----------SDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNV 156
                 NST   D           + W++DLFG  RR  +++LA+  +  A V   +L V
Sbjct: 120 PLGQVLNSTPNFDRHASVYEANLGASWELDLFGGLRRGRQAALADYQATEAGVAATRLAV 179

Query: 157 ISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE 216
            ++    YI  R  + R+ +A + +   +  + +  L   +G  ++L L + +  +   +
Sbjct: 180 AAQTADIYIGVRGLQARLDVAQRQVATQQGLLSMVTLLHGKGLAAELQLQQAQGALAQAQ 239

Query: 217 SDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRP 276
           + +P LE      ++ +  +LG P       +        P   I  + G P DL+R RP
Sbjct: 240 AGVPGLEAGLVAAMNALDAMLGVPPGTHRAELSAAIKPIPPAPQI-ADSGAPGDLLRRRP 298

Query: 277 DIRYQEKKLADSVAKIGIAKSDLYPSLSLNG----SIALTHDNSFPGYNTHWSFGPKLYL 332
           D+   E++LA S A+IG+A ++ YP  SL+G    + A++  N F G     S    L  
Sbjct: 299 DLIVAERRLAASNARIGVAMAEYYPKFSLSGLLGSATAISGANLFTGDAAQSSGVLGLRW 358

Query: 333 PIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVEL 392
            +FD G+I + I +A+    EQ   ++  VL A ++VENA T++ + ++    L   V+ 
Sbjct: 359 RLFDFGRINAQIAQAKGQQAEQLAAYRLAVLRATEDVENAFTALIKREQQAVVLTQGVDA 418

Query: 393 HKKSMSLSMINYRQGRYSLLDILDIE 418
             K+   S + Y +G  SL+++L+ +
Sbjct: 419 LGKARGASALAYEKGTVSLIEVLNAD 444


>gi|114320563|ref|YP_742246.1| RND efflux system outer membrane lipoprotein [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|114226957|gb|ABI56756.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Alkalilimnicola ehrlichii MLHE-1]
          Length = 488

 Score =  180 bits (457), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 126/479 (26%), Positives = 241/479 (50%), Gaps = 41/479 (8%)

Query: 5   RAIFSLFIVL-LAGCTVGPEYTKPHMPL---LPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           +AI +L  VL LAGC VGP+Y  P M L    P    + + +    +D   WW+ F+D +
Sbjct: 3   KAITALAAVLILAGCAVGPDYQAPEMDLPEAWPESSLLADGERAAWVD---WWKRFDDPT 59

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS-----------SYASISHRFI 109
           LN+LV+ A+  NL I     R+  A+  +    A+  P+             A++   F 
Sbjct: 60  LNQLVERAVANNLDIRLQAARLEEARARLGMASAEQLPTVDLQAEAARERGPATLQPAFP 119

Query: 110 ---PNLKTNS----TGQLDSDWKIDLFG----QRRHIESSLANLDSAYAQVDIAKLNVIS 158
              P  +T++    +G L   ++IDLFG    +R   E+ L  L++ ++Q D  +LN+I+
Sbjct: 120 GVEPRARTDNLFSVSGVLG--YEIDLFGRLAREREAAEAFL--LENVFSQ-DAVRLNLIA 174

Query: 159 KLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESD 218
            ++ +Y D R  +++++I    L   ++   L  +++  G T +L+L + EAE++S  ++
Sbjct: 175 DVVTTYFDLRAAQQQLAITENTLVSREETYALERVRYEAGETDELTLRQAEAELQSTRAE 234

Query: 219 IPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQP--NLYIPINI--GIPADLIRN 274
           IP  ++        +  L+G    E +   +     + P   +++P ++   +P++L+  
Sbjct: 235 IPLRQEQVSTLEGVLGVLVGMSPAELMTLDEMDLGEYTPLEAIHLPEDLPATLPSELLER 294

Query: 275 RPDIRYQEKKLADSVAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLY 331
           RPD+R  E +L  + A IG+A+++  P L+L    G+ A    + F G    W  G  + 
Sbjct: 295 RPDVRAAEAELMAATAAIGVAQAERLPRLNLTALLGTAATDTSDLFTGAAETWGLGSSVA 354

Query: 332 LPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVE 391
            P+FD G+ ++ +  AE+ A +    +Q TV++A  EV +AL+      +    ++  V 
Sbjct: 355 GPLFDFGRGRAGVEAAEAMAAQSRARYQATVISAFNEVRDALSLYRTSSQRAQAIRAQVA 414

Query: 392 LHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             +++  L+ + Y++G    +++LD +R+    E+ L+ A R    +   L+ A+G G+
Sbjct: 415 AVERTSQLAELRYQEGFIGFIEVLDAQRSLLAAELALAEAVRDQLNATATLFKALGGGW 473


>gi|172062825|ref|YP_001810476.1| RND efflux system outer membrane lipoprotein [Burkholderia
           ambifaria MC40-6]
 gi|171995342|gb|ACB66260.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia ambifaria MC40-6]
          Length = 495

 Score =  180 bits (457), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 123/478 (25%), Positives = 223/478 (46%), Gaps = 44/478 (9%)

Query: 13  VLLAGCTVGPEY-TKPHMPLLPT---QFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIA 68
            LLAGCTVGP+Y   P  P  PT     + G   N        WW +  D  L+ L+  A
Sbjct: 19  CLLAGCTVGPDYRGAPAAPDAPTFVRAPATGVDSNTPAPSA--WWHALGDRQLDDLIAAA 76

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPSSYASIS------------HRFIPNLKTNS 116
           L  N  +  A  R+ A++  +   RA   P S A+++               +P   +N 
Sbjct: 77  LAHNPDLQAAQARLRASRAQLSQRRAAQLPKSSATVAAIRAREPDVSALGSLLPPGNSNQ 136

Query: 117 T-----------------GQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVIS 158
           +                    D+ W+IDLFG  RR +E++ A  ++  A +   ++++ +
Sbjct: 137 SDGSSPSLGGSGPLQLYSASFDATWEIDLFGGTRRAVEAASAQAEAVDADLADTQVSIAA 196

Query: 159 KLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESD 218
           ++  +Y+D R  ++R++++ +  +L ++ +EL+  +  +G  + + + +L  ++++  + 
Sbjct: 197 EVATAYVDLRDQQQRLALSQRTAELQQQMLELTQQRRARGVAADVDIERLTTQVETTRAS 256

Query: 219 IPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDI 278
           +  L+     ++  ++ L G  A   L      S    P L   + +G PA L++ RPDI
Sbjct: 257 VIPLDAQVTESLDRLAILTGR-APGALDAALSASGAPLPTLPGSVPVGDPAALLKQRPDI 315

Query: 279 RYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGY-----NTHWSFGPKLYLP 333
           R  E++LA S A+IG   +D +P ++L G +  +  +  PG+     N  W   P L   
Sbjct: 316 RAAERRLASSNAQIGEHIADYFPKVTLLGDLGFSATD--PGHLFRKQNFTWVGAPYLQWN 373

Query: 334 IFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELH 393
           I D G+ +  IR AE+S  E    +++ VL A+++   AL      ++ V  L       
Sbjct: 374 ILDFGRTRGAIRAAEASRDEAEANYRKAVLGALQDANTALQRYGHQREHVVALTKVQTSA 433

Query: 394 KKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             S +L    YR G  S++D+LD +R     + ++   K +L K YV L  ++G G+ 
Sbjct: 434 THSATLMDQRYRAGVASIIDLLDTQREALAAQQNVIAGKAELVKDYVSLQKSLGLGWQ 491


>gi|296155956|ref|ZP_06838795.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. Ch1-1]
 gi|295893462|gb|EFG73241.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. Ch1-1]
          Length = 486

 Score =  180 bits (456), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 118/460 (25%), Positives = 214/460 (46%), Gaps = 27/460 (5%)

Query: 11  FIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQ 70
             + L+GC +GP+Y +P +   P  F   +S     +DT  WW  F D  LN+L+  AL 
Sbjct: 16  LCLCLSGCLMGPDYVRPSIET-PATFRFSDSTQAQIVDT-AWWAQFGDPVLNELISTALA 73

Query: 71  QNLTILQATERINAAKENILSVRADLFP---SSYASISHRFIPNLKTNSTGQLDSD---- 123
           QN  +  A  R++  +   ++ R+ LFP   + + +   R  P  +++    + +D    
Sbjct: 74  QNRDLKIAAARVDEFRGQFVTTRSQLFPQISAGFNAGRQRVSPLAQSSLPAGIGTDYTSF 133

Query: 124 -------WKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERIS 175
                  W+ID FG+ RR  E++ ANL ++        L +++ +  SYI+ R   +++ 
Sbjct: 134 NATLPISWEIDAFGRVRRQTEAARANLLASEEGQRATLLTLVASVATSYINLRSLDQQLE 193

Query: 176 IAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIST 235
           IA         ++++  L+F  G  S++ L + ++E ++  +DIP +E         +S 
Sbjct: 194 IARATAASRAGSVKVFELRFKGGQISQVELAQSQSEYEASLADIPAIEAQIGQQEDALSV 253

Query: 236 LLGYPATEFLHYMQKQSNNFQPNLYIP-INIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
           LLG      L             L  P +  G+P++L+  RPD+   E+ L  + A IG 
Sbjct: 254 LLGRNPGPILR------GRTLDELQSPSVPAGLPSELLARRPDVLQAEQNLVAANALIGA 307

Query: 295 AKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           A++  +P +SL G +  +       F G    W+F   L  PIF  G I   + +A++  
Sbjct: 308 ARALYFPQISLTGLLGSSSTQLSRLFSGPANTWAFAGALTQPIFSAGNIAGQVEQAQARQ 367

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           Q+    +Q+ V +A +EV +AL  + +  + +   +  V+       L+   Y  G  S 
Sbjct: 368 QQTLYAYQKAVQSAFQEVSDALLGVGKSCERLVAQERQVDALNAYARLARQRYEGGYTSY 427

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +++LD ER+    ++  +  +     S V LY A+G G+ 
Sbjct: 428 MEVLDAERSLFSAQLAYAQTRGNEYTSLVTLYKALGGGWG 467


>gi|94497417|ref|ZP_01303987.1| RND efflux system outer membrane lipoprotein NodT [Sphingomonas sp.
           SKA58]
 gi|94423048|gb|EAT08079.1| RND efflux system outer membrane lipoprotein NodT [Sphingomonas sp.
           SKA58]
          Length = 506

 Score =  180 bits (456), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 124/474 (26%), Positives = 233/474 (49%), Gaps = 35/474 (7%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLL--PTQFSIGNSKNLINIDTLKWWESFNDTSLNK 63
           A  S   + L+ C  GP+Y  P +  L  P  +S G+   L      +WW   ND +L+ 
Sbjct: 29  AWISGTALTLSACAAGPDYRAPQIGALGVPAAYSAGDGAALSEAQLGQWWTRLNDPALSA 88

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFP--SSYASISHRFIPNLKTNSTGQLD 121
           L+  A+  NL ++QA  R+  A+E+++   A L P  S  A+    +      ++ G+LD
Sbjct: 89  LIDQAVANNLDVVQAQARLRQARESLIQSNASLLPQLSGSATGGRNYS---SQDAGGRLD 145

Query: 122 ----------------------SDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVIS 158
                                 + W++DLFG+ RR  E++ A+L+++   +   ++ VIS
Sbjct: 146 ANGNPIGGGGGNWSSSYSARINASWQLDLFGELRRGREAARADLEASGFDLATVRMTVIS 205

Query: 159 KLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESD 218
           +L+ +Y+ AR  + ++ +A +   + + N +++  +   G  S L   +  A++    + 
Sbjct: 206 ELVNNYVQARLAQAQLKVARETQAVQRDNYQIASWRLQAGLVSSLDEQQARAQLAQTNAT 265

Query: 219 IPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDI 278
           IP LE S + +++ I+ L G    +    ++  +   QP+    I  GIPAD +R RPD+
Sbjct: 266 IPQLEASLKGSLNRIAVLTGQAPGDATRTLETPAPIPQPS--TDIATGIPADTLRQRPDV 323

Query: 279 RYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFG--PKLYLPIFD 336
           R  E+ LA + A+IG+A++ LYPSL ++G+I  T  N+F       + G    +   IFD
Sbjct: 324 RSAERALAAATARIGVAQAQLYPSLGISGNIGTTS-NAFSQLFELITGGVFANVAQTIFD 382

Query: 337 KGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKS 396
            G++ S +R  +++ +  +  +++ VL+A+++VENA+ S+   +    +   A +    +
Sbjct: 383 GGRLASQVRAQKAATEAAFAAYKQNVLSALEDVENAMASLTSARARKAEFAIAYDASNNA 442

Query: 397 MSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             L+   Y+ G      + + E         L+ A+   A +   LY A+G G+
Sbjct: 443 AILARSQYQAGLIDFQTLSNSENTLLNARNSLASAQADEALAIAQLYNALGGGW 496


>gi|301061715|ref|ZP_07202456.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [delta proteobacterium NaphS2]
 gi|300444175|gb|EFK08199.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [delta proteobacterium NaphS2]
          Length = 498

 Score =  180 bits (456), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 129/465 (27%), Positives = 233/465 (50%), Gaps = 39/465 (8%)

Query: 16  AGCT-VGPEYTKPHMPLLPTQFSIGNSKNLINID--TLK-WWESFNDTSLNKLVKIALQQ 71
           +GC  VGP Y KP + + P  +    SK +      TL+ WW  F+D  LN L++ A Q 
Sbjct: 34  SGCAPVGPNYQKPEIKI-PDAWHEAISKEMARQPGATLQTWWRIFDDPVLNDLIEQARQS 92

Query: 72  NLTILQATERINAAKENILSVRADLFP-----SSYASISHRFIPNLKTNS-----TGQ-- 119
           NL I  A   I A++  +  V     P      S++   H      K  +      GQ  
Sbjct: 93  NLDIKIALSGIAASRARLGVVSGKELPNANVFGSFSRFKHSDQGPFKQMAPPGGFEGQNM 152

Query: 120 ----LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
               +D+ W++D+FG+ RR IE++ A  +++        + + +++   Y++ R  + RI
Sbjct: 153 FMVGVDALWEVDVFGRIRRQIEAAGAEYEASIEDYRDVMVTLFAEVALVYVEIRSCQRRI 212

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
             A     + KK +EL+  +F  G +SKL   +  + + + E+ +P L       ++ ++
Sbjct: 213 QCAEANAAIQKKMLELTRARFHSGISSKLDTAQATSNLANTEAAVPPLTIRLNTMINRLA 272

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPI-----NIGIPADLIRNRPDIRYQEKKLADSV 289
            LL          +Q++      ++ IPI      IG+PADL+R RPD+R  EK+LA   
Sbjct: 273 VLLDTNQ----ETLQRKLGG---SVSIPIAKENIGIGVPADLLRQRPDVRMAEKQLAAQT 325

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHDNSFP----GYNTHWSFGPKLYLPIFDKGKIKSNIR 345
           A+IG+A +DLYP  +++G   L    SF     G +  W     +    F  GK +SNI 
Sbjct: 326 ARIGVATADLYPRFTISGFFGL-ETGSFSDIGGGSSLAWGIRSPVKWNFFSGGKTRSNIT 384

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
             +  A+++ + +++TVL A++EV NA+ +  ++K    +L+ AVE  ++++ L ++ Y 
Sbjct: 385 FHKEIARQELLKYRDTVLKAMEEVRNAIVAHAQEKLRRNRLREAVEATREAVDLVIVQYE 444

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            G  +  ++LD +R+  + +  L +++  +  + + LY A+G G+
Sbjct: 445 TGLTNFNNVLDTQRSLFEQQDQLVVSEGDVVFNLIRLYKALGGGW 489


>gi|83649547|ref|YP_437982.1| outer membrane protein [Hahella chejuensis KCTC 2396]
 gi|83637590|gb|ABC33557.1| Outer membrane protein [Hahella chejuensis KCTC 2396]
          Length = 480

 Score =  180 bits (456), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 119/464 (25%), Positives = 224/464 (48%), Gaps = 27/464 (5%)

Query: 7   IFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK--WWESFNDTSLNK 63
           + S   + +AGC TVGP+Y  P  P    Q    N +   +   ++  WW  FND  + K
Sbjct: 8   LVSSLTLAMAGCMTVGPDYQAPEAP--AAQLQTFNQQQF-DFQRMEENWWGQFNDPRIEK 64

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFP-----SSYASISHRFIPNL------ 112
           LV +AL  N  I +A   + AA       R D FP     + Y++   +  P        
Sbjct: 65  LVDLALADNHDIAKARANVKAAYAAFDDSRDDRFPKGGVGAEYSASRAKSAPTFSDAAKV 124

Query: 113 -KTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
            + ++ G L   W +D FG+  R IE++ A   S+ A +   ++ +I++++  Y D R  
Sbjct: 125 EQYSAGGNLS--WNLDFFGRVTRLIEAAEAEALSSDAALRNVQVEIIAEVVRVYADLRGA 182

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           + ++ +A + L+  K  ++L+  K+  G  ++L +V+ +A+    ++ +  L+     + 
Sbjct: 183 QAQVQVAQRNLENLKSVVDLTEAKYKSGVGAELDVVRSKAQYAGAQATLAPLQARIARDE 242

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + ++ L G    +    +  Q     P +   + IG PA L+R RPD+R  E++LA + A
Sbjct: 243 YRLAVLTGAEPGKLAVDLSYQPI---PQVATTLAIGDPAALLRRRPDVRVAERRLASASA 299

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
           +IG+A +DL+P + + G +     +        +  WS  P L   +FD   +K+ +R A
Sbjct: 300 RIGVATADLFPKVEMTGFLGFISGSGSELLKSSSGAWSVAPTLNWAVFDWASLKARVRVA 359

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E+  +     +Q+TVL A+++ + +  + ++ +     LQ  VE   ++  ++   Y++G
Sbjct: 360 EAHNEAALEDYQQTVLRALEDAQLSFVNYHQSQLRYLHLQAQVESSARAQEIAQAQYKEG 419

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
              LL +LD ER     E     A+  + K  V++Y ++G G+ 
Sbjct: 420 FIDLLVLLDTERTRLAAEDAAMQAETDIMKGVVEIYRSLGGGWE 463


>gi|262278475|ref|ZP_06056260.1| RND efflux system outer membrane lipoprotein [Acinetobacter
           calcoaceticus RUH2202]
 gi|262258826|gb|EEY77559.1| RND efflux system outer membrane lipoprotein [Acinetobacter
           calcoaceticus RUH2202]
          Length = 478

 Score =  180 bits (456), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 129/472 (27%), Positives = 233/472 (49%), Gaps = 30/472 (6%)

Query: 7   IFSLFIVLLAGCTVGPEYTKPHMPLLPTQF---SIGNSKNLINIDTLKWWESFNDTSLNK 63
           +  +   +LA CTVGP Y +P + L P  +    + +  +    D   WW+SFND  L +
Sbjct: 8   LLPILTSILAACTVGPNYKRPSISL-PEHYLGARLNSPSDETKADIEVWWKSFNDPQLTR 66

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPSS---------YASISHRF------ 108
            V +AL+QNL + QA  R+  A+  + +V A L P           Y S+          
Sbjct: 67  YVTLALKQNLDLAQAYTRVTQAQAGLSAVNASLRPIGTVDAQAAKVYQSVETPLGQVLNS 126

Query: 109 IPNLKTNST---GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSY 164
           +PN   + +     L + W++D+FG  RR  ES+LAN  ++ A     +L V ++    Y
Sbjct: 127 MPNFDRHGSSYEANLSATWELDIFGGLRRDRESALANYQASNAGASAVRLMVAAQTANLY 186

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           I+ R  + R+ IA Q L   +K + +  L +++G  S+  + + +A +  +++ +P L  
Sbjct: 187 INIRGLQSRLDIAQQQLQTQQKLLSIIQLLYSKGLASEFQVKQAKANVAQVQAVVPALGM 246

Query: 225 SFRMNVHNISTLLG-YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +  + ++ +  +LG  P T      + +     PN+      G P+DL+R RPD+   E+
Sbjct: 247 NLDIAMNALDVMLGTVPGTHRAELAEVKPIPVIPNI---TETGTPSDLLRRRPDLIMAER 303

Query: 284 KLADSVAKIGIAKSDLYPSLSLNG---SIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKI 340
           +LA S A+IG A ++ YP +SL G   S      N F       +    L   +FD G+I
Sbjct: 304 QLAASNARIGSAIAEYYPKVSLGGLIGSATTASGNLFSSGANQAAGLLGLRWRLFDFGRI 363

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
            + IR A+    E+   +Q  VL+A ++VEN+L+++++ ++ +  LQ        +  ++
Sbjct: 364 NAEIRLAKGQEAEKLAAYQLAVLHAAEDVENSLSTLSKRQEQLVALQDGENALHHAQKIA 423

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           +I Y++G  S +++L  +  T +       A+   A + V +Y ++G G+ P
Sbjct: 424 LIAYQKGINSRIEVLQADSNTLQFTDKKVQAQTDSALAAVAVYKSLGGGWQP 475


>gi|78063040|ref|YP_372948.1| RND efflux system outer membrane lipoprotein [Burkholderia sp. 383]
 gi|77970925|gb|ABB12304.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. 383]
          Length = 495

 Score =  180 bits (456), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 128/480 (26%), Positives = 227/480 (47%), Gaps = 48/480 (10%)

Query: 13  VLLAGCTVGPEY-TKPHMPLLPTQFSIGNSKNLINIDTLK-----WWESFNDTSLNKLVK 66
            LLAGCTVGP+Y   P  P  PT      S      DT       WW + ND  L+ L+ 
Sbjct: 19  CLLAGCTVGPDYRGAPAAPDAPTFVRAPAS----GFDTAAPAPSAWWHALNDRQLDDLIT 74

Query: 67  IALQQNLTILQATERINAAKENILSVRA------------------------DLFPSSYA 102
            AL  N  +  A  R+ A++  +   RA                         L PS+ +
Sbjct: 75  AALAYNPDLHAAQARLRASRAQLSQQRAAQLPKSSATVAAIRMREPDVSALGSLLPSNGS 134

Query: 103 SISHRFIPNLKTNSTGQL-----DSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNV 156
           S S    P+L  +   QL     D+ W+IDLFG  RR +E++ A  ++  A +   ++++
Sbjct: 135 SQSGGTSPSLGGSGPLQLYSAGFDATWEIDLFGGTRRAVEAASAQAEAVDADLADTQVSI 194

Query: 157 ISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE 216
            +++  +Y+D R  ++R++++ +  +L ++ +EL+  +  +G  + + + +L  ++++  
Sbjct: 195 AAEVANAYVDLRDQQQRLALSQRTAELQQQMLELTQQRRVRGVAADVDIERLTTQVETTR 254

Query: 217 SDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRP 276
           + +  L+     ++  ++ L G  A   L      S+   P L   + IG PA L++ RP
Sbjct: 255 ASLIPLDAQVTESLDRLAILTGR-APGALDATLSTSDAPLPTLPGSVAIGDPATLLKQRP 313

Query: 277 DIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGY-----NTHWSFGPKLY 331
           DIR  E++LA S A+IG   +D +P ++L G +  +  +  PG+     N  W   P L 
Sbjct: 314 DIRAAERRLASSNAQIGEHVADYFPKVTLLGDLGFSATD--PGHLFRKQNFTWVGAPYLQ 371

Query: 332 LPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVE 391
             I D G+ +  +R AE+S  E    +Q+ VL A+++   AL      ++ V  L     
Sbjct: 372 WNILDFGRTRGAVRAAEASRDEAEANYQKAVLGALQDANTALQRYGHQREHVVALTKVQT 431

Query: 392 LHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
               S +L    YR G  S++D+LD +R     + ++   + +L K YV +  ++G G+ 
Sbjct: 432 SAVHSRTLMDERYRAGVASMIDLLDTQREALSAQQNVIAGQAELIKDYVSVQKSLGLGWQ 491


>gi|307822818|ref|ZP_07653049.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Methylobacter tundripaludum SV96]
 gi|307736422|gb|EFO07268.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Methylobacter tundripaludum SV96]
          Length = 471

 Score =  180 bits (456), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 133/466 (28%), Positives = 229/466 (49%), Gaps = 41/466 (8%)

Query: 10  LFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIA 68
           L  + L GC  +GP+Y KP  P+ P  +    ++ +   DT +WWE F D  L +L++ A
Sbjct: 9   LLPLALTGCFMIGPDYQKPTAPI-PDAWRFAPAETVAASDT-RWWEQFGDPRLTQLIEQA 66

Query: 69  LQQNLTILQATERINAAKENILSV----RADLFPSSYASISHR----------FIPNLKT 114
           L  N  +  AT    A  E  L +    RADLFP    S S++           +P   +
Sbjct: 67  LLHNKDLQIAT----ATVEEFLGLYSVTRADLFPQISGSASYQRQQISGVTAGALPTPAS 122

Query: 115 -NSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAK---LNVISKLIPSYIDARH 169
            N    L+  W+ID++G+ RR  E++ ANL   Y Q +  +   L +++ +  SY+    
Sbjct: 123 DNIQAALNLSWEIDVWGRLRRATEAARANL---YGQEETRRTVVLTLVTSVARSYVQLCE 179

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
             +R+ IA + L   ++   ++  +F     S   + + E+E+ +  + +P LE      
Sbjct: 180 LDQRLEIAKRTLVDRREAYRIARARFEGELNSSAEVRQAESEVHNTAASVPQLESLVAQK 239

Query: 230 VHNISTLLGY-PATEFLHYMQKQSNNFQPNLYIP-INIGIPADLIRNRPDIRYQEKKLAD 287
            H +S LLG+ PA         Q       L++P I  G+P++L+  RPDIR  E+ L  
Sbjct: 240 EHELSVLLGHNPAA-------VQRGLALTELHLPSIPAGLPSELLTRRPDIRKAEQDLIA 292

Query: 288 SVAKIGIAKSDLYPSLSLNGSIA-LTHDNS--FPGYNTHWSFGPKLYLPIFDKGKIKSNI 344
           + A IG+AK+  +P  ++ GS    + D S    G    W++G  L +P+F  GKI   +
Sbjct: 293 ANANIGVAKAAYFPKFTVTGSFGGASADFSQLLSGPAGAWNYGLGLAMPLFTAGKIAGQV 352

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
           + +E+  QE   ++Q+T+L A +E ENAL   ++ ++ V  L   V   ++   L+ + Y
Sbjct: 353 KASEAREQESLFSYQKTLLQAFQETENALIDNSKIQEQVQALNRQVIALREYRRLAWLRY 412

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             G    L +LD +R    +E+ L+ A+    ++ +++Y A G  +
Sbjct: 413 NNGLTDYLVVLDAQRNLFNIELALATAQSNSLQAVINVYKAFGGSW 458


>gi|212633911|ref|YP_002310436.1| RND efflux system, outer membrane lipoprotein, NodT [Shewanella
           piezotolerans WP3]
 gi|212555395|gb|ACJ27849.1| RND efflux system, outer membrane lipoprotein, NodT [Shewanella
           piezotolerans WP3]
          Length = 501

 Score =  179 bits (455), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 128/456 (28%), Positives = 219/456 (48%), Gaps = 23/456 (5%)

Query: 12  IVLLAGCTVGPEYTKPHMPLLPTQF--SIGNSKNLINIDTLKWWESFNDTSLNKLVKIAL 69
           ++ +AGC +GP+Y +P + + P Q+   +  ++ L N     W E + D  L  L++ AL
Sbjct: 37  VLFIAGCAMGPDYQRPDIDI-PEQYLEELQQTEGL-NAGLKHWREFYLDPELQLLIEHAL 94

Query: 70  QQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSD------ 123
            QNL +     R+ AA+ N+    ADLFP    + S     +    ST  +  D      
Sbjct: 95  DQNLDLEGVRSRLLAARANVTVTDADLFPVVGLNASGERALDSALTSTDPVKEDTFYVAG 154

Query: 124 ---WKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQ 179
              W++DL+G  RR  E+  AN  S+   +++A +++IS +   Y +    ++R  I+  
Sbjct: 155 TVSWELDLWGANRRRSEAEFANFISSQEALNLATISLISDVASRYYEWLDIEQRYQISLN 214

Query: 180 ILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG- 238
              L KK  +L+ L+   G  S L + + E E +S +  +P L+       + +  LLG 
Sbjct: 215 TAQLRKKERDLARLRKQNGVISGLQVRQAEVEYQSAKVTLPDLDYERSEKANQLRILLGE 274

Query: 239 --YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
             YP T       K      P+ +    +GIP+ ++  RPD++  E+ L  + A +G+AK
Sbjct: 275 FKYPLTPKTEAQLKAEGPLFPDSFA---VGIPSQMLSQRPDVKTAEQALVAANANVGVAK 331

Query: 297 SDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQE 353
           +  +P  +++GS         + F      WS    +  PIF+ GKI +    A+  A++
Sbjct: 332 TAFFPKFTISGSYGSESESLSDIFDSEGVTWSLLAGITAPIFNSGKISAQYDVAKEEAKQ 391

Query: 354 QYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLD 413
             ++++ TVL A  EV +A+ S    +  +   Q  VE   +   L+M+ YR G  S LD
Sbjct: 392 AMLSYRSTVLAAYFEVNDAMNSFRRSELAIEAQQELVEASTEYTRLAMLRYRNGVSSSLD 451

Query: 414 ILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           ++D +R     ++ LS  KR    S + LY A+G G
Sbjct: 452 LMDAQRNLFSAQLTLSQVKRDRLLSMITLYRALGGG 487


>gi|330720755|gb|EGG98977.1| outer membrane protein OprN precursor [gamma proteobacterium
           IMCC2047]
          Length = 468

 Score =  179 bits (455), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 124/460 (26%), Positives = 233/460 (50%), Gaps = 33/460 (7%)

Query: 16  AGCT-VGPEYTKPHMPLLPTQFSIGN---SKNLINIDTLK----------WWESFNDTSL 61
           AGC  VGP+Y  P  P     F+ G    S +L  +D+            WW    D +L
Sbjct: 14  AGCAAVGPDYQAPAQP----DFAAGQTFASASLQRLDSQAMYLSNQPVNAWWLQLKDPTL 69

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPS---------SYASISHRFIPNL 112
            +LV+ AL  N  +  A   ++AA+  +      L PS         S AS  +   P  
Sbjct: 70  TRLVEQALVANTDLRVALANLSAARAVLRESATGLQPSLDLSAGSERSRASAVNSAQPEA 129

Query: 113 KTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
           +T ++  L   W++D+FG+ RR IE++ +N++ + A  D  +  VI+ +  +Y D R  +
Sbjct: 130 RTVNSASLGLAWELDVFGRVRRSIEAARSNIERSEALRDDVQRIVIADVASAYFDLRGAQ 189

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
           ER  +  + +   ++ +EL+     +G +++L  V+  A++ + ++ +PT+       ++
Sbjct: 190 ERRRVVERNIGNQQETLELTVTLAREGLSTELDTVRARAQLAATQALLPTIISDQNAALN 249

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
            ++ L G         +QK+ +   P +   I +G  A LIR RPDIR  E+ LA  VA+
Sbjct: 250 RLARLTGRVPGPLDVSLQKRGS--LPTMPAFIAVGDAASLIRRRPDIREAERGLASLVAQ 307

Query: 292 IGIAKSDLYPSLSLNGSI--ALTHDNSFPGYN-THWSFGPKLYLPIFDKGKIKSNIRRAE 348
           +G+  +DL+P+++   S+  A    +S   ++ T+++ GP +   +F++G I++ I +A 
Sbjct: 308 VGVVTADLFPTVNFTASVGVAAASGSSLSDHSATNYAVGPGIVWNLFNRGAIRARIEQAR 367

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           + A+ Q   +   VL A++EV +AL   +++++    L+ +    ++++ L  + Y  G 
Sbjct: 368 AGAEAQLARYDGVVLQALEEVNSALMRHSQERERNRVLRESAAASREAVELVKLRYNAGV 427

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGS 448
            S LD+LD ER   + E  L+ +    A+  ++LY A+G 
Sbjct: 428 ESFLDVLDAERTLLEAERQLTASNIDFAQQTINLYRALGG 467


>gi|77918705|ref|YP_356520.1| outer membrane protein [Pelobacter carbinolicus DSM 2380]
 gi|77544788|gb|ABA88350.1| outer membrane protein [Pelobacter carbinolicus DSM 2380]
          Length = 470

 Score =  179 bits (455), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 126/470 (26%), Positives = 226/470 (48%), Gaps = 22/470 (4%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL----INIDTLKWWESF 56
           M  + AIF L  ++L+GC+V  +YT P  P+   Q  +  S  +           WW+ F
Sbjct: 1   MKSITAIF-LCTLVLSGCSVFRDYTPPENPVGAEQTDLTVSDAVRYKAAQEPVAAWWQKF 59

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           +D  L  LV+ AL  NL +  A   +  A+     V  D FP+   + ++  + N +  S
Sbjct: 60  DDPQLVALVEEALDTNLDVRIALANLGEARAMAREVGLDRFPTVTGNAAYFRLLNSRETS 119

Query: 117 TGQ------------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPS 163
            G              D+ W++DLFG+  + I +  A  D+A   V    + V ++   +
Sbjct: 120 AGNSVERDVNSYTAGFDALWELDLFGRVSQRIAAQKALTDAALNDVRQIYVTVSAEAART 179

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           YI+ R  + R++IA +         EL+   F  G  + L + +   +     S IP L+
Sbjct: 180 YIELRGAQYRLNIAERNARNQAGTYELTQKLFDGGRGTALDVSRAITQRDLARSRIPPLQ 239

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
                 ++ +S L G      L  +    +   P+L + + +G    L++ RPDIR  E+
Sbjct: 240 AEVTAAINRLSVLTGRVPDALLEALS--GSKPLPSLPVTVAVGDAEGLLKRRPDIRTAER 297

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHDN--SFPGYNTHWSFGPKLYLPIFDKGKIK 341
           +LA SVA+  +A +DL+P++S+ GSI  +  +  SF       S GP ++   FD G+++
Sbjct: 298 QLAASVARYNVAATDLFPTVSILGSIGFSATDLGSFGASALAGSLGPSIHWRAFDLGRVR 357

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           + + +A++ +      +++TVL A++E + AL++ + +++    LQ A    + S  L+ 
Sbjct: 358 AQMAQADARSIAALAAYEKTVLKALEETQTALSNFSREEERRGTLQQAARSARHSAQLAK 417

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             Y QG  + LD+LD ER   + E  L+ ++   A   + +Y A+G G+ 
Sbjct: 418 QRYEQGMDAFLDVLDAERTQLQTEDALAASETTAALDLIAIYKALGGGWQ 467


>gi|115358025|ref|YP_775163.1| RND efflux system outer membrane lipoprotein [Burkholderia
           ambifaria AMMD]
 gi|115283313|gb|ABI88829.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia ambifaria AMMD]
          Length = 495

 Score =  179 bits (455), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 122/477 (25%), Positives = 224/477 (46%), Gaps = 42/477 (8%)

Query: 13  VLLAGCTVGPEY-TKPHMPLLPTQFSIGNSKNLINIDTL--KWWESFNDTSLNKLVKIAL 69
            LLAGCTVGP+Y   P  P  PT F    +  + +       WW +  D  L+ L+  AL
Sbjct: 19  CLLAGCTVGPDYRGAPAAPDAPT-FVRAPATGVDSTAPAPSAWWHALGDRQLDDLIAAAL 77

Query: 70  QQNLTILQATERINAAKENILSVRADLFPSSYASIS------------HRFIPNLKTNS- 116
             N  +  A  R+ A++  +   RA   P S A+++               +P+  +N  
Sbjct: 78  AHNPDLQAAQARLRASRAQLSQQRAAQLPKSSATVAAIRAREPDVSALGSMLPSGNSNQS 137

Query: 117 ----------------TGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISK 159
                           +   D+ W+IDLFG  RR +E++ A  ++  A +   ++++ ++
Sbjct: 138 GGSSPSLGGSGPLQLYSAGFDATWEIDLFGGTRRAVEAASAQAEAVDADLADTQVSIAAE 197

Query: 160 LIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDI 219
           +  +Y+D R  ++R++++ +  +L ++ +EL+  +  +G  + + + +L  ++++  + +
Sbjct: 198 VATAYVDLRDQQQRLALSQRTAELQQQMLELTQQRRARGVAADVDIERLTTQVENTRASL 257

Query: 220 PTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIR 279
             L+     ++  ++ L G  A   L      S    P L   + +G PA L++ RPDIR
Sbjct: 258 IPLDAQVTESLDRLAILTGR-APGALDAALSASGTPLPTLPGSVPVGDPAALLKQRPDIR 316

Query: 280 YQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGY-----NTHWSFGPKLYLPI 334
             E++LA S A++G   +D +P ++L G +  +  +  PG+     N  W   P L   I
Sbjct: 317 AAERRLASSNAQVGEHIADYFPKVTLLGDLGFSATD--PGHLFRKQNFTWIGAPYLQWNI 374

Query: 335 FDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHK 394
            D G+ +  IR AE+S  E    +Q+ VL A+++   AL      ++ V  L        
Sbjct: 375 LDFGRTRGAIRAAEASRDEAEANYQKAVLGALQDANTALQRYGHQREHVIALAKVQTSAT 434

Query: 395 KSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            S +L    YR G  S +D+LD +R     + ++   K +L K YV L  ++G G+ 
Sbjct: 435 HSATLMDQRYRAGVASTIDLLDTQREALAAQQNVIAGKAELVKDYVSLQKSLGLGWQ 491


>gi|330818240|ref|YP_004361945.1| outer membrane efflux protein [Burkholderia gladioli BSR3]
 gi|327370633|gb|AEA61989.1| outer membrane efflux protein [Burkholderia gladioli BSR3]
          Length = 514

 Score =  179 bits (455), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 120/467 (25%), Positives = 222/467 (47%), Gaps = 36/467 (7%)

Query: 17  GCTVGPEY-TKPHMPLLPTQFSIGNSKNLINIDT-LKWWESFNDTSLNKLVKIALQQNLT 74
           GCTVGP Y   P  P   T      +   +   T   WW+S ND  L++L+  AL  N  
Sbjct: 22  GCTVGPNYKGAPTAPSAATFVRAPQTGVAVATPTPAAWWQSLNDPRLDELIAAALAHNPD 81

Query: 75  ILQATERINAAKENILSVRADLFPSSYASIS--HRFIPNLKTNS---------------- 116
           +  A  R+  A+  +   RA+  P + A ++      P++   S                
Sbjct: 82  LHAAQARLREARAQLSQQRANALPKTSADLAAIRTRAPDMNALSALTGANNANGGNSQAG 141

Query: 117 -------TGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
                  T   D+ W+IDLFG  RR IE++ A  ++  A +   ++++ +++  +Y+D R
Sbjct: 142 TGPIQLYTASFDATWEIDLFGGTRRAIEAASAQAEAVDADLADTQVSIAAEVANAYVDLR 201

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
             ++R++++ +  DL ++ ++L+  +  +G  +   + +L  ++++  + +  L+     
Sbjct: 202 DQQQRLALSRRTADLQQQQLDLTRQRRGRGVAADADIERLTTQVENTRASLIPLDAQVTE 261

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
           ++  ++TL G  A   L      +N   P+L   + IG PA +++ RPD+R  E++LA S
Sbjct: 262 SLDRLATLTGR-APGALDAQLSGANPALPSLPASVPIGDPAAMLKQRPDVRAAERRLASS 320

Query: 289 VAKIGIAKSDLYPSLSLNGSIALTHDNSFPGY-----NTHWSFGPKLYLPIFDKGKIKSN 343
            A+IG   +D +P ++L G +  +  +  PG+     N  W   P L   +FD G+ +  
Sbjct: 321 NAQIGEHIADYFPKVTLLGDLGFSAGD--PGHLFRKQNWTWVGAPYLQWNLFDFGRTRGA 378

Query: 344 IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
           +R AE+S  E    + + VL A+++   AL+     +  V  L         S +L    
Sbjct: 379 VRAAEASRDEAEANYTKAVLGALQDANTALSRYGHQRDHVVALDKVQTSAVHSATLMDQR 438

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           YR G  SL+D+LD +R     + ++   + +L K YV L  ++G G+
Sbjct: 439 YRAGVSSLIDLLDTQRDALSAQQNVIAGQAELIKDYVSLQKSLGLGW 485


>gi|74317433|ref|YP_315173.1| RND efflux system outer membrane lipoprotein NodT [Thiobacillus
           denitrificans ATCC 25259]
 gi|74056928|gb|AAZ97368.1| RND efflux system outer membrane lipoprotein NodT [Thiobacillus
           denitrificans ATCC 25259]
          Length = 520

 Score =  179 bits (454), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 124/464 (26%), Positives = 227/464 (48%), Gaps = 20/464 (4%)

Query: 6   AIFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINI-----DTLKWWESFNDT 59
           A+F+  ++ L GC TVGP +  P  P LP  ++  +++          D  +WW S  D 
Sbjct: 50  ALFAFVVLALTGCVTVGPGHVAPE-PSLPAHWATPDAQPHAGYVARQSDLGQWWRSLGDP 108

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQ 119
            L  LV  AL+    +  A  R+ AA+       AD FPS  AS S R   +     +G 
Sbjct: 109 LLVTLVDEALRTGPDVRSAEARLRAARARRAVAGADRFPSVNASGSARHSDSNAQVGSGS 168

Query: 120 L--------DSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
           +        D+ W++D+FG+ RR +E++ A+ +S+ A++  A++++ +++  +Y++ R  
Sbjct: 169 MQDLYSVGFDASWELDVFGRVRRSVEAAGADHESSQAELANARVSLAAEVALTYVEVRVL 228

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           + R+ IA   L    + ++L+  +   G  S     +  A ++   + IP+LE S     
Sbjct: 229 QIRLGIARANLASQTETLQLTDWRAQAGLVSSQDSEQARANLEQTRAQIPSLETSLAEAA 288

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG P       +   +    P L   + +GIPAD +R RPD+R  E+ LA   A
Sbjct: 289 YRLDLLLGVPPGTLTPRLA--TGGELPALPAEVAVGIPADTLRQRPDVRAAERMLAAETA 346

Query: 291 KIGIAKSDLYPSLSLNGSIALTHD--NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
           ++G+A++  +PS SL+GSI L               S    +  PIFD G++++ +   +
Sbjct: 347 RVGVAQAARFPSFSLSGSIGLEALTLGGLSDSGATRSLLAGITAPIFDAGRLRAQVDVQD 406

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           +  ++  + ++ TVL A++EVE+AL ++  +++    L       + +   +   Y  G 
Sbjct: 407 AVREQARVAYERTVLTALQEVESALVALARNRERSEALAKGAAAARNAADFARQRYSTGL 466

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
                +LD ER+   +E  L+  +     + + LY A+G G++P
Sbjct: 467 IDFQSVLDTERSVLALEDSLASTRADGVLALIRLYKALGGGWSP 510


>gi|261820853|ref|YP_003258959.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Pectobacterium wasabiae WPP163]
 gi|261604866|gb|ACX87352.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Pectobacterium wasabiae WPP163]
          Length = 495

 Score =  179 bits (453), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 131/475 (27%), Positives = 232/475 (48%), Gaps = 38/475 (8%)

Query: 14  LLAGCTVGPEYTKPHMPLL------------PTQFSIGNSKNLINIDTLK-WWESFNDTS 60
           L+AGC VGP+Y +P  PL               Q SI    N I    +  WWE FND  
Sbjct: 15  LMAGCAVGPDYHRPDAPLSDRYQAQSVAKQSAAQQSIEKQGNAIQSTNIAVWWEGFNDPL 74

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS-SYASISHRFIPNLKT----- 114
           L++LV  AL QNL + QA+ R+  ++  + +  A L PS S +    R   +++T     
Sbjct: 75  LSELVSSALSQNLDLAQASARVIQSRAGLGAATAALLPSGSISGQGARAYQSVETPQGRL 134

Query: 115 -NSTG-----------QLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLI 161
            NST             L++ W++D+FG  RR  +++LA+  ++ A V   +L V ++  
Sbjct: 135 LNSTSGYNRYGNAYETDLNASWELDIFGGLRRDRQAALADYQASEAGVTATRLAVAAQTA 194

Query: 162 PSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPT 221
             YI  R  + R+ IA++ ++  ++  +   L  ++G  ++  + + E  +  +++ +P 
Sbjct: 195 DIYITLRGLQARLEIANRQVNTQQELRDKVQLLHSKGLAAEYQVRQAEGTLSQVQATVPV 254

Query: 222 LEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQ 281
           L+      ++ +  +LG P       +       QP  +IP   G PADL+R RPDI   
Sbjct: 255 LQTGIDSAMNALDVMLGTPPGTHRTQLASPGAIPQPPQFIPT--GTPADLLRRRPDIIVA 312

Query: 282 EKKLADSVAKIGIAKSDLYPSLSLNG----SIALTHDNSFPGYNTHWSFGPKLYLPIFDK 337
           E+ LA S A+IG+A S+ YP  SL+     + +++  N F    +  +    L   +FD 
Sbjct: 313 ERHLAASNARIGVAISEYYPKFSLSALLGSTTSVSSGNLFSNGASQSAGVLGLRWRLFDF 372

Query: 338 GKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSM 397
           G+I + I +A+    E    ++ +VL+A ++VENA +++   +   T L         + 
Sbjct: 373 GRINAQIDQAKGQEAEALAAYRLSVLSATEDVENAFSALLNRETQTTTLTAGETALASAR 432

Query: 398 SLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
             S I Y++G  SL+D+L  +    ++    + A+ + A++ V  + A+G G+ P
Sbjct: 433 QSSFIAYQKGTASLIDVLHNDETLLQISDARAQAQTESARATVAAFKALGGGWQP 487


>gi|317053210|ref|YP_004118977.1| RND efflux system, outer membrane lipoprotein, NodT family [Pantoea
           sp. At-9b]
 gi|316952949|gb|ADU72421.1| RND efflux system, outer membrane lipoprotein, NodT family [Pantoea
           sp. At-9b]
          Length = 498

 Score =  178 bits (452), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 123/473 (26%), Positives = 238/473 (50%), Gaps = 43/473 (9%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKN--LINIDTL------KWWESFNDTSLNKLVK 66
           ++GCTVGP++ KP     P  ++   S +  L+N+         +WW+ ++D +LN LV+
Sbjct: 25  VSGCTVGPDFKKPEQKA-PADWTSWRSADPALLNVPGAAAVADNQWWKRYDDPTLNMLVE 83

Query: 67  IAL------------------QQNLTILQATERINAAKENILSVRADLFPSSYASISHRF 108
            AL                  QQ +T  Q T  +NA      + +++  PS+ A      
Sbjct: 84  KALTASPDIRTAALRFASARAQQRITSSQQTPNVNATASITRNQQSENSPSTRAL--KEV 141

Query: 109 IPN------LKTNS----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVI 157
           +PN      L T+      G LD  W+ID +G  RR IE++ A+  +  AQ++ A+L+++
Sbjct: 142 LPNPDELITLMTDPYNWYQGGLDFSWEIDFWGHVRRAIEAAEADSAAQQAQLEFARLSIV 201

Query: 158 SKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIES 217
             ++ SY + R  +++I +A        + + L   +   GA     L +  +E+ +  +
Sbjct: 202 GDVVNSYWNLRGIQQQIRLAKDDERALDERLSLIRARTLSGAQDNTDLERQRSELAATRA 261

Query: 218 DIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPD 277
           ++  L+    +  + +  LL          +Q + ++ Q     P+ +GIP+ +  NRPD
Sbjct: 262 NLIELQAQEGVTTNQLLLLLNERPGALKTLLQFKPDSLQAGNLPPLPLGIPSVVASNRPD 321

Query: 278 IRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALT--HDNSFPGYNTH-WSFGPKLYLPI 334
           I+  E  L  + A+IG+A+++LYPS+++   I +      +F  + +  WS GP L LPI
Sbjct: 322 IKAAEAHLHAATARIGVAEAELYPSITIGARIGMDTYSAGNFGEWGSRSWSVGPSLNLPI 381

Query: 335 FDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHK 394
           FD+G+ K+ +   E+  Q+  + +Q+TVL A +E+++AL+  +  ++ + + Q   E   
Sbjct: 382 FDRGRRKATVVLRETDQQQAAVDYQKTVLRAWQEIDDALSRYSAAQQKLAEQQTRAESSA 441

Query: 395 KSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIG 447
           ++++L    Y  G  S +++LD +R+  +    L++ +R L  ++  +  A+G
Sbjct: 442 QALALIEARYNGGLTSFINVLDAQRSDIQARQALAMGQRDLKTAWAAVNRAVG 494


>gi|190573812|ref|YP_001971657.1| putative outer membrane efflux protein [Stenotrophomonas
           maltophilia K279a]
 gi|190011734|emb|CAQ45354.1| putative outer membrane efflux protein [Stenotrophomonas
           maltophilia K279a]
          Length = 472

 Score =  178 bits (452), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 129/460 (28%), Positives = 235/460 (51%), Gaps = 28/460 (6%)

Query: 13  VLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDT--LKWWESFNDTSLNKLVKIAL 69
           ++LAGC +VGP Y  P    +  Q   G  + + +  +    WW  F+D  L +LV  AL
Sbjct: 12  LVLAGCVSVGPNYKAPVQEPVVLQ---GAQQPVFSTTSPVASWWAQFDDPVLEELVHGAL 68

Query: 70  QQNLTILQATERINAAKENILSVRADLFP--SSYASISHRFIPNLKTNSTGQ-------- 119
             NL +  A  R++ A+   +  R D  P  ++  S   R  P+ +    GQ        
Sbjct: 69  SDNLDLRVAVARVSQARAVFVESRFDQAPHITAGGSYDRRKQPDPQLG--GQRVFSESYQ 126

Query: 120 --LDSDWKIDLFGQRRHIESSLA-NLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISI 176
              D+ W++DLFG++R    +   +LD+  A +  A++ V +++  +Y + R  ++RI++
Sbjct: 127 LGFDAGWELDLFGRKRRAAEAARADLDAEQANLADAQVLVAAEVARNYFELRGTQKRIAV 186

Query: 177 AHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL 236
           A   L   +   +L+  ++  GA S+L +    A +K+IE+DIP LE +   + + ++ L
Sbjct: 187 AQHTLVNLRDTQKLTEARWELGAGSELDVQSSRARLKAIEADIPLLEVAETQSRNRLAVL 246

Query: 237 LGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
           LG    E L  M    +   P     + +G   +L+R R D+R  E++LA + A++G+A 
Sbjct: 247 LGQ-RPETLTAMLAPHDV--PAFAKALPLGDTRELLRQRADVRVAERRLAAATARVGVAT 303

Query: 297 SDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQE 353
           +DL+P LSL+G +      +     G N  WS  P L    FD G +++ +R +++ A+ 
Sbjct: 304 ADLFPRLSLSGFVGFLGGEASGLVNGNNKAWSLTPSLSWAAFDFGTVRARLRASKAEAEG 363

Query: 354 QYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLD 413
               +++ VL A+++ ENALT  ++ +  +  +    +  +++ SL+ I YR+G    L 
Sbjct: 364 VAAQYEQAVLLALEDTENALTRYSKQQARLAIVVEQAQAARRAESLAQIRYREGSEDFLT 423

Query: 414 ILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGS-GYNP 452
           +LD +R     +  L+ A+ ++  S V +Y A+G  G +P
Sbjct: 424 LLDAQRTQLAADDALAAAESEVNVSVVGVYKALGGWGQSP 463


>gi|188989847|ref|YP_001901857.1| outer membrane exporter [Xanthomonas campestris pv. campestris str.
           B100]
 gi|167731607|emb|CAP49782.1| outer membrane exporter [Xanthomonas campestris pv. campestris]
          Length = 490

 Score =  178 bits (452), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 132/479 (27%), Positives = 235/479 (49%), Gaps = 32/479 (6%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKN----LINIDTLKWWESF 56
           M  LR +  L    LAGC VGPEY +P  PL P ++   ++         +D  +WW  F
Sbjct: 1   MPSLRTLTVLLAASLAGCAVGPEYARPDAPL-PDRYLAQDAAEQRSAAAPVDLSRWWAGF 59

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS-SYASISHRFIPNLKTN 115
            D +L++ V  AL QNL + QA  R+  A+  + +  A L PS S    + R   +L+T 
Sbjct: 60  GDPALDRYVTAALAQNLDLAQAAARVTQARAGLGAANAALLPSGSINGQATRAYQSLET- 118

Query: 116 STGQL------------------DSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNV 156
             GQ+                  ++ W+ID+FG  RR  +++LA+  ++ A     +L V
Sbjct: 119 PLGQVLRNTPDFDRYVSVYEATANASWEIDVFGGLRRGRQAALADYQASAAGAAATRLAV 178

Query: 157 ISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE 216
            ++   +YI  R  + R+++A + +   ++ + +  L   +G  + L + + +  +   +
Sbjct: 179 AAQTADTYISIRGLQARLAVAQRQVATQQQLLAMVTLLQGKGLAADLQVHQAQGALTQAQ 238

Query: 217 SDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRP 276
           + +P LE +    ++ +  +LG  AT   H  +  ++   P          P DL+R RP
Sbjct: 239 AGVPALETALTAAMNALDVMLG--ATPGTHRAELVASTPIPTAPQVTGAASPGDLLRRRP 296

Query: 277 DIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSI----ALTHDNSFPGYNTHWSFGPKLYL 332
           D+   E++LA + A+IG+A ++ YP  SL+G I    A++  N F G     +    L  
Sbjct: 297 DLIVAERRLAVANARIGVAMAEYYPKFSLSGLIGSATAISGANLFTGDAAQSAGVLGLRW 356

Query: 333 PIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVEL 392
            +FD G+I + I +A+    EQ   ++  VL A ++VENALT++ + ++  T L   V+ 
Sbjct: 357 RLFDFGRINAQIAQAKGQEAEQLAAYRLAVLRATEDVENALTALVKREQQATVLAQGVDA 416

Query: 393 HKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             K+   S   Y +G  SL+++L+ + A  +       A+ + A+S V  + A+G G+ 
Sbjct: 417 LGKARGASAAAYEKGVVSLIEVLNADDALLRTSDAQLQAQTEAARSAVAAFKALGGGWE 475


>gi|187918872|ref|YP_001887903.1| NodT family RND efflux system outer membrane lipoprotein
           [Burkholderia phytofirmans PsJN]
 gi|187717310|gb|ACD18533.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia phytofirmans PsJN]
          Length = 472

 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 132/469 (28%), Positives = 225/469 (47%), Gaps = 34/469 (7%)

Query: 4   LRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGN-SKNLINIDTLKWWESFNDTSLN 62
            R + ++     AGCTVGP+Y +P +   P+ F   +    +++   ++WW  FND  L+
Sbjct: 6   CRLLAAVCACWFAGCTVGPDYHRPAVDT-PSSFRYASPDAEVVDQGAVQWWSQFNDPVLD 64

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFP---SSYASISHRFIPNL----KTN 115
            L++ AL QN  +  A  R++     +++ RA LFP   +++     R +P         
Sbjct: 65  GLIQRALDQNKDLAIAAARVDEFYGRLMTTRAGLFPQVGANFGGGRGRSVPAPGFAPAVG 124

Query: 116 STGQLD--SDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
           +  QLD  + W+IDLFG+ RR  E++ A+     A     ++ +IS +  SY+  R   +
Sbjct: 125 NQVQLDVMASWEIDLFGRLRRLTEAARADYLGTQAAQQATRIALISSVATSYLLLRDLDQ 184

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
           R+ IA   L      + L   +FT G  S+L + + ++E +S ++ +   ++      + 
Sbjct: 185 RLEIAKSTLASRADALSLFQERFTGGVVSQLQVSQAKSEYESAQASVYAFQQQIAQQENA 244

Query: 233 ISTLLG-----YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
           +S LLG      P  + L  +   +          I  G+P+ L+  RPDI   E+ L  
Sbjct: 245 LSLLLGDNPGPIPRGKPLTQLSAPA----------IPAGLPSSLLERRPDILQAEQALVS 294

Query: 288 SVAKIGIAKSDLYPSLSLNG-----SIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
           + A IG A++  +PS+SL G     S AL+    + G    WSF   +  PIF  G I  
Sbjct: 295 ANASIGAARAQYFPSISLTGMFGAASTALS--GLWTGPARIWSFAGAISQPIFTGGAITG 352

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
           ++R AE+  QE   ++++ + +A  +VENAL  +   +  +      VE   +  SL+  
Sbjct: 353 SVRTAEAQQQEALFSYEQAIQSAFADVENALVGVARVRDQLQATNRQVEALAQYASLARD 412

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            Y  G  S L++LD ER+    ++  S  + Q     V LY A+G G+N
Sbjct: 413 LYEGGYTSYLEVLDAERSLFNAQLQQSQLQDQQLAEIVALYKALGYGWN 461


>gi|113866641|ref|YP_725130.1| outer membrane protein [Ralstonia eutropha H16]
 gi|113525417|emb|CAJ91762.1| outer membrane protein [Ralstonia eutropha H16]
          Length = 518

 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 117/426 (27%), Positives = 200/426 (46%), Gaps = 30/426 (7%)

Query: 17  GCTVGPEYTKPHMPLLP---TQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNL 73
           GC VGP+Y KP +P       Q  +   +     D   WWE F D  L + V++AL QNL
Sbjct: 47  GCAVGPDYRKPEVPTADRFLGQRDVEQRRAATRADLEVWWEGFGDPQLTRFVRLALDQNL 106

Query: 74  TILQATERINAAKENILSVRADLFPSSYASIS------------HRFI---PNLKTNST- 117
            +  A+ R+  A   +    A L PS   S               R +   PN   + + 
Sbjct: 107 NLAVASARVTQAGAGLRFATAALLPSGAVSAQAAKQYQSLETPLGRVLNATPNFDRHGSL 166

Query: 118 --GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
               L + W+ID+FG  RR  E+S A   ++ A +   ++ V ++   +Y+  R  + R+
Sbjct: 167 YEADLTASWEIDIFGGLRREREASQAEYQASEAGLAATRVEVAAQAADTYVTIRGLQARL 226

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
           SIA Q +D  +K +    L + +G  + L + + E  +  +E+ IP LE      ++ + 
Sbjct: 227 SIARQQVDTQQKLVSTVRLLYAKGLAAALEVQQAEGALAQVEATIPELEAGLDAALNAMD 286

Query: 235 TLLG-YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
            LLG  P T        ++    P +      G PADL+R RPD+   E++LA S A+IG
Sbjct: 287 VLLGSQPGTYRAELADIKAIPAAPRIEA---TGTPADLLRRRPDLIVAERRLAASNARIG 343

Query: 294 IAKSDLYPSLSLNG----SIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
            A ++ YP +SL+G    +  +   N F       +    L   +FD G+I + I +A+ 
Sbjct: 344 AAIAEYYPKVSLSGLLGSATTVASGNLFSASANQAAGVAGLRWRLFDFGRIGAQIDQAKG 403

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
              E    ++  VL+A ++VENA T++ + ++    L+   +  +++ + S   Y +G  
Sbjct: 404 QEAEALAGYRLAVLHASEDVENAFTALVKREEQTNALERGEQALRQARNSSFAAYEKGVV 463

Query: 410 SLLDIL 415
            L+++L
Sbjct: 464 RLIEVL 469


>gi|78060838|ref|YP_367413.1| RND efflux system outer membrane lipoprotein [Burkholderia sp. 383]
 gi|77965388|gb|ABB06769.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. 383]
          Length = 499

 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 126/465 (27%), Positives = 229/465 (49%), Gaps = 45/465 (9%)

Query: 18  C-TVGPEYTKPHM-----PLLPTQFSIGNSKNLINIDTL--KWWESFNDTSLNKLVKIAL 69
           C +VGP+YT P       PL        N   L++ D +   WW+ ++D  LN LV+ AL
Sbjct: 22  CKSVGPDYTLPQQAYVNAPLANHALDDANG-TLVSRDAVPGNWWQLYDDPVLNGLVRDAL 80

Query: 70  QQNLTILQATERINAAKENILSVRADL--------FPSSYASISHRF------------I 109
           + N  +     R+ AA  N+   RA L        F     +   R             +
Sbjct: 81  KSNTDL-----RVAAA--NLARSRAALEVASQQGGFSGGAEAAVQRAQESAEQYLLENKL 133

Query: 110 PNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
           P +   + G ++  ++IDLFG+ RR +E++ A+ ++  A  D+A++ V++ ++ +Y+++ 
Sbjct: 134 PVVNEGTVG-INVSYEIDLFGKLRRGVEAARADSEAVRAAGDLARITVVADVVRAYVESC 192

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
              + +++A Q L L K+ + LS      G  ++  + +   +++++ +DIP  E   ++
Sbjct: 193 SAGDELAVAKQSLALQKQRVALSQRLRDAGRGNQTDVTRGVTQVRTLAADIPRFEGRRKV 252

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
             + ++ LL     +    + +      P L  PI IG  A L+R RPD+R  E++LA +
Sbjct: 253 AQYQLAALLARSPADLPKAVAE--CEHLPKLRQPIPIGDGAALLRRRPDVRAAERQLAAA 310

Query: 289 VAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
            A+IG+A + LYPS+S+    GS+ +  D  F      WSFGP +       G+ ++ +R
Sbjct: 311 TARIGVATAALYPSISIGASAGSVGVAAD-LFSSTTNRWSFGPLISWSFPVNGQ-RARVR 368

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
            AE++       +   VLNA++E +++L +   D +    L+ A E  + S   +   Y 
Sbjct: 369 EAEAATGGALAHFDGVVLNALRETQSSLATYAADVQRTEALRTAYESARNSADETHRLYL 428

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            GR S +  LD  R    V+  ++ A+ Q+A   V L++A+G G+
Sbjct: 429 AGRESFISDLDATRTLTSVQAQVAAAEGQVATDQVRLFLALGGGW 473


>gi|182415620|ref|YP_001820686.1| RND efflux system outer membrane lipoprotein [Opitutus terrae
           PB90-1]
 gi|177842834|gb|ACB77086.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Opitutus terrae PB90-1]
          Length = 476

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 131/472 (27%), Positives = 235/472 (49%), Gaps = 28/472 (5%)

Query: 1   MNILRAIFSLFIVLLAGCT-VGPEYTKPHMPLLPTQFSIGNSKNLINIDTL---KWWESF 56
           M IL   F+   +  A    VGP+Y +P +P L +    G  K     D L    WW  F
Sbjct: 1   MKILALFFAFTTLGFAALPKVGPDYYRPDLPPLASYRDAGGWKTADPADALPRGAWWNLF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFP--SSYASI--------SH 106
            D  L+ L   AL  N  +  A  R+  A+      R D +P  +++ ++        + 
Sbjct: 61  GDPVLDGLETRALAANQDLRAAAARVEQARAAAGIARGDYWPQLAAHGAVIREQTSQTTE 120

Query: 107 RFIPNLKTNS-TGQLDSDWKIDLFGQRRHIESSLANLDSAY-AQVDIAKLNVISKLIPSY 164
              P+ +T +    L + W++DLFG+ R +  S  ++ +A  A  +  +L++ + +  +Y
Sbjct: 121 NVFPDPRTTTYRAPLTAAWELDLFGRVRRLNESARDVAAASEATFESVRLSLTADVAANY 180

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
              R  +  + +    + L ++ +EL+  +   G  + L   + E E+ S E++  TL  
Sbjct: 181 FALRATERELVLLDDTVRLRRRALELATARVRSGTAADLDAARAETELASTEAERATLAN 240

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNL-YIPINIGIPADLIRNRPDIRYQEK 283
                 + ++TL+G PA+ F+  + +     +P L ++P   G+P++L+  RPDI   E+
Sbjct: 241 QRSALANALATLVGEPASGFVLAVVEH----EPVLPHVPA--GLPSELLERRPDIAAAER 294

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKI 340
            LA + A+IG+AK+  +P++SL GS        D      +  WS GP+LYLPIF  G+ 
Sbjct: 295 SLAAANARIGVAKAAFFPAISLTGSAGYASADIDRLTESDSRIWSIGPQLYLPIFQGGRN 354

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++N+ R+ ++  E    +++ VL A++EV++ALT+     +     Q A+E  +++  L+
Sbjct: 355 RANLARSRAAYDEAVAAFRQRVLVALREVQDALTASRLIGEEAAAQQRALESSRRAQRLA 414

Query: 401 MINYRQGRYSLLDILDIER-ATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            I Y  G  S L+++D +R A A       +  RQLA + V L  A+G G++
Sbjct: 415 QIRYDAGYVSYLEVIDAQRTALATERATARLIGRQLA-TRVALIKALGGGWH 465


>gi|95930203|ref|ZP_01312941.1| Hydrophobe/amphiphile efflux-1 HAE1 [Desulfuromonas acetoxidans DSM
            684]
 gi|95133666|gb|EAT15327.1| Hydrophobe/amphiphile efflux-1 HAE1 [Desulfuromonas acetoxidans DSM
            684]
          Length = 1503

 Score =  177 bits (450), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 125/455 (27%), Positives = 228/455 (50%), Gaps = 30/455 (6%)

Query: 14   LLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQN 72
            ++ GC TVGP+Y +P   ++   F          +D   WW  FND  L +LV+ AL  N
Sbjct: 1053 IMNGCITVGPDYQRPDPVVIEGAFEQA-------VDVGDWWTQFNDPLLTELVQQALANN 1105

Query: 73   LTILQATERINAAKENILSVRADLFPS--SYASISHRFIPNLKTNSTGQ-------LDSD 123
              +  A  R+  A+  +   +A L+P+  +  S+S        + + G+       +++ 
Sbjct: 1106 RDLKTAVARVREARATLARSKAALWPTLDALGSVSRSKTSENASENAGESTLYDTGVNAA 1165

Query: 124  WKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILD 182
            W+ID+FG  RR +E++ A+  S    +   +++V ++   +YI  R  + ++ +A   L 
Sbjct: 1166 WEIDVFGGTRRSVEAANADWQSMLIDLGDVQVSVAAETALAYIALRTVQYQLVVARDNLA 1225

Query: 183  LYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG-YPA 241
            + ++   +   +   G  + L+L +    ++S  S IPTLE       + +  L+G  P 
Sbjct: 1226 IQQETHAILADRRQAGLDNDLALQQATYNLESTRSSIPTLEAKVESAYNALCVLIGVLPG 1285

Query: 242  TEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYP 301
            +  L  + +      P   + +  GIPADL+R RPD++  E++LA   A+IG+A +DLYP
Sbjct: 1286 SVALEPLSQI-----PRSTVEVE-GIPADLLRRRPDVQRAERQLAAQTARIGVATADLYP 1339

Query: 302  SLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYI-T 357
              +L GSI L   N+       +  +S  P +  PIF  G I++NI+  + + +EQY+  
Sbjct: 1340 RFTLTGSIGLESLNTSDLLTSESERYSIIPGVQWPIFYFGSIRNNIK-VQQAVREQYLQA 1398

Query: 358  WQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDI 417
            ++  VL A++EV NAL    ++++    L  AV   + +  L+   YR G      +LD 
Sbjct: 1399 YESAVLTAVEEVRNALMDYRKEQERYVALNRAVTAAQTAEFLAKDQYRNGLTDFNAVLDA 1458

Query: 418  ERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            +R+    +    +++  ++++ V LY A+G G+ P
Sbjct: 1459 QRSLLSFQEQRVVSEGAVSQNIVRLYRAMGGGWTP 1493


>gi|182678989|ref|YP_001833135.1| RND efflux system outer membrane lipoprotein [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182634872|gb|ACB95646.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 525

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 134/492 (27%), Positives = 238/492 (48%), Gaps = 51/492 (10%)

Query: 6   AIFSL--FIVLLAGC-TVGPEYTKPHMPLLPTQ---------------FSIGNSKNLIN- 46
           AIF++      L GC +VGP+Y  P  P+LP +                S G +K  ++ 
Sbjct: 10  AIFAIVSLSTGLGGCLSVGPDYVGPD-PMLPAKSFYGPPEPAAAVAALPSQGPAKGPVSP 68

Query: 47  IDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYAS--- 103
           +D L WW +F D +L  LV+ A   NL +  A+ R+  ++       A   P+   +   
Sbjct: 69  VDPL-WWRTFRDPTLTSLVQRAAGANLDVRTASMRLAQSRFERGVTAAAALPTGNGNASY 127

Query: 104 ----ISHRFIPNLKTNSTGQL-----------------DSDWKIDLFGQ-RRHIESSLAN 141
               IS++ +  L      QL                 D+ W++D++G  RR IE++ A 
Sbjct: 128 NRQQISNQGVVTLVNPLVQQLGVGAFTVPPINVWSPTFDASWELDIWGHVRRQIEAADAQ 187

Query: 142 LDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATS 201
           +D+A  Q     ++ +++L   YI  R  + +I I    +   +  ++L+  +  +G T+
Sbjct: 188 MDAAEEQRRAMLVSTMAELARDYIQLRGVQAQIGILKDNIVSSEDILKLTRTRAEKGMTT 247

Query: 202 KLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYI 261
            L +    A+++S ++ +P+LE      ++ +S LL  P       + K  +   P +  
Sbjct: 248 GLDVENAAAQVESEKAQLPSLEDQQIELINALSLLLDSPPGALNDELIK--SKPIPPVPP 305

Query: 262 PINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSI---ALTHDNSFP 318
            + +GIP++L R RPDIR  E +L  + A IG+A ++ YP++ LNGS+   AL   N + 
Sbjct: 306 QVPLGIPSELARRRPDIRQAEAQLHSATANIGVAVAEFYPTVKLNGSVGANALDFKNLWK 365

Query: 319 GYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINE 378
                ++FGP   +P+FD G++K+ +   E+  QE  I + +TVL A  EV N LT+  +
Sbjct: 366 PSALQYNFGPSFAVPLFDGGRLKATLHLREAQQQEAAIAYHKTVLGAWHEVVNTLTAYQK 425

Query: 379 DKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKS 438
           +++   +L   V+  ++ +SLS   Y  G    + +LD ER     +   + +   ++  
Sbjct: 426 EQQRRARLNAQVDHARQVLSLSRTRYNTGVTDFITVLDAERTLLGAQQQYAQSTTNVSTD 485

Query: 439 YVDLYIAIGSGY 450
            V LY A+G G+
Sbjct: 486 LVALYKALGGGW 497


>gi|330953402|gb|EGH53662.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae Cit 7]
          Length = 487

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 129/470 (27%), Positives = 222/470 (47%), Gaps = 37/470 (7%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNS-KNLINIDTLK---WWESFNDTSLNK 63
             L +VLL+ C VGP+Y KP M   P QF      +     D +    WWE + D  LN 
Sbjct: 20  LGLCVVLLSACAVGPDYQKPSMAA-PAQFKAAQGWRAATPSDGMAKGAWWEVYKDPQLNA 78

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPS------SYASISHRFIPNLKTNST 117
           LV+     N T+ Q   +   A+  + S RA   P+         S       N  T+++
Sbjct: 79  LVERLNTSNQTVAQYDAQYRQAQTLVRSSRAAFLPTLDLTTGKTRSGQGTGTSNTGTSAS 138

Query: 118 G-------QLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
           G       QL   W+ D++G+ RR +E+  AN  ++ A +   +L++ S+L+ +Y+  R 
Sbjct: 139 GIRNSYNAQLGVSWEADVWGKLRRGLEADTANAQASLADLAAMRLSLQSELVQNYLQLRV 198

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
             E+  +    +D Y++++ L+  ++  G +   ++ + + ++KS ++D+  L       
Sbjct: 199 IDEQKRLLESTVDAYQRSLTLTQNQYRAGISGSDAVAQAQTQLKSTQADLIDLAWQRAQY 258

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP----INIGIPADLIRNRPDIRYQEKKL 285
            + I+ L+G    +F         N      IP    I  G+P+ L+  RPDI   E+ +
Sbjct: 259 ENAIAVLMGMAPADF---------NLPVTTSIPQLPQIPPGLPSQLLERRPDIAAAERSV 309

Query: 286 ADSVAKIGIAKSDLYPSLSL---NGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG+AK+  YP  +L    G  + T  N     N  WS GP+L L +FD GK  +
Sbjct: 310 MGANANIGVAKAAYYPDFTLSMSGGYSSSTFANWISLPNRFWSVGPQLALTLFDGGKRSA 369

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            + R E+   +    +++TVLN  +EVEN L  +   ++     Q A+   + S+ L+  
Sbjct: 370 EVDRTEAVYDQTVAQYRQTVLNGFQEVENYLVQLKVYEQEAAVRQEALVSARDSLRLTNN 429

Query: 403 NYRQGRYSLLDILDIERATAKVEVD-LSIAKRQLAKSYVDLYIAIGSGYN 451
            Y+ G    LD+++++      E   LS+ + +L  S V L  A+G G+N
Sbjct: 430 QYKAGLIGYLDVVNVQATALSNERSVLSVLQSRLIAS-VQLIAALGGGWN 478


>gi|309779682|ref|ZP_07674441.1| RND efflux system, outer membrane lipoprotein, NodT [Ralstonia sp.
           5_7_47FAA]
 gi|308921623|gb|EFP67261.1| RND efflux system, outer membrane lipoprotein, NodT [Ralstonia sp.
           5_7_47FAA]
          Length = 498

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 128/479 (26%), Positives = 220/479 (45%), Gaps = 45/479 (9%)

Query: 10  LFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLIN----IDTLKWWESFNDTSLNKLV 65
           +  +LLAGC VG +Y  P  PL  T+   G    L +    +    WWE F+D  L +LV
Sbjct: 1   MLALLLAGCAVGRDYHTP--PLSGTEAPQGWHATLPHHGSRMALAHWWEQFHDPVLTQLV 58

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFP----SSYASISHRFI------------ 109
           + A   + TI QA  R+  A+ ++ + RA L P    S  A+    F             
Sbjct: 59  EHADATSPTIAQAVGRVREARASVSTSRAALLPQLKGSGSATRQGGFGGSQFAGGAGGLS 118

Query: 110 -----PNLK----TNSTGQLDSDWKIDLF-GQRRHIESSLANLDSAYAQVDIAKLNVISK 159
                P L     T    Q D+ W+IDLF G+RR +E + A L ++ A    A++++ ++
Sbjct: 119 AGALNPTLGLGTITTLAAQADASWEIDLFGGKRRSLEGADARLTASEADWHDARVSLAAE 178

Query: 160 LIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDI 219
           +  +Y+  R  +  + I    L   ++ ++L+  KF  G  +     + +A +    + +
Sbjct: 179 VANTYLQQRECEALVDIGAATLSSRQETLQLTERKFRAGFVAPADFAQAQATVGDAVNAL 238

Query: 220 PTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNF--QPNLYIPINIGIPADLIRNRPD 277
                     +  +  L G         + K S      P+  +P    +PA ++  RPD
Sbjct: 239 EGQRAQCAQGIDKLVALTGLDHDALNGLLSKASAQIPAPPDAGVPD---VPAQVLSQRPD 295

Query: 278 IRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFP-GYNT----HWSFGPKLYL 332
           +   E+ +A + A +G+A +   PS++L GSI +   NS+  G  +     WSFGP + L
Sbjct: 296 VSSAERAVAGASADVGVAVASRLPSITLAGSIGI---NSYRLGGQSLTSKSWSFGPSVSL 352

Query: 333 PIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVEL 392
           PIFD G   + +  A +   +   +++  V  A++EVE+AL  ++  ++ V     A   
Sbjct: 353 PIFDGGAGAARVETARARYDQALASYRSKVRQAVQEVEDALVRLDASERRVDAATMADAQ 412

Query: 393 HKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           + K +  S   YR G  SLL + D+ R   +    L+  K + A+++V LY A+G G+ 
Sbjct: 413 YAKVLEASNARYRLGAGSLLQLEDVRRTALQASQSLAAVKLERAQAWVALYKAVGGGWR 471


>gi|292487766|ref|YP_003530639.1| outer membrane efflux protein [Erwinia amylovora CFBP1430]
 gi|292898995|ref|YP_003538364.1| efflux pump outer membrane protein [Erwinia amylovora ATCC 49946]
 gi|291198843|emb|CBJ45953.1| putative efflux pump outer membrane protein [Erwinia amylovora ATCC
           49946]
 gi|291553186|emb|CBA20231.1| Outer membrane efflux protein precursor [Erwinia amylovora
           CFBP1430]
          Length = 515

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 127/482 (26%), Positives = 230/482 (47%), Gaps = 54/482 (11%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSI----GNSKNLINIDTLKWWESFNDTSLNKLVKIALQ 70
           L GC  GP+Y  P  P+ P  F+     G +K L +     WW++F D  LN L++ A+Q
Sbjct: 22  LGGCAPGPDYQPPR-PVTPEVFNSMPPQGGAKILPSAPRADWWKAFGDPQLNSLIERAVQ 80

Query: 71  QNLTILQATERINAAKENILSVRADLFPSSYASISHRFI-------PNLKTNST------ 117
            NL++ Q   RI  A++ +   R    PS  AS + RF          L++         
Sbjct: 81  GNLSLQQTVLRIAGARQQLDQARGAWAPS--ASGNARFSRQQLGIKGELESQGVDDRLNG 138

Query: 118 ----------------------GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKL 154
                                 G  D+ W++DL+G+ RR +E + A    +  + + A +
Sbjct: 139 MGNADSLRPVLDSLEKPIGLYQGSFDASWELDLWGKVRRQVEMADARQQQSVEERNDALV 198

Query: 155 NVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKS 214
           ++ +++  +Y+  R  +         +D+ +  +EL+  +   G   + ++    A++ S
Sbjct: 199 SLEAEVARAYLQLRGAQAITRTIETQIDVAQLMLELTRSQQQNGLAPQTNVENARAQLSS 258

Query: 215 IESDIPTLEKSFRMNVHNISTLLG-YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIR 273
           + + +P  +      ++ ++ L G  P         +++    P     + +G+P++L R
Sbjct: 259 LRAQLPHYQAQIHQAMNGLAVLTGKVPGALDAELTPRKALTLLPPA---VPVGVPSELAR 315

Query: 274 NRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWS-----FGP 328
            RPD+R  E  L  + A IG++ + L+PSLSL+G   +   NS   Y   WS     FGP
Sbjct: 316 RRPDVRAAEASLHAATASIGVSVAQLFPSLSLSGQFGVR--NSDASYLDRWSSNFYSFGP 373

Query: 329 KLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQH 388
            + LPIF  G++ S ++ A +      + +++TVL A+++VENAL S   D + VT L  
Sbjct: 374 SITLPIFQGGRLVSGVKLARAQQASAALQYRQTVLTALQDVENALVSYRSDLQQVTGLDD 433

Query: 389 AVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGS 448
           + +  + + +L+ ++YRQG  S ++ LD +R  A+++     A+ Q     V LY A+G 
Sbjct: 434 SAQALQNACNLASVSYRQGLSSFIEPLDAQRQLAQLQQQAEQARVQSLLDLVALYKALGG 493

Query: 449 GY 450
           G+
Sbjct: 494 GW 495


>gi|94310211|ref|YP_583421.1| RND efflux system outer membrane lipoprotein NodT [Cupriavidus
           metallidurans CH34]
 gi|93354063|gb|ABF08152.1| Outer membrane efflux family protein precursor [Cupriavidus
           metallidurans CH34]
          Length = 512

 Score =  177 bits (449), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 120/465 (25%), Positives = 226/465 (48%), Gaps = 24/465 (5%)

Query: 8   FSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVK 66
            +L  VLL  C +VGP+Y +P    + + +S+  +    + D  +WW + +D  L++L+ 
Sbjct: 27  LALSCVLLTACASVGPDYREPPPVDVGSGWSLPLASESQSADLSQWWSALDDPILDRLMA 86

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFPSSYA--SISHR-----------FIPNLK 113
            AL QNL + QA  RI+ A+     V  +  P++ A  S++ R            IP L 
Sbjct: 87  TALAQNLDLRQAAARIDEARALRDRVAGEALPTAAAGASVNRRRQSENGPLPVGSIPGLD 146

Query: 114 TNST---GQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
              T      D+ W+ DLFG +RR +E + A L +  A+    ++ +++++  ++  A  
Sbjct: 147 ATQTIYDAGFDAAWEADLFGAKRRALEGANARLQATEAEAQGIRMRIVAEVARTWFTAVG 206

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
            +  +      LD  ++  EL  L+   G  S   +    A+  ++ + IP ++   R  
Sbjct: 207 ARYELHAQQATLDTLQQTWELVRLRHALGDASTADVEAAYAQWTAVNALIPDIQARQRAA 266

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
           V ++  LLG P    L  +        P+    + +G  AD++R RPD+   E++LA S 
Sbjct: 267 VLSLGVLLGAPPERELALLD---GPLTPSTLRALPVGERADMLRRRPDVLAAERRLAASS 323

Query: 290 AKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           A IG+A ++L+P LS+    G  AL+  + F   ++ +S  P +   +FD G++++ IR 
Sbjct: 324 ADIGVATAELFPKLSIGVGGGFQALSTGDWFDASSSRFSILPLISWRLFDGGRVRAEIRA 383

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
            E+  ++  + +++ VL A+ + E AL   +     + +   A++  + S   +   Y  
Sbjct: 384 REAGQRQAALAYEQAVLAALGDAERALGDYHGGLDTLERRGMALDAARTSYGHAKARYAA 443

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           G  +L+++L  +R+  + E   + A    A   V LY A+G G++
Sbjct: 444 GDIALVELLAAQRSLHEAETAAARAHTNAAVQLVALYKALGGGWD 488


>gi|294627198|ref|ZP_06705785.1| outer membrane efflux protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292598437|gb|EFF42587.1| outer membrane efflux protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 498

 Score =  177 bits (448), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 124/445 (27%), Positives = 216/445 (48%), Gaps = 29/445 (6%)

Query: 1   MNILRAIFSLFIV-LLAGCTVGPEYTKPHMPLLP---TQFSIGNSKNLINIDTLKWWESF 56
           M+ LR + +L +  L+ GC VGP+Y +P  PL      Q  I   +  +  +   WW+ F
Sbjct: 1   MSSLRTLAALVVASLVTGCAVGPDYARPEAPLQDRYIGQADIAQRRAAVPAELSTWWDGF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH-RFIPNLKT- 114
           ND  L++ V  AL QNL + QA  R+  A+  + +  A L P+   S S  R   +L+T 
Sbjct: 61  NDPDLSRYVNAALAQNLDLAQAGARVAQARAGLSAATAALLPAGNVSGSATRAYQSLETP 120

Query: 115 -----NSTGQLD-----------SDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVI 157
                +ST   D           + W++DLFG  RR  +++LA+  +  A     +L V 
Sbjct: 121 LGQVLDSTPNFDRHASVYEANLGASWELDLFGGLRRGRQAALADYQATEAGAAATRLAVA 180

Query: 158 SKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIES 217
           ++    YI  R  + R+ +A + +   +  + +  L  ++G  ++L L + +  +   ++
Sbjct: 181 AQTADIYISVRGLQARLDVAQRQVATQQGLLSMVTLLHSKGLAAELQLRQAQGALAQAQA 240

Query: 218 DIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPD 277
            +P LE       + +  +LG P     H  +  +    P      + G P DL+R RPD
Sbjct: 241 GVPGLEAGLVAATNALDVMLGVPPGT--HRAELSAIKPIPPAPQIADSGTPGDLLRRRPD 298

Query: 278 IRYQEKKLADSVAKIGIAKSDLYPSLSLNG----SIALTHDNSFPGYNTHWSFGPKLYLP 333
           +   E++LA S A+IG+A ++ YP  SL+G    + A++  N F G     S    L   
Sbjct: 299 LIVAERRLAASNARIGVAMAEYYPKFSLSGLLGSATAISGANLFTGDAAQSSGVLGLRWR 358

Query: 334 IFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELH 393
           +FD G+I + I +A+    EQ   ++  VL A ++VENA T++ + ++    L   V+  
Sbjct: 359 LFDFGRINAQIAQAKGQQAEQLAAYRLAVLRATEDVENAFTALIKREQQAAVLTQGVDAL 418

Query: 394 KKSMSLSMINYRQGRYSLLDILDIE 418
            K+   S + Y +G  SL+++L+ +
Sbjct: 419 GKARGASALAYEKGTVSLIEVLNAD 443


>gi|289673890|ref|ZP_06494780.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. syringae FF5]
          Length = 487

 Score =  177 bits (448), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 126/470 (26%), Positives = 221/470 (47%), Gaps = 37/470 (7%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNS-KNLINIDTLK---WWESFNDTSLNK 63
             L +VLL+ C VGP+Y KP M   P QF      +     D +    WWE + D  LN 
Sbjct: 20  LGLCVVLLSACAVGPDYQKPSMAA-PAQFKAAQGWRAATPSDGMAKGAWWEVYKDPQLNA 78

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPS-------------SYASISHRFIP 110
           LV+     N T+ Q   +   A+  + S RA   P+             +  S S     
Sbjct: 79  LVERLNTSNQTVAQYDAQYRQAQTLVRSSRAAFLPTLDLTTGKTRSGQGTGTSNSGTSAS 138

Query: 111 NLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
            ++ +   QL   W+ D++G+ RR +E+  AN  ++ A +   +L++ S+L+ +Y+  R 
Sbjct: 139 GIRNSYNAQLGVSWEADVWGKLRRGLEADTANAQASLADLAAMRLSLQSELVQNYLQLRV 198

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
             E+  +    +D Y++++ L+  ++  G +   ++ + + ++KS ++D+  L       
Sbjct: 199 IDEQKRLLESTVDAYQRSLTLTQNQYRAGISGSDAVAQAQTQLKSTQADLIDLAWQRAQY 258

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP----INIGIPADLIRNRPDIRYQEKKL 285
            + I+ L+G    +F         N      IP    I  G+P+ L+  RPDI   E+ +
Sbjct: 259 ENAIAVLMGMAPADF---------NLPATTSIPQLPQIPPGLPSQLLERRPDIAAAERSV 309

Query: 286 ADSVAKIGIAKSDLYPSLSL---NGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG+AK+  YP  +L    G  + T  N     N  WS GP+L L +FD G+  +
Sbjct: 310 MGANANIGVAKAAYYPDFTLSMSGGYSSSTFANWISLPNRFWSVGPQLALTLFDGGRRSA 369

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            + R E+   +    +++TVLN  +EVEN L  +   ++     Q A+   + S+ L+  
Sbjct: 370 EVDRTEAVYDQTVAQYRQTVLNGFQEVENYLVQLKVYEQEAAVRQEALVSARDSLRLTNN 429

Query: 403 NYRQGRYSLLDILDIERATAKVEVD-LSIAKRQLAKSYVDLYIAIGSGYN 451
            Y+ G    LD+++++      E   LS+ + +L  S V L  A+G G+N
Sbjct: 430 QYKAGLIGYLDVVNVQATALSNERSVLSVLQSRLIAS-VQLIAALGGGWN 478


>gi|77458708|ref|YP_348214.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           fluorescens Pf0-1]
 gi|77382711|gb|ABA74224.1| putative RND efflux system, outer membrane lipoprotein [Pseudomonas
           fluorescens Pf0-1]
          Length = 486

 Score =  177 bits (448), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 133/481 (27%), Positives = 239/481 (49%), Gaps = 33/481 (6%)

Query: 1   MNILRAIFSLFIV-LLAGCTVGPEYTKPHMPLLPTQFSIGNS----KNLINIDTL-KWWE 54
           M  LR I  L    L++GC VGP+Y +P  P+  +   +G S    ++    D L  WW+
Sbjct: 1   MPPLRPIALLVTAGLMSGCAVGPDYHRPDAPI--SDHYVGQSAVEPRSESTPDNLVAWWK 58

Query: 55  SFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS-SYASISHRFIPNLK 113
           +FND  L   +  ALQQNL + QA+ R+  A+  + +  A L PS S ++ + R   +++
Sbjct: 59  NFNDPLLTDFINQALQQNLDLAQASARVTQARAGLGAANAALLPSASISAQAARAYQSVE 118

Query: 114 T------NST-----------GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLN 155
           T      NST             L++ W++D+FG  RR  E++LA   S+ A     +L 
Sbjct: 119 TPLGQVLNSTPGYDRYGNAYEANLEAGWEVDVFGGLRRGREAALAEYQSSAAGFTATRLA 178

Query: 156 VISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSI 215
           + ++    YI  R  + R+ IA++ ++  +  +E   L + +G  ++  + + E E+  +
Sbjct: 179 IAAQTADIYITLRGLQARLEIANRQVETRRALLEKVRLLYGKGLAAEYQVRQAEGELSQV 238

Query: 216 ESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNR 275
           ++ +P L+      ++ +  LLG P     H  Q       P++     +G PADL+R R
Sbjct: 239 QATVPVLQSGLEAAMNAMDVLLGTPPG--THRTQLAREGEIPDVPSLNRLGTPADLLRRR 296

Query: 276 PDIRYQEKKLADSVAKIGIAKSDLYPSLSLNG----SIALTHDNSFPGYNTHWSFGPKLY 331
           PD+   E++LA S A+IG A ++ YP  SL+     + A++  N F    +  +    L 
Sbjct: 297 PDLIVAERRLAASNARIGEAIAEYYPKFSLSALLGSATAVSGGNLFTSGASQSAGVLGLR 356

Query: 332 LPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVE 391
             +FD  +I + I +A+    E    ++++VL A ++VENAL+S+   +   T L    E
Sbjct: 357 WRLFDFARINARIDQAKGQESEALAAYRQSVLRATEDVENALSSLVNRQTQTTTLTGGEE 416

Query: 392 LHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
              ++   S   Y +G  SL+D+L  +    +     + A+ + A++ V ++ ++G G+ 
Sbjct: 417 ALTQARQSSFTAYEKGTASLIDVLHADETLLQASDARAQARTESARAAVAVFKSLGGGWQ 476

Query: 452 P 452
           P
Sbjct: 477 P 477


>gi|330900291|gb|EGH31710.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. japonica str. M301072PT]
          Length = 487

 Score =  176 bits (447), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 126/470 (26%), Positives = 220/470 (46%), Gaps = 37/470 (7%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNS-KNLINIDTLK---WWESFNDTSLNK 63
             L +VLL+ C VGP+Y KP M   P QF      +     D +    WWE + D  LN 
Sbjct: 20  LGLCVVLLSACAVGPDYQKPSMAA-PAQFKAAQGWRTATPSDGMAKGAWWEVYKDPQLNA 78

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPS-------------SYASISHRFIP 110
           LV+     N T+ Q   +   A+  + S RA   P+             +  S S     
Sbjct: 79  LVERLNTSNQTVAQYDAQYRQAQTLVRSSRAAFLPTLDLTTGKTRSGQGTGTSNSGTSTS 138

Query: 111 NLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
            ++ +   QL   W+ D++G+ RR +E+  AN  ++ A +   +L++ S+L+ +Y+  R 
Sbjct: 139 GIRNSYNAQLGVSWEADVWGKLRRGLEADTANAQASLADLAAMRLSLQSELVQNYLQLRV 198

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
             E+  +    +D Y++++ L+  ++  G +   ++ + + ++KS ++D+  L       
Sbjct: 199 IDEQKRLLESTVDAYQRSLTLTQNQYRAGISGSDAVAQAQTQLKSTQADLIDLAWQRAQY 258

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP----INIGIPADLIRNRPDIRYQEKKL 285
            + I+ L+G    +F         N      IP    I  G+P+ L+  RPDI   E+ +
Sbjct: 259 ENAIAVLMGMAPADF---------NLPATTSIPQLPHIPPGLPSQLLERRPDIAAAERSV 309

Query: 286 ADSVAKIGIAKSDLYPSLSL---NGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG+AK+  YP  +L    G  + T  N     N  WS GP+L L +FD G+  +
Sbjct: 310 MGANANIGVAKAAYYPDFTLSMSGGYSSSTFANWISLPNRFWSVGPQLALTLFDGGRRSA 369

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
              R E+   +    +++TVLN  +EVEN L  +   ++     Q A+   + S+ L+  
Sbjct: 370 EFDRTEAVYDQTVAQYRQTVLNGFQEVENYLVQLKVYEQEAAVRQEALVSARDSLRLTNN 429

Query: 403 NYRQGRYSLLDILDIERATAKVEVD-LSIAKRQLAKSYVDLYIAIGSGYN 451
            Y+ G    LD+++++      E   LS+ + +L  S V L  A+G G+N
Sbjct: 430 QYKAGLIGYLDVVNVQATALSNERSVLSVLQSRLIAS-VQLIAALGGGWN 478


>gi|209517826|ref|ZP_03266661.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. H160]
 gi|209501772|gb|EEA01793.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. H160]
          Length = 522

 Score =  176 bits (447), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 129/462 (27%), Positives = 228/462 (49%), Gaps = 29/462 (6%)

Query: 13  VLLAGC-TVGPEYTKPHMPLL-------PTQFSIGNSKNLINIDTLKWWESFNDTSLNKL 64
           V L GC  VGP YT P   L+       P + +     + +N+ T+ WW+ ++D  LN L
Sbjct: 27  VALNGCINVGPNYTLPKQALVNAPHANGPIEGADPRLTSTLNVPTV-WWKLYDDPVLNGL 85

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS--------HRF-----IPN 111
           V  AL+ N  +  A   +  ++E +   +A    S  AS+S         +F     +P 
Sbjct: 86  VDQALKSNTDLRVAAANLARSREALSIAQAQGGFSGDASVSIERAQESAEQFLLTEKLPV 145

Query: 112 LKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                 G ++  ++IDLFG+ RR +E++ A+ ++  A  D+A++ V++ ++ SY++    
Sbjct: 146 ANLGDMG-INVSYEIDLFGKLRRGVEAAAADTEAVEAAGDLARITVVADVVRSYVEQCSA 204

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
            E + IA Q L L K+ ++LS      G  ++ ++   + +I+++ +DIP      ++  
Sbjct: 205 AEELRIAEQSLALQKERVDLSRRLRDAGRGNQTAVTSGQTQIENLRADIPRYTARRKIAQ 264

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + ++ LL    ++    +   + +  P +  PI IG  A L+R RPD+   E++LA S A
Sbjct: 265 YRLAMLLAQSPSQLPPAV--LACDRLPQIRQPIPIGDGAALLRRRPDVHEAERQLAASTA 322

Query: 291 KIGIAKSDLYPSLSLNGSIALTHD-NSFPGYNT-HWSFGPKLYLPIFDKGKIKSNIRRAE 348
           +IG+A   LYPS+S+  S   T      P   T  W+FGP +    F     +  +  AE
Sbjct: 323 RIGVATGALYPSISIGASAGFTGILEDIPTSPTARWAFGPLISW-TFPTNGARQRVHEAE 381

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           +S+Q     +   VL A++E E +L +   D      L+ A++   KS   +   YR GR
Sbjct: 382 ASSQVALAHFDGVVLTALRETETSLATYTYDYARAESLRAALQSAAKSADETHRLYRAGR 441

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            S +  LD  R     +  L+ A+ Q+A   V+L++++G G+
Sbjct: 442 ESFISDLDATRTLTAAKSQLAAAEGQVAVDQVNLFLSLGGGW 483


>gi|294011589|ref|YP_003545049.1| putative outer membrane protein [Sphingobium japonicum UT26S]
 gi|292674919|dbj|BAI96437.1| putative outer membrane protein [Sphingobium japonicum UT26S]
          Length = 489

 Score =  176 bits (447), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 120/466 (25%), Positives = 218/466 (46%), Gaps = 33/466 (7%)

Query: 13  VLLAGCTVGPEYTKPHMPLL--PTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQ 70
           ++L+GC  GP+Y  P    L  P  +  G    L   +   WW   +D +L+ L+  A+ 
Sbjct: 20  LVLSGCAAGPDYRAPAPAALGVPAAYIQGAGAPLDEAELAAWWTRLDDPALSGLIDRAIA 79

Query: 71  QNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLD--------- 121
            NL I+QA  R+  A+E++   RA   P +  S S     + + ++ G+LD         
Sbjct: 80  HNLDIVQAQARLRQARESLRQARAAFLPQANGSASGGRNYSSR-DAGGRLDPSGNPIGGG 138

Query: 122 -------------SDWKIDLFGQ--RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYID 166
                        + W++DLFG+  R    +      S Y   ++ +  ++S+L+ +Y+ 
Sbjct: 139 GSNWSSSYSVGANASWQVDLFGELSRSAEAARADLAASGYDLANV-RATIVSELVANYVQ 197

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
           AR  +E++ IA +   + + N  +++ +   G  S L   +  A++    + +P LE   
Sbjct: 198 ARLAQEQLRIARETQAIQQDNYNIANWRLQAGLVSSLDAEQARAQLAQTNATVPQLEAGL 257

Query: 227 RMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLA 286
           R +++ I+ L G    E    ++  +    P     I  GIPAD +R RPD+R  E+ LA
Sbjct: 258 RGSLNRIAVLTGQAPGEATRSLE--TPAPIPAAPARIATGIPADTLRQRPDVRSTERALA 315

Query: 287 DSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFG--PKLYLPIFDKGKIKSNI 344
            + A+IG+A++ LYPSL ++G+I  T  NSF    +  + G    +   IFD G++ S +
Sbjct: 316 AATARIGVAQAQLYPSLGISGNIGTTS-NSFKDLFSLVTGGVFANVAQVIFDGGRLASQV 374

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
           R   ++    +  +++ VL A+++VENA+ S++  +    +   A E    +  L+   Y
Sbjct: 375 RSQRAATDAAFAAYKQAVLTALEDVENAMASLSSARARKAEFATAYEASNNAAILARSQY 434

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           + G      +   E +       L+ A+         LY A+G G+
Sbjct: 435 QAGLIDFQTLSQSENSLLNARNSLAGAQSDEVLGLAQLYNALGGGW 480


>gi|254522205|ref|ZP_05134260.1| outer membrane efflux protein [Stenotrophomonas sp. SKA14]
 gi|219719796|gb|EED38321.1| outer membrane efflux protein [Stenotrophomonas sp. SKA14]
          Length = 473

 Score =  176 bits (447), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 132/461 (28%), Positives = 239/461 (51%), Gaps = 30/461 (6%)

Query: 13  VLLAGC-TVGPEYTKP-HMPLL--PTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIA 68
           ++LAGC +VGP Y  P   P++    Q  +  S + +      WW  F+D  L +LV  A
Sbjct: 13  LVLAGCVSVGPNYKAPVQEPVVLQGAQQPVFTSTSPVA----SWWAQFDDPVLEELVHGA 68

Query: 69  LQQNLTILQATERINAAKENILSVRADLFP--SSYASISHRFIPNLKTNSTGQ------- 119
           L  NL +  A  R++ A+   +  R D  P  ++  S   R  P+ +    GQ       
Sbjct: 69  LSDNLDLRVAVARVSQARAVFVESRFDQAPHITAGGSYDRRKQPDPQLG--GQRVFSESY 126

Query: 120 ---LDSDWKIDLFGQRRHIESSLA-NLDSAYAQVDIAKLNVISKLIPSYIDARHFKERIS 175
               D+ W++DLFG++R    +   +LD+  A +  A++ + +++  +Y + R  ++RI+
Sbjct: 127 QLGFDAGWELDLFGRKRRAAEAARADLDAEQANLADAQVLIAAEVARNYFELRGTQKRIA 186

Query: 176 IAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIST 235
           +A   L   +   +L+  ++  GA S+L +    A +K+IE+DIP LE +   + + ++ 
Sbjct: 187 VAQHTLVNLRDTQKLTEARWELGAGSELDVQSSRARLKAIEADIPLLEVAETQSRNRLAV 246

Query: 236 LLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIA 295
           LLG    E L  M   + +  P     + +G   +L+R R D+R  E++LA + A++G+A
Sbjct: 247 LLGQ-RPEVLTAML--APHEVPAFAKALPLGDTRELLRQRADVRVAERRLAAATARVGVA 303

Query: 296 KSDLYPSLSLNGSIA-LTHDNS--FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQ 352
            +DL+P LSL+G +  L  D S    G N  WS  P L    FD G +++ +R +++ A+
Sbjct: 304 TADLFPRLSLSGFVGFLGGDASGLVNGNNKAWSLTPSLSWAAFDFGTVRARLRASKAEAE 363

Query: 353 EQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLL 412
                +++ VL A+++ ENALT  ++ +  +  +    +  +++ SL+ I YR+G    L
Sbjct: 364 GVAAQYEQAVLLALEDTENALTRYSKQQARLAIVVEQAQAARRAESLAQIRYREGSEDFL 423

Query: 413 DILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGS-GYNP 452
            +LD +R     +  L+ A+ ++  S V +Y A+G  G +P
Sbjct: 424 TLLDAQRTQLAADDALAAAEAEVNVSVVGVYKALGGWGQSP 464


>gi|254883855|ref|ZP_05256565.1| outer membrane protein oprM [Bacteroides sp. 4_3_47FAA]
 gi|254836648|gb|EET16957.1| outer membrane protein oprM [Bacteroides sp. 4_3_47FAA]
          Length = 460

 Score =  176 bits (447), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 123/456 (26%), Positives = 226/456 (49%), Gaps = 29/456 (6%)

Query: 12  IVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQ 71
           + LL  C +G  YT+P + L P Q      ++ ++I  ++WWE + DT+L  L++  L  
Sbjct: 17  MTLLTSCQLGKHYTRPDLHL-PQQLDTLRQQDTLSIADMQWWEIYTDTTLQSLIEKTLDN 75

Query: 72  NLTILQATERIN--AAKENILSVRADLFP------------SSYASISHRFIPNLKTNST 117
           N  +  A  R+   AA + I    A+LFP            S+Y   +++  P L     
Sbjct: 76  NKDMKIAAARVKELAAMKRI--DFANLFPQLNGSAYAQKEGSNYGGDNYKNDPEL----G 129

Query: 118 GQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISI 176
           G+L   W++DL+G  R   + S+A    +       K++++S++  +Y +       ++I
Sbjct: 130 GKLTVTWELDLWGNLRWAKDKSIAQFLGSIEAQRALKMSIVSEVAQAYFELVALDNELNI 189

Query: 177 AHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL 236
             Q L   K+ + L+ L+F  G TS+ S  + + E     + +P LE+   +  ++I+ L
Sbjct: 190 VRQTLYARKEGVRLAKLRFEGGLTSETSYQQAQVEYARTATLVPELERKISLKENDIAFL 249

Query: 237 LGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
            G    E+ H +Q+     +  L   + +G+P+ L+  RPD+R  E+KL  + A +GIA 
Sbjct: 250 AG----EYPHRIQRSILPEEVKLPETLPVGLPSTLLERRPDVREAEQKLIAANASVGIAY 305

Query: 297 SDLYPSLSLNGSIALTHD--NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQ 354
           ++++P LSL     +  +  + F     H+  G  L  P+F  GK ++ ++  +++ +++
Sbjct: 306 TNMFPRLSLTAQYGVESEEFSDFFKSPIHYISG-NLLTPLFAMGKYRATLKAKKAAYEQE 364

Query: 355 YITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDI 414
             +++++VL A KE  NA+   N+ K I           K +M L+ + Y  G    LD+
Sbjct: 365 CYSYEKSVLTAFKEARNAIVDFNKIKDIYESRLQLERSSKATMELAQLQYINGVIGYLDV 424

Query: 415 LDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           LD +R+    ++ LS A R    + V LY A+G G+
Sbjct: 425 LDAQRSYFDAQIGLSNAIRDKQITLVKLYKALGGGW 460


>gi|319641471|ref|ZP_07996162.1| outer membrane protein oprM [Bacteroides sp. 3_1_40A]
 gi|317386904|gb|EFV67792.1| outer membrane protein oprM [Bacteroides sp. 3_1_40A]
          Length = 457

 Score =  176 bits (447), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 123/456 (26%), Positives = 226/456 (49%), Gaps = 29/456 (6%)

Query: 12  IVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQ 71
           + LL  C +G  YT+P + L P Q      ++ ++I  ++WWE + DT+L  L++  L  
Sbjct: 14  MTLLTSCQLGKHYTRPDLHL-PQQLDTLRQQDTLSIADMQWWEIYTDTTLQSLIEKTLDN 72

Query: 72  NLTILQATERIN--AAKENILSVRADLFP------------SSYASISHRFIPNLKTNST 117
           N  +  A  R+   AA + I    A+LFP            S+Y   +++  P L     
Sbjct: 73  NKDMKIAAARVKELAAMKRI--DFANLFPQLNGSAYAQKEGSNYGGDNYKNDPEL----G 126

Query: 118 GQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISI 176
           G+L   W++DL+G  R   + S+A    +       K++++S++  +Y +       ++I
Sbjct: 127 GKLTVTWELDLWGNLRWAKDKSIAQFLGSIEAQRALKMSIVSEVAQAYFELVALDNELNI 186

Query: 177 AHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL 236
             Q L   K+ + L+ L+F  G TS+ S  + + E     + +P LE+   +  ++I+ L
Sbjct: 187 VRQTLYARKEGVRLAKLRFEGGLTSETSYQQAQVEYARTATLVPELERKISLKENDIAFL 246

Query: 237 LGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
            G    E+ H +Q+     +  L   + +G+P+ L+  RPD+R  E+KL  + A +GIA 
Sbjct: 247 AG----EYPHRIQRSILPEEVKLPETLPVGLPSTLLERRPDVREAEQKLIAANASVGIAY 302

Query: 297 SDLYPSLSLNGSIALTHD--NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQ 354
           ++++P LSL     +  +  + F     H+  G  L  P+F  GK ++ ++  +++ +++
Sbjct: 303 TNMFPRLSLTAQYGVESEEFSDFFKSPIHYISG-NLLTPLFAMGKYRATLKAKKAAYEQE 361

Query: 355 YITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDI 414
             +++++VL A KE  NA+   N+ K I           K +M L+ + Y  G    LD+
Sbjct: 362 CYSYEKSVLTAFKEARNAIVDFNKIKDIYESRLQLERSSKATMELAQLQYINGVIGYLDV 421

Query: 415 LDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           LD +R+    ++ LS A R    + V LY A+G G+
Sbjct: 422 LDAQRSYFDAQIGLSNAIRDKQITLVKLYKALGGGW 457


>gi|157375420|ref|YP_001474020.1| outer membrane efflux protein [Shewanella sediminis HAW-EB3]
 gi|157317794|gb|ABV36892.1| outer membrane efflux protein [Shewanella sediminis HAW-EB3]
          Length = 501

 Score =  176 bits (447), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 126/458 (27%), Positives = 220/458 (48%), Gaps = 29/458 (6%)

Query: 13  VLLAGCTVGPEYTKPHMPLLPTQF----SIGNSKNLINIDTLKWWESFNDTSLNKLVKIA 68
            LLAGC +GP+Y +P + L P Q+      G   N   I   +W + + D  L  L+  A
Sbjct: 33  TLLAGCAMGPDYQQPELDL-PGQYHNELQQGEGDN---IGKTQWRDFYLDPQLQPLINHA 88

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPS-SYASISHRFIPNLKTNSTGQLDSD---- 123
           L QNL +     R+ AA++ I    A L+P     +   R + +  TN+    + +    
Sbjct: 89  LAQNLDLEAMRSRLIAARQRITVTDAALYPKVGIDAYGERSLDSGLTNTEPSSEDEFNLS 148

Query: 124 ----WKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAH 178
               W++D++G  RR  E+  AN  SA   +++A +++IS +   Y +    ++R  I+ 
Sbjct: 149 GVVSWELDIWGANRRRSEAEYANFLSAQESLNLATISLISDVASRYYEWLDIEQRYQIST 208

Query: 179 QILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG 238
             + L KK ++L+ L+   G  S L + + E E +S +  +P L+       + +  LLG
Sbjct: 209 NTVALRKKELDLARLRKENGVISGLEVRQAEVEFQSAKVTLPDLDFERGEKANQLRILLG 268

Query: 239 YPATEFLHYMQKQSN---NFQPNLY-IPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
               EF + +Q Q+      +  L+    N+G+P++++  RPD++  E+ L    AK+G+
Sbjct: 269 ----EFGYPLQLQTEAELRVEDALFPAQFNVGVPSEMLSQRPDVKAAEQALIAMNAKVGV 324

Query: 295 AKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           AK+  +P  +++GS     D   N        WS    +  PIF+ G I +    A+  +
Sbjct: 325 AKTAFFPKFTISGSFGRESDELSNLLDSEGVTWSLLGGITAPIFNAGSISAQYEIAKEES 384

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           ++  + ++ TVL A  EV +A+ S    +  +   Q  V    +   L+ + YR G  S 
Sbjct: 385 KQALLAYRNTVLRAYFEVNDAMNSFRRSELAINAQQELVAASSEYNRLAGLRYRNGVASS 444

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           LD++D +R     ++ LS  KR    S + LY A+G G
Sbjct: 445 LDLMDAQRKLFSAQLALSQIKRDRLLSMITLYRALGGG 482


>gi|269120097|ref|YP_003308274.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Sebaldella termitidis ATCC 33386]
 gi|268613975|gb|ACZ08343.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Sebaldella termitidis ATCC 33386]
          Length = 491

 Score =  176 bits (447), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 119/415 (28%), Positives = 220/415 (53%), Gaps = 17/415 (4%)

Query: 52  WWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS-------SYASI 104
           WW   +D +L +L+ ++L  N  +++A  R+N A+  +   +A+L P          A I
Sbjct: 69  WWNILDDDTLTQLITLSLNNNKNLMEARARVNEARAALGISQAELLPWLDSNNFWGRAKI 128

Query: 105 SHRFIPNLKTNSTGQL--DSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLI 161
           S    P +      +L  D+ W+ID+FG  R+ ++++ ++L +  A +    +++ S++ 
Sbjct: 129 SDNITPEIGITDIYRLGIDASWEIDIFGGNRYKVKAAESDLLAQNALLHSTWVSISSEVA 188

Query: 162 PSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPT 221
            +Y+  R  +ER++IA   L L + +I+L   K   G T +L+L + +      ++ IP 
Sbjct: 189 VNYLSLRTLQERLAIAESNLALQETSIKLLQSKNKAGLTDELNLNQAKYTANQTKAAIPA 248

Query: 222 LEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQ 281
           ++ S    ++N++ L G         + ++     P++   I +GIPA+ +R RPDI+  
Sbjct: 249 IKISIEEILNNLAILTGQVPGSLEKTLSERKE--LPDVNEMIYVGIPAEALRQRPDIQAA 306

Query: 282 EKKLADSVAKIGIAKSDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIFDKG 338
           E KL   +A+   A++DL P LSL GSI   +LT  +   G +  +S  P++  PIF+ G
Sbjct: 307 EYKLESQIARTKSARTDLLPKLSLFGSIGLESLTSGSLLSGASKGFSLLPQISFPIFNAG 366

Query: 339 KIKSNIRRAESSAQEQYIT-WQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSM 397
            I+ NI   +S+ +EQY+  ++ TVLNA  EV NALT++ ++ +  T L+  V     ++
Sbjct: 367 AIRKNIN-VQSAREEQYLAAYENTVLNAAAEVRNALTAVAQESEKNTSLKDGVANASAAL 425

Query: 398 SLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            ++   Y  G      +LD +R+   ++   +I+K Q   + V L+ A+G G+ P
Sbjct: 426 KIAQNKYNNGLTDYQSVLDAQRSLLSLQDQYAISKGQKVSNLVGLFKALGGGWKP 480


>gi|194365348|ref|YP_002027958.1| NodT family RND efflux system outer membrane lipoprotein
           [Stenotrophomonas maltophilia R551-3]
 gi|194348152|gb|ACF51275.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Stenotrophomonas maltophilia R551-3]
          Length = 473

 Score =  176 bits (446), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 129/460 (28%), Positives = 237/460 (51%), Gaps = 28/460 (6%)

Query: 13  VLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDT--LKWWESFNDTSLNKLVKIAL 69
           ++LAGC +VGP Y  P    +  Q   G  + + +  +    WW  F+D  L +LV  AL
Sbjct: 13  LVLAGCVSVGPNYKAPVQEPVVLQ---GAQQPVFSTTSPVASWWAQFDDPVLEELVHGAL 69

Query: 70  QQNLTILQATERINAAKENILSVRADLFP--SSYASISHRFIPNLKTNSTGQ-------- 119
             NL +  A  R++ A+   +  R D  P  ++  S   R  P+ +    GQ        
Sbjct: 70  SDNLDLRVAVARVSQARAVFVESRFDQAPHVTAGGSYDRRKQPDPQLG--GQRVFSESYQ 127

Query: 120 --LDSDWKIDLFGQRRHIESSLA-NLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISI 176
              D+ W++DLFG++R    +   +LD+  A +  A++ V +++  +Y + R  ++RI++
Sbjct: 128 LGFDAGWELDLFGRKRRAAEAARADLDAEQANLADAQVLVAAEVARNYFELRGTQKRIAV 187

Query: 177 AHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL 236
           A   L   ++  +L+  ++  GA S+L +    A +K+IE+DIP LE +   + + ++ L
Sbjct: 188 AQHTLVNLRETQKLTEARWELGAGSELDVQSSRARLKAIEADIPLLEVAETQSRNRLAVL 247

Query: 237 LGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
           LG         +   + +  P     + +G   +L+R R D+R  E++LA + A++G+A 
Sbjct: 248 LGQRPETLTAML---APHEVPAYAKALPLGDTRELLRQRADVRVAERRLAAATARVGVAT 304

Query: 297 SDLYPSLSLNGSIA-LTHDNS--FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQE 353
           +DL+P LSL+G +  L  D S    G N  WS  P L    FD G +++ +R +++ A+ 
Sbjct: 305 ADLFPRLSLSGFVGFLGGDASGLVNGNNKAWSLTPSLSWAAFDFGTVRARLRASKAEAEG 364

Query: 354 QYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLD 413
               +++ VL A+++ ENALT  ++ +  +  +    +  +++ SL+ I YR+G    L 
Sbjct: 365 VAAQYEQAVLLALEDTENALTRYSKQQARLAIVVEQAQAARRAESLAQIRYREGSEDFLT 424

Query: 414 ILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGS-GYNP 452
           +LD +R     +  L+ A+ ++  S V +Y A+G  G +P
Sbjct: 425 LLDAQRTQLSADDALAAAEAEVNVSVVGVYKALGGWGQSP 464


>gi|312171882|emb|CBX80139.1| Outer membrane efflux protein precursor [Erwinia amylovora ATCC
           BAA-2158]
          Length = 515

 Score =  176 bits (446), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 128/482 (26%), Positives = 230/482 (47%), Gaps = 54/482 (11%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSI----GNSKNLINIDTLKWWESFNDTSLNKLVKIALQ 70
           L GC  GP+Y  P  P  P  F+     G +K L +     WW++F D  LN L++ A+Q
Sbjct: 22  LGGCAPGPDYQPPR-PATPEVFNSMPPQGGAKILPSAPRADWWKAFGDPQLNSLIERAVQ 80

Query: 71  QNLTILQATERINAAKENILSVRADLFPSSYASISHRFI-------PNLKTNST------ 117
            NL++ Q   RI  A++ +   R    PS  AS + RF          L++         
Sbjct: 81  GNLSLQQTVLRIAGARQQLDQARGAWAPS--ASGNARFSRQQLGIKGELESQGVDDRLNG 138

Query: 118 ----------------------GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKL 154
                                 G  D+ W++DL+G+ RR +E + A    +  + + A +
Sbjct: 139 VGNADSLRPVLDSLEKPIGLYQGSFDASWELDLWGKVRRQVEMADARQQQSVEERNDALV 198

Query: 155 NVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKS 214
           ++ +++  +Y+  R  +         +D+ +  +EL+  +   G   + ++    A++ S
Sbjct: 199 SLEAEVARAYLQLRGAQAITRTIETQIDVAQLMLELTRSQQQNGLAPQTNVENARAQLSS 258

Query: 215 IESDIPTLEKSFRMNVHNISTLLG-YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIR 273
           + + +P  +      ++ ++ L G  P         +++    P L   + +G+P++L R
Sbjct: 259 LRAQLPHYQAQIHQAMNGLAVLTGKVPGALDAELTPRKA---LPLLPPAVPVGVPSELAR 315

Query: 274 NRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWS-----FGP 328
            RPD+R  E  L  + A IG++ + L+PSLSL+G   +   NS   Y   WS     FGP
Sbjct: 316 RRPDVRAAEASLHAATASIGVSVAQLFPSLSLSGQFGVR--NSDASYLDRWSSNFYSFGP 373

Query: 329 KLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQH 388
            + LPIF  G++ S ++ A +      + +++TVL A+++VENAL S   D + VT L  
Sbjct: 374 SITLPIFQGGRLVSGVKLARAQQASAALQYRQTVLTALQDVENALVSYRSDLQQVTGLDD 433

Query: 389 AVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGS 448
           + +  + + +L+ ++YRQG  S ++ LD +R  A+++     A+ Q     V LY A+G 
Sbjct: 434 SAQALQNACNLASVSYRQGLSSFIEPLDAQRQLAQLQQQAEQARVQSLLDLVALYKALGG 493

Query: 449 GY 450
           G+
Sbjct: 494 GW 495


>gi|325272469|ref|ZP_08138850.1| RND efflux system outer membrane lipoprotein [Pseudomonas sp.
           TJI-51]
 gi|324102397|gb|EGB99862.1| RND efflux system outer membrane lipoprotein [Pseudomonas sp.
           TJI-51]
          Length = 471

 Score =  176 bits (446), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 135/469 (28%), Positives = 233/469 (49%), Gaps = 22/469 (4%)

Query: 1   MNILRAIF-SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK--WWESFN 57
           MN+L+ +  SL  + LA C VGP+Y  P     P Q          +    +  WW+ F+
Sbjct: 1   MNLLKPLTPSLLALALAACAVGPDYQAPATA--PAQLGADAQAKAYDRSHFESLWWKQFD 58

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFP--SSYAS--ISHRFIPNL- 112
           D  LN+LV+ +L  N  +  A  R+ +A+        D FP  +S AS  I    +P   
Sbjct: 59  DPVLNQLVQASLTGNRDLRVAFARLKSARSIREDAENDPFPVVTSRASSDIGKGQVPGQT 118

Query: 113 --KTNSTG---QLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYID 166
             + NS      LD  W++DLFG+ +R IE+S A   +A A +   ++++I++L+ +Y  
Sbjct: 119 EQRVNSERYDLGLDMAWELDLFGRIQRQIEASEAQEAAAAADLQQLQVSLIAELVDAYGQ 178

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
            R  + R  IA   L   +++  ++      G  + L +V+ +A +  +E+ +P L+   
Sbjct: 179 LRGAQLREKIALANLKTQQQSRSITETLRDAGVGNDLDVVRADARLAGVEATVPQLQAEQ 238

Query: 227 RMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLA 286
               H I+TLLG         +   S    P +   + +G P +L+R RPDIR  E++LA
Sbjct: 239 ARARHRIATLLGQRPDALSVDL---SPKALPAIAKALPVGDPGELLRRRPDIRSAERQLA 295

Query: 287 DSVAKIGIAKSDLYPSLSLNGSIALTH-DNSFPGYNTH--WSFGPKLYLPIFDKGKIKSN 343
            + A +G+A +DL+P +SL+G +  T    S  G +    W+ GP +    FD G +++ 
Sbjct: 296 AATANVGVATADLFPRVSLSGFLGFTAARGSQLGSSAANAWALGPSITWAAFDLGSVRAR 355

Query: 344 IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
           +R A++ A+     +++ VL A++E  NA +   + ++ +  L    E  +K+  L+ I 
Sbjct: 356 LRGAKADAEGAMANYEQQVLLALEESANAFSDYAKTQQRLLSLMRQSEASRKAAQLASIR 415

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           YR+G    L +LD ER     E   +  + +L +  V +Y A+G G+ P
Sbjct: 416 YREGTVDYLVLLDAERERLSAEDAQAQGEVELYRGIVSIYKALGGGWQP 464


>gi|265756231|ref|ZP_06090560.1| outer membrane protein oprM [Bacteroides sp. 3_1_33FAA]
 gi|263233822|gb|EEZ19431.1| outer membrane protein oprM [Bacteroides sp. 3_1_33FAA]
          Length = 457

 Score =  176 bits (446), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 123/456 (26%), Positives = 226/456 (49%), Gaps = 29/456 (6%)

Query: 12  IVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQ 71
           + LL  C +G  YT+P + L P Q      ++ ++I  ++WWE + DT+L  L++  L  
Sbjct: 14  MTLLTSCQLGKHYTRPDLHL-PQQLDTLRQQDTLSIADMQWWEIYTDTTLQSLIEKTLDN 72

Query: 72  NLTILQATERIN--AAKENILSVRADLFP------------SSYASISHRFIPNLKTNST 117
           N  +  A  R+   AA + I    A+LFP            S+Y   +++  P L     
Sbjct: 73  NKDMKIAAARVKELAAMKRI--DFANLFPQLNGGAYAQKEGSNYGGNNYKNDPEL----G 126

Query: 118 GQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISI 176
           G+L   W++DL+G  R   + S+A    +       K++++S++  +Y +       ++I
Sbjct: 127 GKLTVTWELDLWGNLRWAKDKSIAQFLGSIEAQRALKMSIVSEVAQAYFELVALDNELNI 186

Query: 177 AHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL 236
             Q L   K+ + L+ L+F  G TS+ S  + + E     + +P LE+   +  ++I+ L
Sbjct: 187 VRQTLYARKEGVRLAKLRFEGGLTSETSYQQAQVEYARTATLVPELERKISLKENDIAFL 246

Query: 237 LGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
            G    E+ H +Q+     +  L   + +G+P+ L+  RPD+R  E+KL  + A +GIA 
Sbjct: 247 AG----EYPHRIQRSILPEEVKLPETLPVGLPSTLLERRPDVREAEQKLIAANASVGIAY 302

Query: 297 SDLYPSLSLNGSIALTHD--NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQ 354
           ++++P LSL     +  +  + F     H+  G  L  P+F  GK ++ ++  +++ +++
Sbjct: 303 TNMFPRLSLTAQYGVESEEFSDFFKSPIHYISG-NLLTPLFAMGKYRATLKAKKAAYEQE 361

Query: 355 YITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDI 414
             +++++VL A KE  NA+   N+ K I           K +M L+ + Y  G    LD+
Sbjct: 362 CYSYEKSVLTAFKEARNAIVDFNKIKDIYESRLQLERSSKATMELAQLQYINGVIGYLDV 421

Query: 415 LDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           LD +R+    ++ LS A R    + V LY A+G G+
Sbjct: 422 LDAQRSYFDAQIGLSNAIRDKQITLVKLYKALGGGW 457


>gi|289209080|ref|YP_003461146.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Thioalkalivibrio sp. K90mix]
 gi|288944711|gb|ADC72410.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Thioalkalivibrio sp. K90mix]
          Length = 482

 Score =  176 bits (446), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 118/460 (25%), Positives = 226/460 (49%), Gaps = 27/460 (5%)

Query: 14  LLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL----KWWESFNDTSLNKLVKIAL 69
           LL GC VGP+Y +P   L P  +       L++ +      +WW  + D  L+ LV  AL
Sbjct: 13  LLGGCAVGPDYERPDFDL-PEDWP---EHVLLSAEEQEAWQQWWTRYQDPQLDALVARAL 68

Query: 70  QQNLTILQATERINAAKENILSVRADLFPS--SYASISHRFIPNLKTNSTGQLDSD---- 123
             NL +    +RI  ++  +    A+  P+  + A  +    P   +   G   +D    
Sbjct: 69  DDNLDVRLQVQRIQESRARLGLAEANRLPTLDAQAEAARERQPEGLSPIPGGGGTDNLFS 128

Query: 124 ------WKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISI 176
                 +++DL+G+  R  E++ A L  +    +  +LNV++ ++ +Y++ R  +E+++I
Sbjct: 129 ITGILGYELDLWGRLARQEEAAEAFLQQSRFSHEAVRLNVVADVVATYVNLRSAQEQLAI 188

Query: 177 AHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL 236
           A + ++  ++ +EL  +++  G T  L L +  AE+++  + IP+L +  +     ++ L
Sbjct: 189 AEKTVESRERTLELEQIRYEGGQTDALVLRQSVAELETTRARIPSLRQQVQTLEGALAVL 248

Query: 237 LGYPATEFLHYMQKQSNNFQPNLYIPINIG--IPADLIRNRPDIRYQEKKLADSVAKIGI 294
           +G    E L  +         +L +P ++   +P++L+R RPDIR  E +L  S A+IG+
Sbjct: 249 VGMSPRELLDELDFGDRRL-ADLELPAHVPAVMPSELLRRRPDIRAAEAELMASTAEIGV 307

Query: 295 AKSDLYPSLSLNG---SIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           A++D  P L+L G   + A    + F      W  G  +  P+FD G+ ++ +  AE+  
Sbjct: 308 AEADRLPRLNLMGFLGTAATETSDLFTRSAETWGVGATVAGPLFDFGRARARVETAEALR 367

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
            +    +  T+  A +EV +AL       + V  ++  V+  +++  L+ I Y +G    
Sbjct: 368 DQAETRYAMTMTQAFREVRDALVLYEATDERVGAVRRQVQAIQETRDLAEIRYEEGFTGF 427

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +++LD ERA    E+ LS A R    +   L+ A+G G++
Sbjct: 428 IELLDAERALLDAELALSEALRDRLNATATLFKAMGGGWD 467


>gi|269122646|ref|YP_003310823.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Sebaldella termitidis ATCC 33386]
 gi|268616524|gb|ACZ10892.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Sebaldella termitidis ATCC 33386]
          Length = 492

 Score =  176 bits (445), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 125/444 (28%), Positives = 227/444 (51%), Gaps = 24/444 (5%)

Query: 23  EYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERI 82
           EY  P+       F+     NL       WW   +D +L +L+ ++L  N  +++A  R+
Sbjct: 47  EYDSPY-------FNTKTQNNLSPDALADWWNILDDDTLTQLITLSLNNNKNLMEARARV 99

Query: 83  NAAKENILSVRADLFPS-------SYASISHRFIPNLKTNSTGQL--DSDWKIDLFGQRR 133
           N A+  +   +A+L P          A IS    P +      +L  D+ W+ID+FG  R
Sbjct: 100 NEARAALGISQAELLPWLDSNNFWGRAKISDNITPEIGITDIYRLGIDASWEIDIFGGNR 159

Query: 134 H-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSH 192
           + ++++ ++L +  A +    +++ S++  +Y+  R  +ER++IA   L L + +I+L  
Sbjct: 160 YKVKAAESDLLAQNALLHSTWVSISSEVAVNYLSLRTLQERLAIAESNLALQETSIKLLQ 219

Query: 193 LKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQS 252
            K   G T +L+L + +      ++ IP ++ S    ++N++ L G         + ++ 
Sbjct: 220 SKNKAGLTDELNLNQAKYTANQTKAAIPAIKISIEEILNNLAILTGQVPGSLEKTLTERK 279

Query: 253 NNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSI--- 309
               P++   I +GIPA+ +R RPDI+  E KL   +A+   A++DL P LSL GSI   
Sbjct: 280 E--LPDVNEMIYVGIPAEALRQRPDIQAAEYKLESQIARTKSARTDLLPKLSLFGSIGLE 337

Query: 310 ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYIT-WQETVLNAIKE 368
           +LT  +   G +  +S  P++  PIF  G I+ NI   +S+ +EQY+  ++ TVLNA  E
Sbjct: 338 SLTSGSLLSGASKGFSLLPQISFPIFHAGAIRKNIN-VQSAREEQYLAAYENTVLNAAAE 396

Query: 369 VENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDL 428
           V NALT++ ++ +  T L+  V     ++ ++   Y  G      +LD +R+   ++   
Sbjct: 397 VRNALTAVAQESEKNTSLKDGVSNASAALKIAQNKYNNGLTDYQSVLDAQRSLLSLQDQY 456

Query: 429 SIAKRQLAKSYVDLYIAIGSGYNP 452
           +I+K Q   + V L+ A+G G+ P
Sbjct: 457 AISKGQKVSNLVGLFKALGGGWKP 480


>gi|330981343|gb|EGH79446.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. aptata str. DSM 50252]
          Length = 487

 Score =  176 bits (445), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 128/470 (27%), Positives = 221/470 (47%), Gaps = 37/470 (7%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNS-KNLINIDTLK---WWESFNDTSLNK 63
             L +VLL+ C VGP+Y KP M   P QF      +     D +    WWE + D  LN 
Sbjct: 20  LGLCVVLLSACAVGPDYQKPSMAA-PAQFKAAQGWRAATPSDGMAKGAWWEVYKDPQLNA 78

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPS------SYASISHRFIPNLKTNST 117
           LV+     N T+ Q   +   A+  + S RA   P+         S       N  T+++
Sbjct: 79  LVERLNTSNQTVAQYDAQYRQAQTLVRSSRAAFLPTLDLTTGKTRSGQGTGTSNSGTSAS 138

Query: 118 G-------QLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
           G       QL   W+ D++G+ RR +E+  AN  ++ A +   +L++ S+L+ +Y+  R 
Sbjct: 139 GTRNSYNAQLGVSWEADVWGKLRRGLEADTANAQASLADLAAMRLSLQSELVQNYLQLRV 198

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
             E+  +    +D Y++++ L+  ++  G +   ++ + + ++KS ++D+  L       
Sbjct: 199 IDEQKRLLESTVDAYQRSLTLTQNQYRAGISGSDAVAQAQTQLKSTQADLIDLAWQRAQY 258

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP----INIGIPADLIRNRPDIRYQEKKL 285
            + I+ L+G    +F         N      IP    I  G+P+ L+  RPDI   E+ +
Sbjct: 259 ENAIAVLMGMAPADF---------NLPATTSIPQLPQIPPGLPSQLLERRPDIAAAERSV 309

Query: 286 ADSVAKIGIAKSDLYPSLSL---NGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG+AK+  YP  +L    G  + T  N     N  WS GP+L L +FD G+  +
Sbjct: 310 MGANANIGVAKAAYYPDFTLSMSGGYSSSTFANWISLPNRFWSVGPQLALTLFDGGRRSA 369

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
              R E+   +    +++TVLN  +EVEN L  +   ++     Q A+   + S+ L+  
Sbjct: 370 EFDRTEAVYDQTVAQYRQTVLNGFQEVENYLVQLKVYEQEAAVRQEALVSARDSLRLTNN 429

Query: 403 NYRQGRYSLLDILDIERATAKVEVD-LSIAKRQLAKSYVDLYIAIGSGYN 451
            Y+ G    LD+++++      E   LS+ + +L  S V L  A+G G+N
Sbjct: 430 QYKAGLIGYLDVVNVQATALSNERSVLSVLQSRLIAS-VQLIAALGGGWN 478


>gi|78046019|ref|YP_362194.1| outer membrane efflux protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78034449|emb|CAJ22094.1| outer membrane efflux protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 502

 Score =  176 bits (445), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 124/447 (27%), Positives = 218/447 (48%), Gaps = 33/447 (7%)

Query: 1   MNILRAIFSLFIV--LLAGCTVGPEYTKPHMPLLP----TQFSIGNSKNLINIDTLKWWE 54
           M+ LR   ++F+   L+AGC VGP+Y +P +PL P     Q  I   +  +  D   WW+
Sbjct: 1   MSSLR-TLAVFVAASLVAGCAVGPDYARPEVPL-PDRYIGQADIAQRQAAVPADLSTWWD 58

Query: 55  SFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS---------SYASIS 105
            FND  L++ V  AL QNL + QA  R+  A+  + +  A L P+         +Y S+ 
Sbjct: 59  GFNDPDLSRYVTAALAQNLDLAQAGARVAQARAGLSAATAALLPAGNVSGSATRAYQSLE 118

Query: 106 HRF------IPNLKTNST---GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLN 155
                     PN   +++     L + W++DLFG  RR  +++LA+  +  A     +L 
Sbjct: 119 TPLGQVISSTPNFDRHASVYEANLGASWELDLFGGLRRGRQAALADYQATEAGAAATRLA 178

Query: 156 VISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSI 215
           V ++    YI  R  + R+ +A + +   +  + +  L   +G  ++L L + +  +   
Sbjct: 179 VAAQTADIYISIRGLQARLDVAQRQVATQRGLLSMVTLLHGKGLAAELQLQQAQGALAQA 238

Query: 216 ESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNR 275
           ++ +P LE      ++ +  +LG P     H  +  +    P      + G P DL+R R
Sbjct: 239 QAGVPGLEAGLVAAMNALDVMLGVP--PGTHRAELSATKPIPPAPQIADSGTPGDLLRRR 296

Query: 276 PDIRYQEKKLADSVAKIGIAKSDLYPSLSLNG----SIALTHDNSFPGYNTHWSFGPKLY 331
           PD+   E++LA S A+IG+A ++ YP  SL+G    + A++  N F G     S    L 
Sbjct: 297 PDLIVAERRLAASNARIGVAMAEYYPKFSLSGLLGSATAISGANLFTGDAAQSSGVLGLR 356

Query: 332 LPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVE 391
             +FD G+I + I +A+    EQ   ++  VL A ++VENA T++ + ++    L   V+
Sbjct: 357 WRLFDFGRINAQIAQAKGQQAEQLAAYRLAVLRATEDVENAFTALIKREQQAAVLTQGVD 416

Query: 392 LHKKSMSLSMINYRQGRYSLLDILDIE 418
              K+   S + Y +G  SL+++L+ +
Sbjct: 417 ALGKARGASALAYEKGTVSLIEVLNAD 443


>gi|171911892|ref|ZP_02927362.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Verrucomicrobium spinosum DSM 4136]
          Length = 473

 Score =  176 bits (445), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 115/413 (27%), Positives = 205/413 (49%), Gaps = 14/413 (3%)

Query: 51  KWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF-- 108
           KWWE F+D  LN+LV  ALQ +  I  A  ++  ++       A LFP+  A  S R   
Sbjct: 62  KWWERFHDPVLNQLVSTALQNSTDIRTAVSKVRESRARRGVQAAGLFPTVDAGFSARGER 121

Query: 109 IPNLKT------NSTGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLI 161
             N  T      N    +D  W++DLFG QR++I+++  +L  A   +  A++++ +++ 
Sbjct: 122 TDNRNTGVSSSENYGASIDMTWEVDLFGKQRQNIKAATEDLREAGENLYAAQVSLAAEVA 181

Query: 162 PSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPT 221
            +Y+  R  + ++++  + L    +  +++  K     T  +   +  + ++   + +P+
Sbjct: 182 DTYVSLRQAEAQLAVVERTLASRTETTQIARWKEEAKITGSVDTQQAISTLEQARAQVPS 241

Query: 222 LEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQ 281
           L+++     + +S L   P       + +  ++  P+    I IGIPAD +R RPDIR  
Sbjct: 242 LKQTISQTQNQLSLLASLPPGALDKLLAR--SDKMPSPPARIAIGIPADTLRQRPDIRAA 299

Query: 282 EKKLADSVAKIGIAKSDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIFDKG 338
           E+++  +VA+   A ++ YP LSL+GSI   AL     F   N   S    L  PIFD G
Sbjct: 300 ERRVDAAVARTKSAVAERYPDLSLSGSIGVDALKAGRIFSPENVAASIAGSLAAPIFDAG 359

Query: 339 KIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMS 398
           +I+ +I        +  I W+ TVL ++ EVENAL  I    + +  L+ A++  +++  
Sbjct: 360 RIRQDINIQSELESQALIGWEATVLTSLSEVENALIGIQRTAERLVILEQALKAARQAEE 419

Query: 399 LSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           LS   Y  G   LL +L+ +R    +E      +   A +++ LY A+G G++
Sbjct: 420 LSTQQYEAGLVDLLVVLEAQRTLLSLEDQEVTTRANQASAHIQLYKALGGGWS 472


>gi|330971257|gb|EGH71323.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. aceris str. M302273PT]
          Length = 487

 Score =  176 bits (445), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 125/470 (26%), Positives = 222/470 (47%), Gaps = 37/470 (7%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNS-KNLINIDTL---KWWESFNDTSLNK 63
             L +VLL+ C VGP+Y KP M   P QF      +     D +    WWE + D  LN 
Sbjct: 20  LGLCVVLLSACAVGPDYQKPSMAA-PAQFKAAQGWRTATPSDGMGKGAWWEVYKDPQLNA 78

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPS-------------SYASISHRFIP 110
           LV+     N T+ Q   +   A+  + S RA   P+             +  S S     
Sbjct: 79  LVERLNTSNQTVAQYDAQYRQAQTLVRSSRAAFLPTLDLTTGKTRSGQGTGTSNSGTSAS 138

Query: 111 NLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
            ++ +   QL   W+ D++G+ RR +E+  AN  ++ A +   +L++ S+L+ +Y+  R 
Sbjct: 139 GIRNSYNAQLGVSWEADVWGKLRRGLEADTANAQASLADLAAMRLSLQSELVQNYLQLRV 198

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
             E+  +    +D Y++++ L+  ++  G +   ++ + + ++KS ++D+  L       
Sbjct: 199 IDEQKRLLESTVDAYQRSLTLTQNQYRAGISGSDAVAQAQTQLKSTQADLIDLAWQRAQF 258

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP----INIGIPADLIRNRPDIRYQEKKL 285
            + I+ L+G    +F         N   +  IP    I  G+P+ L+  RPDI   E+ +
Sbjct: 259 ENAIAVLMGMAPADF---------NLPASTSIPQLPQIPPGLPSQLLERRPDIAAAERSV 309

Query: 286 ADSVAKIGIAKSDLYPSLSL---NGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG+AK+  YP  +L    G  + T  N     N  WS GP+L L +FD G+  +
Sbjct: 310 MGANANIGVAKAAYYPDFTLSMSGGYSSSTFANWISLPNRFWSVGPQLALTLFDGGRRSA 369

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            + R E+   +    +++TVLN  +EVEN L  +   ++     Q A+   + S+ L+  
Sbjct: 370 EVDRTEAVYDQTVAQYRQTVLNGFQEVENYLVQLKVYEQEAAVRQEALVSARDSLRLTNN 429

Query: 403 NYRQGRYSLLDILDIERATAKVEVD-LSIAKRQLAKSYVDLYIAIGSGYN 451
            Y+ G    LD+++++      E   LS+ + +L  S V L  A+G G++
Sbjct: 430 QYKAGLIGYLDVVNVQATALSNERSVLSVLQSRLIAS-VQLIAALGGGWD 478


>gi|212691876|ref|ZP_03300004.1| hypothetical protein BACDOR_01371 [Bacteroides dorei DSM 17855]
 gi|237708081|ref|ZP_04538562.1| outer membrane protein oprM [Bacteroides sp. 9_1_42FAA]
 gi|212665548|gb|EEB26120.1| hypothetical protein BACDOR_01371 [Bacteroides dorei DSM 17855]
 gi|229457909|gb|EEO63630.1| outer membrane protein oprM [Bacteroides sp. 9_1_42FAA]
          Length = 457

 Score =  176 bits (445), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 123/456 (26%), Positives = 226/456 (49%), Gaps = 29/456 (6%)

Query: 12  IVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQ 71
           + LL  C +G  YT+P + L P Q      ++ ++I  ++WWE + DT+L  L++  L  
Sbjct: 14  MTLLTSCQLGKHYTRPDLHL-PQQLDTLRQQDTLSIADMQWWEIYTDTTLQSLIEKTLDN 72

Query: 72  NLTILQATERIN--AAKENILSVRADLFP------------SSYASISHRFIPNLKTNST 117
           N  +  A  R+   AA + I    A+LFP            S+Y   +++  P L     
Sbjct: 73  NKDMKIAAARVKELAAMKRI--DFANLFPQLNGGAYAQKEGSNYGGNNYKNDPEL----G 126

Query: 118 GQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISI 176
           G+L   W++DL+G  R   + S+A    +       K++++S++  +Y +       ++I
Sbjct: 127 GKLTVTWELDLWGNLRWAKDKSIAQFLGSIEAQRALKMSIVSEVAQAYFELVALDNELNI 186

Query: 177 AHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL 236
             Q L   K+ + L+ L+F  G TS+ S  + + E     + +P LE+   +  ++I+ L
Sbjct: 187 VRQTLYARKEGVRLAKLRFEGGLTSETSYQQAQVEYARTATLVPELERKISLKENDIAFL 246

Query: 237 LGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
            G    E+ H +Q+     +  L   + +G+P+ L+  RPD+R  E+KL  + A +GIA 
Sbjct: 247 AG----EYPHRIQRSILPEEVKLPETLPVGLPSTLLERRPDVREAEQKLIAANASVGIAY 302

Query: 297 SDLYPSLSLNGSIALTHD--NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQ 354
           ++++P LSL     +  +  + F     H+  G  L  P+F  GK ++ ++  +++ +++
Sbjct: 303 TNMFPRLSLTAQYGVESEEFSDFFKSPIHYISG-NLLTPLFAMGKYRATLQAKKAAYEQE 361

Query: 355 YITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDI 414
             +++++VL A KE  NA+   N+ K I           K +M L+ + Y  G    LD+
Sbjct: 362 CYSYEKSVLTAFKEARNAIVDFNKIKDIYESRLQLERSSKATMELAQLQYINGVIGYLDV 421

Query: 415 LDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           LD +R+    ++ LS A R    + V LY A+G G+
Sbjct: 422 LDAQRSYFDAQIGLSNAIRDKQITLVKLYKALGGGW 457


>gi|170690255|ref|ZP_02881422.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia graminis C4D1M]
 gi|170144690|gb|EDT12851.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia graminis C4D1M]
          Length = 491

 Score =  176 bits (445), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 122/464 (26%), Positives = 222/464 (47%), Gaps = 25/464 (5%)

Query: 5   RAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKL 64
           R +  L +  L GC +GP Y +P   + P  F     +     +T+ WWE F D  LN+L
Sbjct: 8   RLLAVLVLTSLYGCLLGPNYERPKTEV-PATFRFSMEQTAETANTV-WWEQFQDPVLNEL 65

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFP---SSYASISHRF-------IPNLKT 114
           +  AL  NL +  A  R+   +   ++ R+ LFP   +++ +   R        +P    
Sbjct: 66  IAAALADNLDVKIAAARVEEFRGQFVTTRSGLFPQVGANFDASRQRASQSGAVPLPAGVG 125

Query: 115 NSTGQLDSD----WKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
               Q+D+     W+IDLFG+ RR  E++ ANL ++        L++++ +  SYI+ R 
Sbjct: 126 AVYNQVDASVSASWEIDLFGKIRRQSEAARANLLASEEGRRGTILSLVASVASSYINLRS 185

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
             +++ IA   +     ++ +  L+F  G  S+L L + ++E ++  + +P LE    + 
Sbjct: 186 LDKQLDIAKATVQSRADSVNVFTLRFKGGEVSQLELAQSQSEYQAARATLPQLEAQIAVQ 245

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
              ++ LLG      +       ++        I  G+P+DL+  RPD+   E+ L    
Sbjct: 246 EDALAVLLGRNPEPIVR-----GHDLDALAAPTIPSGLPSDLLERRPDLLQAEQNLVAQN 300

Query: 290 AKIGIAKSDLYPSLSLNG---SIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           A IG A++  +PS+SL G   S++    + F G    WSF   + LPIF  G I+  + +
Sbjct: 301 ALIGAARALYFPSISLTGLFGSLSTDFASLFSGPARIWSFAGAVSLPIFTAGNIEGQVHQ 360

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
           AE+  QE    +++ +  A +EV +AL ++ +  + ++     V        L+ + Y  
Sbjct: 361 AEARQQEALFAYRKAIQVAFQEVSDALINLQKSGEQLSVQGDQVNALAMYAHLARLRYEG 420

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           G  S +++LD ER+    ++  +  +     S+V+LY A+G G+
Sbjct: 421 GYTSYIEVLDAERSLFNAQLSYTQTQGVQLTSFVNLYKAMGGGW 464


>gi|51245973|ref|YP_065857.1| outer membrane lipoprotein [Desulfotalea psychrophila LSv54]
 gi|50877010|emb|CAG36850.1| related to outer membrane lipoprotein [Desulfotalea psychrophila
           LSv54]
          Length = 476

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 134/469 (28%), Positives = 232/469 (49%), Gaps = 29/469 (6%)

Query: 4   LRAIFSLFIVLLA--GCTVGPEYTKPHMPLLPTQFSIG----NSKNLINIDTLKWWESFN 57
           +R +F   ++LLA   CT+G +Y +P   L+P QF  G     ++    +    WWE ++
Sbjct: 7   IRNLFFGGVLLLALSACTLGQDYQRPET-LVPIQFKNGAPWKEARPSDAVAKGNWWELYH 65

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS-----------SYASISH 106
           D  LN L + ALQ N  +  A  R++  + N+   R++  P            + AS++ 
Sbjct: 66  DPVLNGLEENALQANQNLRAAYARLSQVQANLGISRSNQLPRLDLNANGGRQRTAASLTS 125

Query: 107 RFIPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
                L T     L   +++DL+G+ RR IE+S A+++SA A      L + ++L  +Y 
Sbjct: 126 PGQDQLSTQLNLPLVLSYEVDLWGRVRRSIEASTADVESARADYQSLMLTLQAELARNYF 185

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
             R       +  Q ++L +  + L   KF  G  S+L L + E+E+ ++E++   L+K 
Sbjct: 186 TLRAVDNETRLLQQTIELRRSTLSLVKSKFENGRVSQLDLSQAESELATVEAEAIGLKKR 245

Query: 226 FRMNVHN-ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
            R  + N I+ L+G PA+ F   + + S    P    P   G+P+DL+  RPD+   E+K
Sbjct: 246 -RGELENLIAVLMGLPASNF--SLAQVSLRLSPPTIAP---GLPSDLLERRPDVAAAERK 299

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIK 341
           +A + A+IG+AK+  +P++SL GS     + +   F   N  W  GP + LPIFD G+  
Sbjct: 300 MAAASARIGVAKTAFFPAISLTGSTGFASNETSSLFNWDNRTWGLGPAISLPIFDYGRNS 359

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           + + ++ +  +E    +++ VL A +EVEN L  +    +    LQ A      +  +S 
Sbjct: 360 AKLDKSRAVYEEAIANYRQQVLVAFQEVENGLNGLQVLHEQGKALQRATTTATLAWEISE 419

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             YR G  S L+++D +R+    E  L   + +   + V L  A+G  +
Sbjct: 420 KRYRSGLVSYLEVVDTQRSALLRERALVQLRGEQMSTSVLLIKALGGSW 468


>gi|218887249|ref|YP_002436570.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218758203|gb|ACL09102.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 529

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 126/488 (25%), Positives = 229/488 (46%), Gaps = 54/488 (11%)

Query: 12  IVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL--------------------- 50
           ++ L+GC VGP+Y +P  P  PT++S   ++  I+ D                       
Sbjct: 14  VLALSGCAVGPDYDRPAPPAAPTEWSAAKTRPEISGDVSGSGAPAESAGSVAPRAAVSAA 73

Query: 51  ----KWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH 106
               +WWE   D  L++LV +A+  N   L A   +  A+  ++ V       + A+   
Sbjct: 74  TPDGQWWERMGDPQLSELVAMAVGHNNDALIAAANLREAR-AVVGVARGALLPAAAAGGS 132

Query: 107 RFIPNLKTNS-TGQ-----------------LDSDWKIDLFG-QRRHIESSLANLDSAYA 147
                + TN+ TGQ                  D+ W+ID+FG  RR +E++ A   +A A
Sbjct: 133 FERSRVSTNTLTGQSLEMARMPIESDLYQAGFDARWEIDIFGGARRGVEAARARQQAAEA 192

Query: 148 QVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVK 207
            +    L+V ++   +Y + R  + R+ +A +  +  ++ +EL  L+   G  S +++++
Sbjct: 193 GLSDVLLSVAAETARAYAELRGAQARLDVAERNAEAQRRTLELVRLRRDVGVASDMNVLQ 252

Query: 208 LEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP--INI 265
            EA+++  E+ +P L  +    +H +  L G P       +  ++    P   +P  + +
Sbjct: 253 AEAQLQRTEALVPPLRAATDAAIHRLGVLCGLPPAALRDRLAPRA----PLPAVPDLVPV 308

Query: 266 GIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNT 322
           G+P+DL+  RPDIR  E +L  + A IG  ++DL+P  SL GS  L      + F   + 
Sbjct: 309 GLPSDLLLRRPDIRRVEHELHAATADIGQREADLFPKFSLTGSYGLNSIHFSDLFRDDSR 368

Query: 323 HWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKI 382
            W+  P +   IF+ G+ ++ +   E+  +     W++TVL A +EVE +L    E    
Sbjct: 369 AWTIMPGVRWAIFEGGRTRAAVAALEARREATLERWRKTVLVAFEEVETSLARYAEAFVE 428

Query: 383 VTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDL 442
             +L  ++E   ++  L+ + Y +G   LL +LD ER   +VE  L+ ++  +    V L
Sbjct: 429 RERLSRSLEAQAEATRLAKVRYTEGVDDLLTVLDAERRQLEVEEALARSRSGVLLHLVSL 488

Query: 443 YIAIGSGY 450
           Y A+G G+
Sbjct: 489 YKALGGGW 496


>gi|302186200|ref|ZP_07262873.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. syringae 642]
          Length = 487

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 124/470 (26%), Positives = 221/470 (47%), Gaps = 37/470 (7%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNS-KNLINIDTLK---WWESFNDTSLNK 63
             L +VLL+ C VGP+Y KP M   P QF      +     D +    WWE + D  LN 
Sbjct: 20  LGLCVVLLSACAVGPDYQKPSMAA-PAQFKAAQGWRAATPSDGMAKGAWWEVYKDPQLNA 78

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPS-------------SYASISHRFIP 110
           LV+     N T+ Q   +   A+  + S R    P+             +  S S   + 
Sbjct: 79  LVERLNTSNQTVAQYDAQYRQAQTLVRSSRGAFLPTLDLTTGKTRSGQGTGTSNSGTSVS 138

Query: 111 NLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
            ++ +   QL   W+ D++G+ RR +E+  AN  ++ A +   +L++ S+L+ +Y+  R 
Sbjct: 139 GIRNSYNAQLGVSWEADVWGKLRRGLEADTANAQASLADLAAMRLSLQSELVQNYLQLRV 198

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
             E+  +    +D Y++++ L+  ++  G +   ++ + + ++KS ++D+  L       
Sbjct: 199 IDEQKRLLESTVDAYQRSLTLTQNQYRAGISGSDAVAQAQTQLKSTQADLIDLAWQRAQY 258

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP----INIGIPADLIRNRPDIRYQEKKL 285
            + I+ L+G    +F         N      IP    I  G+P+ L+  RPDI   E+ +
Sbjct: 259 ENAIAVLMGMAPADF---------NLPATTSIPQLPQIPPGLPSQLLERRPDIAAAERSV 309

Query: 286 ADSVAKIGIAKSDLYPSLSL---NGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG+AK+  YP  +L    G  + T  N     N  WS GP+L L +FD G+  +
Sbjct: 310 MGANANIGVAKAAYYPDFTLSMSGGYSSSTFANWISLPNRFWSVGPQLALTLFDGGRRSA 369

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            + R E+   +    +++TVLN  +EVEN L  +   ++     Q A+   + S+ L+  
Sbjct: 370 EVDRTEAVYDQTVAQYRQTVLNGFQEVENYLVQLKVYEQEAAVRQEALVSARDSLRLTNN 429

Query: 403 NYRQGRYSLLDILDIERATAKVEVD-LSIAKRQLAKSYVDLYIAIGSGYN 451
            Y+ G    LD+++++      E   LS+ + +L  S V L  A+G G++
Sbjct: 430 QYKAGLIGYLDVVNVQATALSNERSVLSVLQSRLIAS-VQLIAALGGGWD 478


>gi|296116876|ref|ZP_06835481.1| putative outer membrane protein oprJ [Gluconacetobacter hansenii
           ATCC 23769]
 gi|295976569|gb|EFG83342.1| putative outer membrane protein oprJ [Gluconacetobacter hansenii
           ATCC 23769]
          Length = 515

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 129/515 (25%), Positives = 237/515 (46%), Gaps = 90/515 (17%)

Query: 4   LRAIFSLFIVLLA--GCTVGPEYTKP--------HMPLLPTQFSIGNSKNLINIDTLKWW 53
           +RA  S  I LLA  GC VGP+Y KP        H  + P Q ++  +     +D  +WW
Sbjct: 1   MRARLSGGIALLALAGCAVGPDYHKPRNIAPHDWHQSMPPAQSAVAET----GMDA-RWW 55

Query: 54  ESFNDTSLNKLVKIALQQNLTILQAT---------ERINAAKE----------------- 87
             F+D +LN L    ++ NL +  A           RI +A +                 
Sbjct: 56  SIFHDPTLNALEAEVVRANLDLRAAAYRFAQSMAERRIASAAQFPHAQANASYARERAST 115

Query: 88  ----NILSVRADLFPSSYASISHRFIPNLKTNSTGQ---------LDSDWKIDLFGQ-RR 133
                +L V       + AS +  F P       G          +++ W++D +G  RR
Sbjct: 116 NGVLGLLGVMEQQGAGTIASGTQGFGPTALPGRVGNPSFNLPQYGMNASWEVDFWGHVRR 175

Query: 134 HIESSLANLDSAYAQVDIAK---LNVISKLIPSYIDARHFKERISIAHQILDLYKKNIEL 190
            +E++ A +   +A  D+ +   ++++++    YI+ R  + RI+I    +D+ K +++L
Sbjct: 176 QVEAATAAM---HATEDMRRDVLVSLMAETAQDYIELRGVQARIAIVEHNIDIAKHSVDL 232

Query: 191 SHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN------------ISTLLG 238
           +  ++ QGA ++L +     ++ + ES +P L KS  +++ N            ++ LLG
Sbjct: 233 TTQRYAQGAATRLDVADSTGQLHTFESHLPVL-KSQEIHLLNALSFLVAREPGALTALLG 291

Query: 239 YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSD 298
            PA               P +   + +G+P++L+  RPDIR  E++L  + A IG+A +D
Sbjct: 292 APAA-------------IPPVPDSVPVGLPSELVDRRPDIRMAEERLHAATANIGVAVAD 338

Query: 299 LYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQY 355
            +P ++L+GS+   AL         +  + FGP    PIF+ G++   +R   +  +E  
Sbjct: 339 FFPRVTLSGSLDVQALQFSGLGSWASRQYGFGPTATFPIFEGGRLTGQLRLRRAQQKEAA 398

Query: 356 ITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDIL 415
           I  Q T+L A +EV++A+   +  +    +L  AV  ++ ++  +   Y QG    L++L
Sbjct: 399 IMLQRTILKAWQEVDDAMADFSAAQGQRDRLAEAVAENQIAVDTAQAQYVQGASDFLNVL 458

Query: 416 DIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            ++ A    + +L  A   ++ S   LY A+G G+
Sbjct: 459 TMQNALLATQSELVQATTHVSTSVARLYRALGGGW 493


>gi|104781428|ref|YP_607926.1| multidrug efflux RND outer membrane protein OprN [Pseudomonas
           entomophila L48]
 gi|95110415|emb|CAK15123.1| multidrug efflux RND outer membrane protein OprN [Pseudomonas
           entomophila L48]
          Length = 471

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 125/457 (27%), Positives = 228/457 (49%), Gaps = 33/457 (7%)

Query: 18  CTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK--WWESFNDTSLNKLVKIALQQNLTI 75
           C VGP+Y  P     P +   G      +    +  WW+ F+D  LN+LV+ +L+ N  +
Sbjct: 19  CAVGPDYKTPDTA--PARLDSGLEAKAFDRSRFESVWWKQFDDPVLNQLVQASLEGNRDL 76

Query: 76  LQATERINAAKENILSVRADLFPSSYASISHRFIPNL-KTNSTGQ-------------LD 121
             A  R+ AA+    ++R D+       ++ R   +L K    GQ             LD
Sbjct: 77  RVAFARLKAAR----AIREDVSNDQIPVVTSRASSDLGKGQIPGQTERRVNSERYDLGLD 132

Query: 122 SDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR--HFKERISIAH 178
             W++DLFG+ +R IE+S A   +A A +   ++++I++L+ +Y   R    +E+I++A+
Sbjct: 133 MAWELDLFGRIQRQIEASEAQEAAAEADLQQLQVSLIAELVDAYGQLRGAQLREQIAVAN 192

Query: 179 QILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG 238
                  ++I ++ L+ T G  ++L +V+ +A +  +E+ +P L+ +     + I+TLLG
Sbjct: 193 LKTQQQSRDITVT-LRDT-GVGNELDVVRADARLAGVEATVPQLQAAQVRAKNRIATLLG 250

Query: 239 YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSD 298
                    +   S    P +   + +G P +L+R RPDIR  E++LA + A +G+A +D
Sbjct: 251 QRPDAMTVDL---SPKALPAIAKALPVGDPGELLRRRPDIRSAERQLAAATANVGVATAD 307

Query: 299 LYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQY 355
           L+P +SL+G +  T           +  W+ GP +    FD G +++ +R A++ A    
Sbjct: 308 LFPRVSLSGFLGFTAARGSQIGSAASNAWALGPSITWAAFDLGSVRARLRGAKADADGAL 367

Query: 356 ITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDIL 415
             +++ VL A++E  NA +   + ++ +  L    E  +K+  L+ I YR+G    L +L
Sbjct: 368 ANYEQQVLLALEESANAFSDYGKRQQRLLALMRQSEASRKAAELASIRYREGTVDYLVLL 427

Query: 416 DIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           D ER     E   +  + +L    V +Y A+G G+ P
Sbjct: 428 DAERERLSAEDAQAQGEVELYSGIVAIYKALGGGWQP 464


>gi|294669169|ref|ZP_06734250.1| outer membrane multidrug efflux protein OprB [Neisseria elongata
           subsp. glycolytica ATCC 29315]
 gi|291308913|gb|EFE50156.1| outer membrane multidrug efflux protein OprB [Neisseria elongata
           subsp. glycolytica ATCC 29315]
          Length = 477

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 124/448 (27%), Positives = 226/448 (50%), Gaps = 19/448 (4%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTIL 76
           GCT+ P+Y +P + +  T F   N+++ I   +L W + F D  L++L++IAL++N  + 
Sbjct: 21  GCTMIPKYEQPQVAVSET-FKYDNAQSSIQAASLGWQDYFADPRLHRLIEIALERNTDLR 79

Query: 77  QATERINAAKENILSVRADLFPSSYASIS---HRFIPNL--------KTNSTGQLDSDWK 125
            A     A +E     RA+LFP+     S    R   +L        ++ S G   S ++
Sbjct: 80  TAALNAEALREQYRITRANLFPTVAGKGSGTRQRTAADLAGGRAAITESYSVGLGVSAYE 139

Query: 126 IDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLY 184
           +DLFG+ R +  ++L +  ++ A  D   L +++ +  +Y + R+ +E + +A  +L   
Sbjct: 140 LDLFGKARSNNRAALESYFNSTAARDAVHLTIVASVAKAYFNERYAEEAMKLAQNVLKTR 199

Query: 185 KKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEF 244
           ++   LS LK   G  S + L + EA I S ++D  T  K+     + +S L+  P  + 
Sbjct: 200 EQTYRLSQLKHKAGVISAVDLRQQEALIASAQADYETAVKNREQARNALSVLINQPLPDD 259

Query: 245 LHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLS 304
           L      S  F+ +  +P   G+ ++++ NRPDIR  E  L  + A IG A++  +PS++
Sbjct: 260 LPAGLPLSRQFKVS-RLPA--GLTSEVLLNRPDIRAAEHSLKQANANIGAARAAFFPSIT 316

Query: 305 LNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQET 361
           L GS+    +   N F   N  W+F P + +PIF  G +K+++  A+   Q Q + ++  
Sbjct: 317 LTGSVGSASNELNNLFKSGNGTWAFAPSINVPIFTWGALKASLDAAKIRQQIQVVNYEAA 376

Query: 362 VLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERAT 421
           V +A ++V +AL +  + +K         + +   + L  + Y+ G  S LD+LD ER++
Sbjct: 377 VQSAFRDVADALVAREQLEKAHAAKAKQSKAYTDQLRLIQLRYKHGVSSALDLLDAERSS 436

Query: 422 AKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
              +  L  +     ++  DLY A+G G
Sbjct: 437 YAADSALLASSLTRLENMADLYKALGGG 464


>gi|301058705|ref|ZP_07199705.1| putative outer membrane efflux protein OprM [delta proteobacterium
           NaphS2]
 gi|300447190|gb|EFK10955.1| putative outer membrane efflux protein OprM [delta proteobacterium
           NaphS2]
          Length = 488

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 129/465 (27%), Positives = 227/465 (48%), Gaps = 27/465 (5%)

Query: 7   IFSLFIVLLAGCT-VGPEYTKP-HMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKL 64
           I +   +L+ GC  +GP++ KP  +   P +F     K +  +   +WWE FND  +N+L
Sbjct: 10  ILAASCLLMGGCVKMGPDFKKPDSVVAAPERFQYAPRKPMATLPEDRWWEVFNDPEINRL 69

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPS-SYASISHR-------FIPNLKTNS 116
           V+  L+ N  + QA  RI   +  ++  RAD FPS  + + + R         P +    
Sbjct: 70  VEKVLKNNPDLEQAAARILELEYQVVQTRADRFPSLGFKAGAQRQHEPKSIVGPGISVGG 129

Query: 117 T-----GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
           T       L + +++DL+G+  R  E+S A L  A         +++S+ I  Y+  +  
Sbjct: 130 TVDQYSFSLPASYEMDLWGKYARAEEASRAQLLQAEENRLTLSQSLVSEAISLYLQIQSL 189

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           + RI I  Q L  Y+ ++     ++ +G TS L L +    +   + ++P L +      
Sbjct: 190 ERRIQITVQSLKNYEDSVTFVEQRYKRGLTSILDLRQARRTLNQAKGNLPQLRQELGTAQ 249

Query: 231 HNISTLLG-YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
             ++ LLG YP T   +    Q  ++   L   I  G+P++L+  RPD+R  E +L    
Sbjct: 250 QALAVLLGEYPKTRKPY---PQPEDYYRKLRA-IPPGLPSELLLRRPDVRAAEAQLKTLN 305

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHD---NSF-PGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
           A+IG+AK+  +PS+SL GS     +   N F PG    WS    L  P+FD G++K+N R
Sbjct: 306 AQIGVAKASRFPSISLTGSYGYASEELSNLFDPG--GIWSLAAGLVQPLFDAGRLKANQR 363

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
            AE+  ++ +  +++TVL A +EVENAL +  +  +    +Q  V   + +  ++   Y 
Sbjct: 364 AAEARYEQGFAAYRKTVLGAFREVENALLTRRKQLERRGDVQSFVVEARATQRVAETRYM 423

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +G    L +L+ ++   + E  L   +  +  + V L+ A+G G+
Sbjct: 424 RGLVDYLTVLNAQQTRFQAEDQLLRVELTILANRVTLHRALGGGW 468


>gi|21229896|ref|NP_635813.1| outer membrane protein [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66766774|ref|YP_241536.1| outer membrane protein [Xanthomonas campestris pv. campestris str.
           8004]
 gi|21111402|gb|AAM39737.1| outer membrane protein [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66572106|gb|AAY47516.1| outer membrane protein [Xanthomonas campestris pv. campestris str.
           8004]
          Length = 490

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 129/478 (26%), Positives = 233/478 (48%), Gaps = 30/478 (6%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKN----LINIDTLKWWESF 56
           M  LR +  L    LA C VGPEY +P  PL P ++   ++         +D  +WW  F
Sbjct: 1   MPSLRTLTVLLTASLASCAVGPEYARPDAPL-PDRYLAQDAAEQRSAAAPVDLSRWWAGF 59

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS---------SYASISH- 106
            D +L++ V  AL QNL + QA  R+  A+  + +  A L PS         +Y S+   
Sbjct: 60  GDPALDRYVTAALAQNLDLAQAAARVTQARAGLGAANAALLPSGSINGQATRTYQSLETP 119

Query: 107 -----RFIPNLKTNST---GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVI 157
                R  P+    ++      ++ W+ID+FG  RR  +++LA+  ++ A     +L V 
Sbjct: 120 LGQVLRNTPDFDRYASVYDATANASWEIDVFGGLRRGRQAALADYQASAAGAAATRLAVA 179

Query: 158 SKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIES 217
           ++   +YI  R  + R+++A + +   ++ + +  L   +G  + L + + +  +   ++
Sbjct: 180 AQTADTYISIRGLQARLAVAQRQVATQQQLLAMVTLLQGKGLAADLQVHQAQGALTQAQA 239

Query: 218 DIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPD 277
            +P LE +    ++ +  +LG  AT   H  +  ++   P          P DL+R RPD
Sbjct: 240 GVPALETALTAAMNALDVMLG--ATPGTHRAELVASTPIPTAPQVTGAASPGDLLRRRPD 297

Query: 278 IRYQEKKLADSVAKIGIAKSDLYPSLSLNGSI----ALTHDNSFPGYNTHWSFGPKLYLP 333
           +   E++LA + A+IG+A ++ YP  SL+G I    A++  N F G     +    L   
Sbjct: 298 LIVAERRLAVANARIGVAMAEYYPKFSLSGLIGSATAISGANLFTGDAAQSAGVLGLRWR 357

Query: 334 IFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELH 393
           +FD G+I + I +A+    EQ   ++  VL A ++VENALT++ + ++  T L   V+  
Sbjct: 358 LFDFGRINAQIAQAKGQEAEQLAAYRLAVLRATEDVENALTALVKREQQATVLAQGVDAL 417

Query: 394 KKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            K+   S   Y +G  SL+++L+ + A  +       A+ + A+S V  + A+G G+ 
Sbjct: 418 GKARGASAAAYEKGVVSLIEVLNADDALLRTSDAQLQAQTEAARSAVAAFKALGGGWE 475


>gi|146298670|ref|YP_001193261.1| RND efflux system outer membrane lipoprotein [Flavobacterium
           johnsoniae UW101]
 gi|146153088|gb|ABQ03942.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Flavobacterium johnsoniae UW101]
          Length = 455

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 128/457 (28%), Positives = 228/457 (49%), Gaps = 12/457 (2%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPT-QFSIGNSKNLINIDTLKWWESFNDT 59
           + IL AIF L  V   GC VGP+Y KP  P   + ++S  ++ +  ++ T+KW   FND 
Sbjct: 4   LKILLAIF-LIAVFPYGCMVGPKYAKPEQPQTDSFRYSNQSADSTKSVTTIKWSSIFNDD 62

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQ 119
            L  L++  +Q N  +  A  R+   + N+   +ADLFP+   S            S+  
Sbjct: 63  VLIGLIEKGIQNNYDLKIAIARLEQVQANLGMAKADLFPAFQYSGQVNSAETFMQPSSVF 122

Query: 120 LDSDWKIDLFGQRRHIESSLAN--LDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIA 177
            +  W++D +G+ RH   +L N  L S  A+  +   N++S +  SY + R F  ++ I 
Sbjct: 123 ANMSWELDFWGKYRHQTKALQNELLASDEAR-KVVLSNIVSTIATSYFELRDFDNQLEIT 181

Query: 178 HQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLL 237
              L+  +K  ++ + +F  G  ++L  V++E ++   E++IP +++      ++IS L+
Sbjct: 182 IHTLETRQKAYDIINERFISGYVAELDKVQIEQQVAIAEANIPLIKRQITALENSISILV 241

Query: 238 GYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKS 297
           G    +    + +   N +  +       +P+ L+ NRPD++ QE     +  +IG+A++
Sbjct: 242 G----QVPQPIPRGKTNSELLILTEFPTSVPSALLENRPDVKRQEYLYKAAFERIGVAQA 297

Query: 298 DLYPSL---SLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQ 354
             YPS    +L G  ++T  + F   +   + G  +  PIF+ GK K  +      A+E 
Sbjct: 298 LRYPSFNIGALAGFASITVGDLFNDGSYTQNVGAGVAGPIFNFGKNKRRVEVNRQIAEEM 357

Query: 355 YITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDI 414
              +Q+T L AI EVEN+L ++   K+  T     V   +K+  LS   Y  G  S L++
Sbjct: 358 KFNFQKTYLTAISEVENSLQNVAMFKEEWTARNRQVVAAQKNYDLSNARYYNGYVSYLEV 417

Query: 415 LDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           LD +R+  + ++ LS   ++   S V LY A+G G++
Sbjct: 418 LDAQRSLFEAQLSLSQLTQKQLSSMVQLYKALGGGWS 454


>gi|294776525|ref|ZP_06741999.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [Bacteroides vulgatus PC510]
 gi|294449654|gb|EFG18180.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [Bacteroides vulgatus PC510]
          Length = 457

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 125/452 (27%), Positives = 227/452 (50%), Gaps = 21/452 (4%)

Query: 12  IVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQ 71
           + LL  C +G  YT+P + L P Q      ++ ++I  ++WWE + DT+L  L++  L  
Sbjct: 14  MTLLTSCQLGKHYTRPDLHL-PQQLDTLRQQDTLSIADMQWWEIYTDTTLQSLIEKTLDN 72

Query: 72  NLTILQATERIN--AAKENILSVRADLFP----SSYASI--SHRFIPNLKTN--STGQLD 121
           N  +  A  R+   AA + I    A+LFP    S+YA    S+    N K +    G+L 
Sbjct: 73  NKDMKIAAARVKELAAMKRI--DFANLFPQLNGSAYAQKEGSNYGGDNYKNDPEQGGKLT 130

Query: 122 SDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI 180
             W++DL+G  R   + S+A    +       K++++S++  +Y +       ++I  Q 
Sbjct: 131 VTWELDLWGNLRWAKDKSIAQFLGSIEAQRALKMSIVSEVAQAYFELVALDNELNIVRQT 190

Query: 181 LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP 240
           L   K+ + L+ L+F  G TS+ S  + + E     + +P LE+   +  ++I+ L G  
Sbjct: 191 LYARKEGVRLAKLRFEGGLTSETSYQQAQVEYARTATLVPELERKISLKENDIAFLAG-- 248

Query: 241 ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLY 300
             E+ H +Q+     +  L   + +G+P+ L+  RPD+R  E+KL  + A +GIA ++++
Sbjct: 249 --EYPHRIQRSILPEEVKLPETLPVGLPSTLLERRPDVREAEQKLIAANASVGIAYTNIF 306

Query: 301 PSLSLNGSIALTHD--NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITW 358
           P LSL     +  +  + F     H+  G  L  P+F  GK ++ ++  +++ +++  ++
Sbjct: 307 PRLSLTAQYGVESEEFSDFFKSPIHYISG-NLLTPLFAMGKYRATLKAKKAAYEQECYSY 365

Query: 359 QETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIE 418
           +++VL A KE  NA+   N+ K I           K +M L+ + Y  G    LD+LD +
Sbjct: 366 EKSVLTAFKEARNAIVDFNKIKDIYESRLQLERSSKATMELAQLQYINGVIGYLDVLDAQ 425

Query: 419 RATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           R+    ++ LS A R    + V LY A+G G+
Sbjct: 426 RSYFDAQIGLSNAIRDKQITLVKLYKALGGGW 457


>gi|150006273|ref|YP_001301017.1| outer membrane protein oprM precursor [Bacteroides vulgatus ATCC
           8482]
 gi|149934697|gb|ABR41395.1| outer membrane protein oprM precursor [Bacteroides vulgatus ATCC
           8482]
          Length = 460

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 125/452 (27%), Positives = 227/452 (50%), Gaps = 21/452 (4%)

Query: 12  IVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQ 71
           + LL  C +G  YT+P + L P Q      ++ ++I  ++WWE + DT+L  L++  L  
Sbjct: 17  MTLLTSCQLGKHYTRPDLHL-PQQLDTLRQQDTLSIADMQWWEIYTDTTLQSLIEKTLDN 75

Query: 72  NLTILQATERIN--AAKENILSVRADLFP----SSYASI--SHRFIPNLKTN--STGQLD 121
           N  +  A  R+   AA + I    A+LFP    S+YA    S+    N K +    G+L 
Sbjct: 76  NKDMKIAAARVKELAAMKRI--DFANLFPQLNGSAYAQKEGSNYGGDNYKNDPEQGGKLT 133

Query: 122 SDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI 180
             W++DL+G  R   + S+A    +       K++++S++  +Y +       ++I  Q 
Sbjct: 134 VTWELDLWGNLRWAKDKSIAQFLGSIEAQRALKMSIVSEVAQAYFELVALDNELNIVRQT 193

Query: 181 LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP 240
           L   K+ + L+ L+F  G TS+ S  + + E     + +P LE+   +  ++I+ L G  
Sbjct: 194 LYARKEGVRLAKLRFEGGLTSETSYQQAQVEYARTATLVPELERKISLKENDIAFLAG-- 251

Query: 241 ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLY 300
             E+ H +Q+     +  L   + +G+P+ L+  RPD+R  E+KL  + A +GIA ++++
Sbjct: 252 --EYPHRIQRSILPEEVKLPETLPVGLPSTLLERRPDVREAEQKLIAANASVGIAYTNIF 309

Query: 301 PSLSLNGSIALTHD--NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITW 358
           P LSL     +  +  + F     H+  G  L  P+F  GK ++ ++  +++ +++  ++
Sbjct: 310 PRLSLTAQYGVESEEFSDFFKSPIHYISG-NLLTPLFAMGKYRATLKAKKAAYEQECYSY 368

Query: 359 QETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIE 418
           +++VL A KE  NA+   N+ K I           K +M L+ + Y  G    LD+LD +
Sbjct: 369 EKSVLTAFKEARNAIVDFNKIKDIYESRLQLERSSKATMELAQLQYINGVIGYLDVLDAQ 428

Query: 419 RATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           R+    ++ LS A R    + V LY A+G G+
Sbjct: 429 RSYFDAQIGLSNAIRDKQITLVKLYKALGGGW 460


>gi|94987437|ref|YP_595370.1| outer membrane efflux protein [Lawsonia intracellularis PHE/MN1-00]
 gi|94731686|emb|CAJ55049.1| outer membrane efflux protein [Lawsonia intracellularis PHE/MN1-00]
          Length = 459

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 117/451 (25%), Positives = 227/451 (50%), Gaps = 15/451 (3%)

Query: 12  IVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQ 71
            V+++ C+  P+Y +PH+ L     S   S       +++WW+ FND++L+ LV  ALQ 
Sbjct: 11  CVIVSSCSFAPDYNRPHLELPEVWVS---SPETGVPASMQWWKRFNDSTLDILVAEALQH 67

Query: 72  NLTILQATERINAAKENILSVRADLFP-------SSYASISHRFIPNLKTNSTGQLDSDW 124
           N  ++ A  R++ A+  +   R+DLFP       ++   + H+ + + ++  +    + W
Sbjct: 68  NRDLIAAVARVDYAQAQLGVARSDLFPHFSGNAQATPVWVDHKRVTDGQSPYSANFSASW 127

Query: 125 KIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDL 183
           +ID++G+ R+  +++ + L +  A+ +   L++ ++   +Y   R    + SIA + +  
Sbjct: 128 EIDIWGKIRNAKDAAFSQLMATEAEKEGVFLSIAAQTANAYFLLRSLDLQCSIAERTVKT 187

Query: 184 YKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATE 243
            +  + +   ++ +G  +KL L + + E+++  + +     +       +S LLG     
Sbjct: 188 REDALSIYTAQYQKGFINKLDLTRAKTEVETARTALYQKRIAQENAETALSVLLGRSPRL 247

Query: 244 FLHYMQKQSNNFQPNLYIP-INIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPS 302
            +    ++  + +    IP I  GIP++L+  RPDIR  E  L  + A IG+A++   PS
Sbjct: 248 IMDTAIERGVSMKDLSCIPVIPQGIPSELLERRPDIRQAEYTLKATSANIGVARAAWLPS 307

Query: 303 LSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQ 359
           +SL G   +      +        WS+G    +PI D G++  N+  A++  +E    ++
Sbjct: 308 ISLTGLFGIVSPHLSDLLKNPLKTWSYGETGTVPILDFGQVYYNVEAAQAKEREALANYE 367

Query: 360 ETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIER 419
           +TV NA K++ +AL    E K IV  L+  V+  + ++ L+   Y  G  S LD+LD ER
Sbjct: 368 KTVQNAFKDIHDALIRQYESKNIVNSLERMVKELRIAVHLARTLYDNGYTSYLDVLDAER 427

Query: 420 ATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           A  + E+DL+ A      S V + +A+G  +
Sbjct: 428 ALFQSELDLASAWSDRLSSIVQVCLALGGSW 458


>gi|224825602|ref|ZP_03698707.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Lutiella nitroferrum 2002]
 gi|224602523|gb|EEG08701.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Lutiella nitroferrum 2002]
          Length = 496

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 126/471 (26%), Positives = 225/471 (47%), Gaps = 34/471 (7%)

Query: 10  LFIVLLAGCTVGPEYTKPHMPLLPT---QFSIGNSKNLINIDTLKWWESFNDTSLNKLVK 66
           L + +L GCTVGP+Y +P + L PT   Q  + + +     D   WW +F+D  L   V 
Sbjct: 12  LSVGVLTGCTVGPDYRRPEIALSPTFIGQEGVDHRQVKHKADLTIWWAAFDDPLLTHFVA 71

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFPSSYASI-SHRFIPNLKT------NST-- 117
           +AL QNL I QA  R+  ++ ++    A L P++  SI + R   +++T      N+T  
Sbjct: 72  LALDQNLDIAQAAARVAQSRASLRYADAALLPAANVSITAARGYQSVETPLGQVLNATPG 131

Query: 118 ---------GQLDSDWKIDLFGQRRHIESSLANLDSAYAQVDIA-KLNVISKLIPSYIDA 167
                      L++ W+ID+FG  R    +      A     +A +L V ++    Y+  
Sbjct: 132 FDRSGSSYEANLNASWEIDMFGGLRRGREAARAAYEASEAGAVATRLAVAAQTADVYVTI 191

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
           R  + RI+IA Q ++  ++   +  L++ +G  ++L + + E  +   E+ IP LE    
Sbjct: 192 RGLQARIAIARQQVETRRQLFAMVRLQYGKGVAAELQMNQAEGSLTQAEAQIPVLEAGLD 251

Query: 228 MNVHNISTLLGY-PATEFLHYMQKQSNNFQPNLYIP--INIGIPADLIRNRPDIRYQEKK 284
             ++ +  LLG  P T      + +  +  P   +P     G PA+LIR RPD+   E++
Sbjct: 252 SAMNALDVLLGVQPGT-----YRTELASVAPVPVVPGLAETGTPAELIRRRPDLIAAERR 306

Query: 285 LADSVAKIGIAKSDLYPSLS----LNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKI 340
           LA + A+IG+  S+ YP LS    L  + A+   N F G  +       L   +FD G++
Sbjct: 307 LAAANARIGVVVSEYYPKLSLAALLGSATAIASGNLFTGAASQAQGVLGLRWRLFDFGRV 366

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
            + I  A     E    ++  VL A ++VENA+ ++ + +  V  L        ++   S
Sbjct: 367 DAQIAAARGQEAEALAAYRLAVLRATEDVENAIEALVKREAQVGILTRGESSLARARENS 426

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +  Y+ G  SL+++LD +    +     + A+ + A++ +  + A+G G++
Sbjct: 427 LAAYKGGVVSLIEVLDADGKLLEARDAKAQAETEAARAAIASFRALGGGWD 477


>gi|295691161|ref|YP_003594854.1| NodT family RND efflux system outer membrane lipoprotein
           [Caulobacter segnis ATCC 21756]
 gi|295433064|gb|ADG12236.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Caulobacter segnis ATCC 21756]
          Length = 469

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 125/469 (26%), Positives = 223/469 (47%), Gaps = 29/469 (6%)

Query: 4   LRAIFSLFIVLLAG-CTVGPEYTKPHMPLL------PTQFSIGNSKNLINIDTLKWWESF 56
           LRA     + L A  C VGP Y  P  P        P  F+  N +         WW++F
Sbjct: 8   LRAALIAGVALTAAACAVGPNYRAPATPPAAFQNADPAVFTAANPEA-------AWWKAF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYA----SISHRFIPNL 112
            D  L++LV  AL  NL +  A  R+  A+      + D+ P   A    + S +  P L
Sbjct: 61  GDPVLDQLVGQALSANLDLRIALARVAEARALFTEQKLDVLPHVTADGTYTKSKQQQPGL 120

Query: 113 KTNS------TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
            T+           D+ W+IDLFG+ RR +E++ A   +A A +  A++ V +++  +Y+
Sbjct: 121 TTDRIESQTYQAGFDARWEIDLFGRVRRGVEAAGAEAGAAQADLRDAQVTVAAEVARNYL 180

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
           + R  +ER+ +A++ L   ++ + L+ ++F  GA S + +   +A + + E+ IP+L  +
Sbjct: 181 ELRGAQERLKVANRNLATQRETLRLTKVRFDAGAGSPIDVASAQARLNATEAAIPSLITA 240

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
                + ++ L G         +  +  + +P L   + IG     +R RPD++  E++L
Sbjct: 241 ATRANYRLAVLTGQRPGALDALLVAREADTRP-LVAALPIGEAGQFLRRRPDVQAAERRL 299

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTH---WSFGPKLYLPIFDKGKIKS 342
           A S A++G+A +DL+P +S+ G +      S    N+    WS  P +  P  D G   +
Sbjct: 300 AASTAQVGVATADLFPRVSVTGFVGFLSGTSTGFGNSASQAWSVAPTVSWPALDLGSAHA 359

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            +R A +        +   VL A++++ENAL +  + +  +  L       +++  L+ I
Sbjct: 360 RLRAARARDDAALAAYDRAVLLALEDLENALVAYRQQQAQLKSLADQAAASRRAAELARI 419

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            YR+G    L +LD ER     E  L++A+  +    V +Y A+G G+ 
Sbjct: 420 QYREGGIDFLVLLDAERTLLAAEDALTVAETGVNTDVVAIYKALGGGWT 468


>gi|296156033|ref|ZP_06838872.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. Ch1-1]
 gi|295893539|gb|EFG73318.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. Ch1-1]
          Length = 547

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 126/509 (24%), Positives = 238/509 (46%), Gaps = 76/509 (14%)

Query: 13  VLLAGCTVGPEYTKPHMPLLPTQF----------SIGNSKNLINIDTL------KWWESF 56
           +LL+ CTVGP++  P   + P Q+          +  ++ N+ ++ TL      +WW +F
Sbjct: 28  MLLSACTVGPDFHAPKADV-PDQWHDTQRSTATATGASAANVASVPTLDTDPDPRWWRNF 86

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHR--------F 108
           ND +L+ LV  A + NL + +A  RI  A+  + S  A   P+  A+ S++        F
Sbjct: 87  NDPTLDALVGRAARGNLDLQEAVLRIVEARTQVQSAAAQGLPNVRATGSYQREQLGVKGF 146

Query: 109 I--------------PNLKTNSTG---------------------------QLDSDWKID 127
           +              PN   N+                               D+ W++D
Sbjct: 147 LESDGVYDKVDQLGAPNSPVNAVAPGAGATLQNGANNLLNQLTAPVNLWQAGFDASWELD 206

Query: 128 LFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKK 186
           LFG+ RR +E++ A  ++A    + A L++ +++  +Y+  R  +   +I   ++D  ++
Sbjct: 207 LFGRVRRSVEAANAQTEAAVESRNDALLSLEAEVAQTYMQLRGAQALHAITASLVDEQRE 266

Query: 187 NIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLH 246
            + L+  +   G TS+L +    A++   ++ +P  E+     ++ ++ L+G P      
Sbjct: 267 IVTLTQSQAKVGLTSELDVKSATAQLAQTQAQLPQYEQQIAQALNGLAYLVGEPPGALEA 326

Query: 247 YMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLN 306
            +   +      +   + +G+P+ L R RPD+R  E  L  + A +G+A +  YP +SL 
Sbjct: 327 ELDAPAAVP--PVPPVVPVGLPSTLARRRPDVRRAEASLHSATANVGVAVAQFYPDVSLT 384

Query: 307 GSIALTHDNSFPGYNTHWS-----FGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQET 361
           G +     N+     + WS     FGP + LPIF  G + SN+R +++   E  + +++T
Sbjct: 385 GQVGTRATNA--SDLSRWSHLFYSFGPSISLPIFQGGALVSNLRLSKAQEAEAALDYRKT 442

Query: 362 VLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERAT 421
           VL A+++V+NAL     D+     L  +V   + +  L+  +YR+G  S +++LD ER  
Sbjct: 443 VLMALRDVDNALAVYRTDQARRDSLSESVAAEQAAFDLARDSYRKGITSFINVLDAERQL 502

Query: 422 AKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           A+     +    Q++   V LY A+G G+
Sbjct: 503 AQARQQYAQGTMQVSTDLVSLYKALGGGW 531


>gi|186474286|ref|YP_001861628.1| RND efflux system outer membrane lipoprotein [Burkholderia phymatum
           STM815]
 gi|186475415|ref|YP_001856885.1| RND efflux system outer membrane lipoprotein [Burkholderia phymatum
           STM815]
 gi|184191874|gb|ACC69839.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia phymatum STM815]
 gi|184196618|gb|ACC74582.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia phymatum STM815]
          Length = 496

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 124/468 (26%), Positives = 222/468 (47%), Gaps = 30/468 (6%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPT-QFSIGNSKNLINIDTLKWWESFNDTSL 61
           +L  + +   + L+GC +GP+Y++P + +  T +F    + ++ N +   WW+ F+D  L
Sbjct: 6   VLGPLCAFCALTLSGCLLGPDYSRPQVEVPATYRFPENYASDVANTE---WWKQFDDPVL 62

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS---TG 118
           N L+  AL  N  +  A  R++      ++ RA LFP   A +       + T+S   TG
Sbjct: 63  NDLITAALANNNDVKIAAARVDQFLGQFVTTRAALFPQVSAGLDAAR-ERVSTSSPLFTG 121

Query: 119 -----------QLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYID 166
                       L + W+IDLFG  RR  E++ A+L S         L ++S +  SYI+
Sbjct: 122 VQNPVFNSYQLALSASWEIDLFGHNRRLTEAARASLLSTEEARRGTILTLVSSVASSYIN 181

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
            R    ++ IA        +++ +  L+F  G  S++ L + ++E +   + IP +E   
Sbjct: 182 LRSLDRQLEIAKATTASRAESVHVFELRFQGGEVSQMELAQSQSEYEDSRARIPQIESQI 241

Query: 227 RMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP-INIGIPADLIRNRPDIRYQEKKL 285
                 +S LLG    + L             L  P +  G+P++L+  RPD+R  E+ L
Sbjct: 242 AQQEDALSVLLGRNPGDILR------GRALGELAAPAVPAGLPSNLLERRPDLRQAEQDL 295

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A+IG AK+  +P +S+ G +          F G    WSF   +  PIF+ G I  
Sbjct: 296 VAANAQIGAAKALYFPQISITGLLGTQSGQFSRLFTGPARVWSFAGSVTQPIFEGGAIAG 355

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            +++AE+  Q+   T+++ +  A +EV++AL S  + ++        V+       L+ +
Sbjct: 356 QVKQAEAVQQQALYTYRKAIQVAFQEVDDALISSQKLREQFEVQGRQVQALATYAHLARL 415

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            Y  G  S +++LD ER+    ++  +  +  +  SYV LY A+G G+
Sbjct: 416 RYEGGYTSYIEVLDAERSLFNAQLSETQTQAGVLVSYVSLYKAMGGGW 463


>gi|220903590|ref|YP_002478902.1| NodT family RND efflux system outer membrane lipoprotein
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
 gi|219867889|gb|ACL48224.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
          Length = 531

 Score =  175 bits (443), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 123/475 (25%), Positives = 230/475 (48%), Gaps = 29/475 (6%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQF-SIGNSKNLINIDTLKWWESFNDT 59
           M +  A+F L + +L+ C++ P Y +P M + P Q+ ++      +N D   WW  FND 
Sbjct: 10  MRLTGAVFVLSVFMLSACSLAPRYERPEMDM-PAQWRTVDMGAAPLNTD---WWNRFNDP 65

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS------SYASISHRFIPNL- 112
            L  LV  AL+ N  I ++  +I++A   +    ADL PS      S A  +    PN  
Sbjct: 66  VLTALVDEALKNNQDIAESLAKIDSAASQVGIATADLLPSVSGSASSMAQGASEKTPNTM 125

Query: 113 --------KTNSTGQ--LDSDWKIDLFGQRRHIESSLAN-LDSAYAQVDIAKLNVISKLI 161
                   +T +T Q  L + W++DL+G+ R+  + L++ L S     +  +L+V  +  
Sbjct: 126 PFDKSGLSRTTATNQAALSASWELDLWGKNRNNYTMLSDVLMSTVIGHEALRLSVAGQTA 185

Query: 162 PSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPT 221
            SY        ++  A + L   +    +   ++ QG  ++L   +  AE++   + + T
Sbjct: 186 QSYFALLALDMQLDTARRTLKTREDAFSIYSSRYKQGDITELDWQRARAEVEIARAQVHT 245

Query: 222 LEKSFRMNVHNISTLLGYPATEFLHYM--QKQSNNFQPNLYIPINIGIPADLIRNRPDIR 279
              +       ++ LLG    + +     + Q+    P+  + +  G+P+DL++ RPD+R
Sbjct: 246 STVAVDRAEAGLAVLLGRSPRDIMERGMPRGQAIGMLPSPPV-LPEGLPSDLLQRRPDVR 304

Query: 280 YQEKKLADSVAKIGIAKSDLYPSLSLNG---SIALTHDNSFPGYNTHWSFGPKLYLPIFD 336
             E  L  + A IG+A++  +PS+SL G   +++    + F G    WS+G    +P+ D
Sbjct: 305 AAEFMLMANNANIGVARAQFFPSVSLTGMLGTVSAAVGSLFTGPAGAWSYGVTGSMPLLD 364

Query: 337 KGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKS 396
            G+   N++ AE+  +     +++TV  A +++  +LT+  E   IV  +Q  VE  +++
Sbjct: 365 FGRTWYNVKDAEARKKASVAVYRKTVQTAFEDMRTSLTAQREADAIVRSMQIQVESLRRA 424

Query: 397 MSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            +++ + Y  G    L +LD ER     E+ L+ A R    + V + +A+G G+N
Sbjct: 425 TTIARLQYDNGYTDYLTVLDAERQLFAAELQLASALRDRLDNVVSVCMALGGGWN 479


>gi|161523168|ref|YP_001586097.1| RND efflux system outer membrane lipoprotein [Burkholderia
           multivorans ATCC 17616]
 gi|189348010|ref|YP_001941206.1| RND efflux system outer membrane lipoprotein [Burkholderia
           multivorans ATCC 17616]
 gi|160346721|gb|ABX19805.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia multivorans ATCC 17616]
 gi|189338148|dbj|BAG47216.1| RND efflux system outer membrane lipoprotein [Burkholderia
           multivorans ATCC 17616]
          Length = 502

 Score =  175 bits (443), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 130/477 (27%), Positives = 233/477 (48%), Gaps = 45/477 (9%)

Query: 6   AIFSLFIVLLAGC-TVGPEYTKPHM-----PLLPTQFSIGNSKNLINIDTL--KWWESFN 57
           A  +     L  C +VGP+YT P       PL        N   L++ D +   WW+ ++
Sbjct: 10  ATLAPLAFALGACKSVGPDYTLPQQAYVNAPLANHALDDANG-TLVSHDAVPGNWWQLYD 68

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADL--------FPSSYASISHRF- 108
           D +LN LV+ AL  N  +     R+ AA  N+   RA L        F     +   R  
Sbjct: 69  DPALNDLVRSALTSNTDL-----RVAAA--NLARSRAALEVANQQGGFSGRTEAAVQRAQ 121

Query: 109 -----------IPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNV 156
                      +P +   S G ++  ++IDLFG+ RR +E++ A+ ++  A  D+A++ V
Sbjct: 122 ESAEQYLLENKLPVVNEGSVG-INVSYEIDLFGKLRRGVEAARADSEAVQAAADLARITV 180

Query: 157 ISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE 216
           ++ ++ +Y++A    E + IA Q + L ++ + LS      G  ++  + +   +++++ 
Sbjct: 181 VADVVRAYVEACSAGEELEIAKQSVALQRQRVALSQRLRDVGRGNQTEVTRGVTQVRTLA 240

Query: 217 SDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRP 276
           +DIP  E   ++  + ++ LL     +    + + +    P L  PI IG  A L+R RP
Sbjct: 241 ADIPRFESRRKIAQYQLAALLARAPADLPKAVTECAR--LPKLRRPIPIGDGAALLRRRP 298

Query: 277 DIRYQEKKLADSVAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLP 333
           D+R  E++LA + A+IG+A + LYPS+S+    GS+ +  D  F      WSFGP +   
Sbjct: 299 DVREAERQLAAATARIGVATAALYPSISIGASAGSVGVAAD-LFSSTTNRWSFGPLISWT 357

Query: 334 IFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELH 393
               G+ ++ +R AE++       +   VLNA++E ++++ +   D +   +L+ A E  
Sbjct: 358 FPVNGQ-RARVREAEAATGGALAHFDGVVLNALRETQSSVAAYAADVQRADELRTAYESA 416

Query: 394 KKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           + S   +   YR GR S +  LD  R    V   ++ A+ Q+A   V L++A+G G+
Sbjct: 417 RSSADETHRLYRAGRESFIADLDATRTLTSVHAQVAAAEGQVAADQVRLFLALGGGW 473


>gi|225076295|ref|ZP_03719494.1| hypothetical protein NEIFLAOT_01336 [Neisseria flavescens
           NRL30031/H210]
 gi|224952419|gb|EEG33628.1| hypothetical protein NEIFLAOT_01336 [Neisseria flavescens
           NRL30031/H210]
          Length = 474

 Score =  175 bits (443), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 125/445 (28%), Positives = 214/445 (48%), Gaps = 14/445 (3%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F      + I    L W + F D  L++L+ IAL++N  
Sbjct: 25  LSACTMMPKYEQPQVAVADT-FKYDTVDDGIRAAELGWQDYFADPRLHRLIDIALERNTD 83

Query: 75  ILQATERINAAKENILSVRADLFPSSYASIS------HRFIPNLKTNSTGQLDSDWKIDL 128
           +  A       ++  +  R +L P+  AS +                S G   + +++DL
Sbjct: 84  LRTAALNAEIYRKQYMIARNNLLPTVNASGTGSRQGSLSGGSVSSQYSVGLGAASYELDL 143

Query: 129 FGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKN 187
           FG+ R   E++L    +  A  D A L +IS +  +Y + R+ +E +++A ++L   +  
Sbjct: 144 FGRVRSTSEAALQGYFNVAANRDAAHLTLISTVAKAYFNERYAEETMALAQRVLQTREAT 203

Query: 188 IELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHY 247
            +LS L+   G  S + L + EA I+S ++D  +  K+     ++++ L+  P  E L  
Sbjct: 204 YKLSQLRHKAGVISAVDLRQQEALIESAKADYASAVKNREQARNSLAMLINQPLPEDLPA 263

Query: 248 MQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNG 307
               S  F+      +  G+ +D++ NRPDIR  E  L  + A IG A++  +P +SL G
Sbjct: 264 GLPLSKQFK---MTKLPAGLSSDVLLNRPDIRAAEHALKQANANIGAARAAFFPRISLTG 320

Query: 308 SIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLN 364
           S+          F      W+F P + LPIFD G  K+N+  A+   Q Q + ++  V +
Sbjct: 321 SVGTASGELSGLFKSGTGIWAFAPSITLPIFDWGTNKANLDVAKLRQQAQIVAYEAAVQS 380

Query: 365 AIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKV 424
           A K+V NAL +  +  K    L      +  S+ L  + Y+ G  S LD+LD ER++   
Sbjct: 381 AFKDVSNALVAREQLDKSYAALSKQSRAYNDSLRLISLRYKHGVSSALDLLDAERSSYSA 440

Query: 425 EVDLSIAKRQLAKSYVDLYIAIGSG 449
           E  L   +    ++  DLY A+G G
Sbjct: 441 ETALLANQLTRLENLADLYKALGGG 465


>gi|66045721|ref|YP_235562.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. syringae B728a]
 gi|63256428|gb|AAY37524.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. syringae B728a]
          Length = 487

 Score =  175 bits (443), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 124/470 (26%), Positives = 222/470 (47%), Gaps = 37/470 (7%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNS-KNLINIDTL---KWWESFNDTSLNK 63
             L +VLL+ C VGP+Y KP M   P QF      +     D +    WWE + D  LN 
Sbjct: 20  LGLCVVLLSACAVGPDYQKPSMAA-PAQFKAAQGWRTATPSDGMGKGAWWEVYKDPQLNA 78

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPS-------------SYASISHRFIP 110
           LV+     N T+ Q   +   A+  + S RA   P+             +  S S     
Sbjct: 79  LVERLNTSNQTVAQYDAQYRQAQTLVRSSRAAFLPTLDLTTGKTRSGQGTGTSNSGTSAS 138

Query: 111 NLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
            ++ +   QL   W+ D++G+ RR +E+  AN  ++ A +   +L++ S+L+ +Y+  R 
Sbjct: 139 GIRNSYNAQLGVSWEADVWGKLRRGLEADTANAQASLADLAAMRLSLQSELVQNYLQLRV 198

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
             E+  +    +D Y++++ L+  ++  G +   ++ + + ++KS ++D+  L       
Sbjct: 199 IDEQKRLLESTVDAYQRSLTLTQNQYRAGISGSDAVAQAQTQLKSTQADLIDLAWQRAQF 258

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP----INIGIPADLIRNRPDIRYQEKKL 285
            + I+ L+G    +F         N   +  IP    I  G+P+ L+  RPDI   E+ +
Sbjct: 259 ENAIAVLMGMAPADF---------NLPASTSIPQLPQIPPGLPSQLLERRPDIAAAERSV 309

Query: 286 ADSVAKIGIAKSDLYPSLSL---NGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG+A++  YP  +L    G  + T  N     N  WS GP+L L +FD G+  +
Sbjct: 310 MGANANIGVARAAYYPDFTLSMSGGYSSSTFANWISLPNRFWSVGPQLALTLFDGGRRSA 369

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            + R E+   +    +++TVLN  +EVEN L  +   ++     Q A+   + S+ L+  
Sbjct: 370 EVDRTEAVYDQTVAQYRQTVLNGFQEVENYLVQLKVYEQEAAVRQEALVSARDSLRLTNN 429

Query: 403 NYRQGRYSLLDILDIERATAKVEVD-LSIAKRQLAKSYVDLYIAIGSGYN 451
            Y+ G    LD+++++      E   LS+ + +L  S V L  A+G G++
Sbjct: 430 QYKAGLIGYLDVVNVQATALSNERSVLSVLQSRLIAS-VQLIAALGGGWD 478


>gi|91784639|ref|YP_559845.1| MFS efflux system, outer membrane porin [Burkholderia xenovorans
           LB400]
 gi|40019161|emb|CAE92885.1| putative outer membrane protein or channel-forming component
           [Pseudomonas putida]
 gi|91688593|gb|ABE31793.1| MFS efflux system, outer membrane porin [Burkholderia xenovorans
           LB400]
          Length = 511

 Score =  175 bits (443), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 122/472 (25%), Positives = 229/472 (48%), Gaps = 35/472 (7%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQ------FSIGNSKNLINIDTLKWWESFNDTSLN 62
           +L  + L GC VGP++ KP   L   Q      ++     +  N  +  WW  FND  L 
Sbjct: 17  ALCTISLVGCAVGPDFVKPDDRLAAVQLSPRADYAQAQETSAANFPS-SWWTLFNDDVLA 75

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS--------HRFIPNLKT 114
            L   A   NL +  A+ERI  ++  +    + L PS  AS          H     L  
Sbjct: 76  DLQARAQAGNLNLQMASERIEQSRAQLGIASSLLLPSVGASAGYSREAISEHGKFAALGA 135

Query: 115 NSTGQ------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
            ++         D+ W++DL+G+ RR  ES+ A  ++   + + A++ + +++  +Y+  
Sbjct: 136 PTSASDFWQLGFDASWELDLWGRARRSRESAAAAFEATVYEREAARVALSAEVARTYLQL 195

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTL--EKS 225
           R  + ++ I  Q L++  + + L+  +   G  ++       A++ ++E+ +P L   ++
Sbjct: 196 RGTQAQLDITRQNLEVADRTLRLAESRERNGVATRFETASARAQLATVEALVPELVQRRN 255

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINI--GIPADLIRNRPDIRYQEK 283
             MNV  ++ LLG    E    +  Q     P   +P N+  G+P++L   RPDI+  E 
Sbjct: 256 TLMNV--LALLLG----EQPRALDAQLLEAMPLPSLPSNVPVGLPSELAHRRPDIQRAEA 309

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALT--HDNSFPGYNTHW-SFGPKLYLPIFDKGKI 340
           +L  + A IG+AK+D YP + L G + +     N    +++ + S GP +YLPIF  G++
Sbjct: 310 QLHAATAAIGVAKADFYPRIGLKGRVGVEAFEFNDLDSWDSRFFSVGPTVYLPIFQGGRL 369

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           K  +   E+  +   I +++TVL A  EV+NAL +    +    +L  + E +++++  +
Sbjct: 370 KQRLALNEARQRTAAIGYRQTVLQAWHEVDNALDAWAAQQNRHAELVVSYEQNQQALHAA 429

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
              Y++G    L++L  +R     +  L+ +    A + V+LY ++G G++P
Sbjct: 430 ERGYQEGAADYLNVLAAQRGVLASQTSLNASATNAALTLVNLYKSLGGGWDP 481


>gi|223938971|ref|ZP_03630857.1| RND efflux system, outer membrane lipoprotein, NodT family [bacterium
            Ellin514]
 gi|223892398|gb|EEF58873.1| RND efflux system, outer membrane lipoprotein, NodT family [bacterium
            Ellin514]
          Length = 1392

 Score =  174 bits (442), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 143/464 (30%), Positives = 232/464 (50%), Gaps = 32/464 (6%)

Query: 12   IVLLAGCTVGPEYTKPHMPLLPTQF---SIGNSKNLINIDTL---KWWESFNDTSLNKLV 65
            + L A   VGP Y +P    +P ++    +GN K    +D L   KWWE + D +LN+L 
Sbjct: 913  VALSAKAAVGPNYVRP-TNAVPQEYKAEELGNWKEGKPLDHLPKGKWWEVYEDATLNELE 971

Query: 66   KIALQQNLTILQATERINAAKENILSVRADLFPS---SYASISHRFIPN-------LKTN 115
            + A   N  +  A  R+  A+      R +L PS     + I  RF PN       +  N
Sbjct: 972  ENASAGNQGLKGAVARVEQARATARVARGELLPSLNFDPSFIRQRFSPNQDPSFGAITAN 1031

Query: 116  S-TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
            S +  LD  ++IDL+G+ RR  ES+     ++ A      L + S +  +Y   R     
Sbjct: 1032 SFSVPLDLSYEIDLWGRVRRGFESARDQAAASLASYYSVLLTLQSDVAQNYFGLRSLDAE 1091

Query: 174  ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN- 232
            I+   + ++L K+ ++L H ++  G  S+L + + E E+ + E++   L K  R  + N 
Sbjct: 1092 IATVARTVELRKEQVQLVHGRYEGGIGSELDMARAETELANAEAEAAGLAKR-RAELENA 1150

Query: 233  ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINI--GIPADLIRNRPDIRYQEKKLADSVA 290
            I+ L+G   +EF H     + N+ P    P  I  G+PADL++ RPD+   E+ LA + A
Sbjct: 1151 IAILVGKIPSEF-HLAAGTAPNWNPQ---PPTIPAGLPADLLQRRPDVATAERNLASANA 1206

Query: 291  KIGIAKSDLYPSLSLNGS---IALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            +IG+AK+  +P +SL  S   ++   +  F   +  WS GP + LPIF  G+ K+N RR+
Sbjct: 1207 QIGVAKAAFFPVVSLTASGGYLSGDIETLFNWSSRTWSIGPSISLPIFAGGRNKANYRRS 1266

Query: 348  ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
            +++ QE   T+++ VL A  +VEN+L  I    K       AV   +++  L+   YR G
Sbjct: 1267 KAAYQEAIATYRQQVLVAFGDVENSLAGIYHLAKQSEAQNRAVASAQRAADLATERYRSG 1326

Query: 408  RYSLLDILDIERATAKVE-VDLSIAKRQLAKSYVDLYIAIGSGY 450
              S LD++D +R     E     +A ++L  S V L  A+G G+
Sbjct: 1327 LVSYLDVVDADREALTAERARAQLAGQRLVAS-VQLIKALGGGW 1369


>gi|197295316|ref|YP_002153857.1| outer membrane efflux protein [Burkholderia cenocepacia J2315]
 gi|195944795|emb|CAR57400.1| outer membrane efflux protein [Burkholderia cenocepacia J2315]
          Length = 533

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 126/522 (24%), Positives = 230/522 (44%), Gaps = 80/522 (15%)

Query: 4   LRAIFSLF--IVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL--------------INI 47
           +R   ++F    ++A CTVGP+Y  PH  +  T  ++                    ++ 
Sbjct: 1   MRRAATIFTGCAVVASCTVGPDYQPPHADVPDTWHAMRADGQAASPASDAAARSSPTVDA 60

Query: 48  DT-LKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH 106
           D   +WW +F D  L++LV+ A   NL +  A  RI  A+  + +  A   P   A+ S+
Sbjct: 61  DPDPRWWRAFGDPLLDRLVERAAHDNLDVQAAVLRIAQARAQVRAAAAQGLPDVRATASY 120

Query: 107 -------------------------------RFIPNLKTNST------------------ 117
                                          RF P                         
Sbjct: 121 QREQLGLKGIVEEQGIDQRVDRLGAPGSPLDRFGPGTGARVQQGARSAIDALEAPVNLWQ 180

Query: 118 GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISI 176
              D+ W++DLFG+ RR +E++ A   +A A  D A L++ +++  +Y+  R  + + ++
Sbjct: 181 AGFDASWELDLFGRVRRSVEAAGAQTSAAIASRDDALLSLEAEVAQTYLQLRGAQAQRAL 240

Query: 177 AHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL 236
           A  +    ++ ++L+  +   G  S L +   +A +  I + +P  ++   +  + ++ L
Sbjct: 241 ADDLQRAQRELLDLTREQAAHGLASDLDVRSADARLAQIRAQLPQFDQQIVLLRNGLAYL 300

Query: 237 LGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
           +G        ++   +    P++   + +G+P+ L R RPDIR  E +L  + A +G+A 
Sbjct: 301 VGGAPGALDDWLA--APRALPDVPPAVPVGLPSTLARRRPDIRRAEAELHAATADVGVAV 358

Query: 297 SDLYPSLSLNGSIAL--THDNSFPGYNTHWS-----FGPKLYLPIFDKGKIKSNIRRAES 349
           +  YP +SL G + L  +H         HWS     FGP + LPIF  G++ SN+R +++
Sbjct: 359 AQFYPDISLTGQVGLRASHVREL----AHWSHLFYSFGPAISLPIFSGGQLVSNLRLSQA 414

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
              E  + +++ VL A+++V+NAL     D+     L  AV+  + ++ L+   YR+G  
Sbjct: 415 RQAEAALAYRQAVLVALRDVDNALAVYRTDQARAAALDDAVKAEQGALDLARDRYRKGLS 474

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             LD+LD ER  ++          Q     V LY A+G G+ 
Sbjct: 475 PFLDVLDAERQWSEGRQQAQQGALQTTTDLVALYKALGGGWQ 516


>gi|170703516|ref|ZP_02894275.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia ambifaria IOP40-10]
 gi|170131577|gb|EDT00146.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia ambifaria IOP40-10]
          Length = 499

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 125/467 (26%), Positives = 229/467 (49%), Gaps = 49/467 (10%)

Query: 18  C-TVGPEYTKPHM-----PLLPTQFSIGN----SKNLINIDTLKWWESFNDTSLNKLVKI 67
           C +VGP+YT P       PL        N    S+N +  +   WW+ ++D  L+ LV+ 
Sbjct: 22  CKSVGPDYTLPQQAYVNAPLANHALDDANGALVSRNAVPGN---WWQLYDDPVLDALVRS 78

Query: 68  ALQQNLTILQATERINAAKENILSVRADL--------FPSSYASISHRF----------- 108
           AL+ N  +     R+ AA  N+   RA L        F  S  +   R            
Sbjct: 79  ALKSNTDL-----RVAAA--NLARSRAALEVANEQGGFSGSAEAAVQRAQESAEQYLLEN 131

Query: 109 -IPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYID 166
            +P +   + G +   +++DLFG+ RR +E++ A+ ++  A  D+A++ V++ ++ +Y++
Sbjct: 132 KLPVVNEGAVG-ISVSYELDLFGKLRRGVEAARADSEAVQAAADLARITVVADVVRAYVE 190

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
           +    + ++IA Q L L ++ ++LS      G  ++  + +   +++++ +DIP  E   
Sbjct: 191 SCSAGDELAIAKQSLALQQQRVKLSQRLRDAGRGNQTDVTRGVTQVRTLSADIPRFEGRR 250

Query: 227 RMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLA 286
           ++  + ++ LL     +    + +      P L  PI IG  A L+R RPD+R  E++LA
Sbjct: 251 KIAQYQLAALLARSPADLPKAVAECER--LPKLRQPIPIGDGAALLRRRPDVREAERQLA 308

Query: 287 DSVAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSN 343
            + A+IG+A + LYPS+S+    GS+ +  D  F      WSFGP +       G+ ++ 
Sbjct: 309 AATARIGVATAALYPSISIGASAGSVGVAAD-LFSSTTNRWSFGPLISWSFPVNGQ-RAR 366

Query: 344 IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
           +R AE++       +   VLNA++E +++L +   D +    L+ A E  + S   +   
Sbjct: 367 VREAEAATGGALAHFDGVVLNALRETQSSLATYAADVQRTDALRTAYESARNSADETHRL 426

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           Y  GR S +  LD  R    V   ++ A+ Q+A   V L++A+G G+
Sbjct: 427 YAAGRESFISDLDATRTLTSVRAQVAAAEGQVAADQVKLFLALGGGW 473


>gi|116748519|ref|YP_845206.1| RND efflux system outer membrane lipoprotein [Syntrophobacter
           fumaroxidans MPOB]
 gi|116697583|gb|ABK16771.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Syntrophobacter fumaroxidans MPOB]
          Length = 496

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 118/453 (26%), Positives = 220/453 (48%), Gaps = 27/453 (5%)

Query: 17  GCTVGPEYTKPHMPLLPT-QFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTI 75
           GCT+GP+Y +P + ++P+ +F    +++  N D   WW+ F D  L+ L+  AL  N  +
Sbjct: 15  GCTLGPDYRRPAVDVMPSYRFEERETRDTANTD---WWKEFQDPVLDSLIAEALANNRNV 71

Query: 76  LQATERINAAKENILSVRADLFPS-SYASISHR-------------FIPNLKTNSTGQLD 121
             A   I+ A   ++  RA LFP  SY+  + R             F+ N + +      
Sbjct: 72  RIAAANIDQAAGVLMQTRAPLFPQVSYSGSATRRRASERGSDVLSGFVSNPRNSFELLAG 131

Query: 122 SDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI 180
           ++W+IDL+G+ RR  E++ ANL ++        L++++ +  +YI  R   +++ I+ + 
Sbjct: 132 ANWEIDLWGRIRRLSEAARANLLASEEARRGVVLSLVASVAGTYIQLRGLDDQLEISRRT 191

Query: 181 LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP 240
           L +Y +++ L  L+F  G  S++++ +  ++ ++  + IP +E       + +STLLG  
Sbjct: 192 LAVYGESLRLFELQFAHGQVSQMTVEQARSQYETAAATIPQIESQIAQTENGLSTLLGRN 251

Query: 241 ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLY 300
                    K      P     I  G+P+ L+  RPD+   E+ L  + A+IG AK+  +
Sbjct: 252 PGPVDR--GKSIRELTPPA---IPSGLPSQLLERRPDLAQAEQNLIAANAQIGAAKALYF 306

Query: 301 PSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYIT 357
           P++SL  ++        + F G    WS+      PIF  G I   +++AE+  +    +
Sbjct: 307 PAISLTAALGTQSSELSDLFKGPARTWSYAGSFTGPIFTAGAIAGQVKQAEAMQKAALES 366

Query: 358 WQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDI 417
           +Q  +LNA  +VE+AL +  +  + +   +  V   K+   L+ + Y  G    L +L  
Sbjct: 367 YQNAILNAFSDVESALVARRKLSEQLEAQEALVRTLKEYDRLAWLQYNGGYTPYLTVLTA 426

Query: 418 ERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           E      E+  S  +  L  +YV++Y  +G G+
Sbjct: 427 ETQLFPAELTTSEVRTALMAAYVNIYKVMGGGW 459


>gi|148556611|ref|YP_001264193.1| RND efflux system outer membrane lipoprotein [Sphingomonas
           wittichii RW1]
 gi|148501801|gb|ABQ70055.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Sphingomonas wittichii RW1]
          Length = 485

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 121/470 (25%), Positives = 218/470 (46%), Gaps = 26/470 (5%)

Query: 4   LRAIFSLF-IVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLN 62
           LR    LF  + L  C VGP+Y  P      + ++   +      D ++WW +  D  L 
Sbjct: 9   LRLAVVLFSCISLTACVVGPDYHAPPSVDTGSGWTQAAAGASAPADLVRWWSTLGDPELE 68

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFP--SSYASISHR-----------FI 109
           +LV  AL QNL I QA  RI+ A+           P  S+ AS++ R            I
Sbjct: 69  RLVDTALAQNLDIRQAAARIDEARALRDRAAGQQLPAVSAGASVNRRRQSENGPLPVGSI 128

Query: 110 PNLKTNST---GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
           P L  + T      D+ W++DLFG  RR +E + A L +  A+    ++ + +++  ++ 
Sbjct: 129 PGLDASQTIYDAGFDAAWEVDLFGANRRALEGASARLQATQAEAQGVRMRIAAEVARTWF 188

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
           +A    E +      +   ++ ++L   +   G  S+  +        +  + +P +   
Sbjct: 189 EATGAGEELLTQQATVATLQQTLDLMRSRAALGDVSRADVDAAYERWAAANAMLPGIAAR 248

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP-INIGIPADLIRNRPDIRYQEKK 284
            R  V  +  LLG P    L  +    +   P   +P + +G  AD++R RPD+   E++
Sbjct: 249 QRGAVLGLGVLLGAPPERELKLL----DTAAPARVLPALPVGERADILRRRPDVLAAERR 304

Query: 285 LADSVAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIK 341
           LA S A IG+A ++L+P LS+    G  AL+  + F   +T +S  P +   +FD G+++
Sbjct: 305 LAASTADIGVATAELFPKLSIGAGGGFQALSPGDWFDSSSTRYSILPLISWRLFDGGRVR 364

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           + IR  E++ ++  + +++ VL A+ + E  L   N     +T+ Q A++  ++S   + 
Sbjct: 365 AEIRVREAAQRQAALGYEQAVLAALGDAERTLGDYNASLDTLTRHQAALDASRRSFDHAE 424

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             +  G  + +++L  +R   + E     A+   A   V LY AIG G+N
Sbjct: 425 ARFAAGDITRIELLAAQRLLHEAETANLRARTTAAVQMVALYKAIGGGWN 474


>gi|319638633|ref|ZP_07993395.1| MtrE protein [Neisseria mucosa C102]
 gi|317400382|gb|EFV81041.1| MtrE protein [Neisseria mucosa C102]
          Length = 474

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 125/445 (28%), Positives = 214/445 (48%), Gaps = 14/445 (3%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F      + I    L W + F D  L++L+ IAL++N  
Sbjct: 25  LSACTMMPKYEQPQVAVADT-FKYDTVDDGIRAAELGWQDYFADPRLHRLIDIALERNTD 83

Query: 75  ILQATERINAAKENILSVRADLFPSSYASIS------HRFIPNLKTNSTGQLDSDWKIDL 128
           +  A       ++  +  R +L P+  AS +                S G   + +++DL
Sbjct: 84  LRTAALNAEIYRKQYMIARNNLLPTVNASGTGSRQGSLSGGSVSSQYSVGLGAASYELDL 143

Query: 129 FGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKN 187
           FG+ R   E++L    +  A  D A L +IS +  +Y + R+ +E +++A ++L   +  
Sbjct: 144 FGRVRSTSEAALQGYFNVAANRDAAHLTLISTVAKAYFNERYAEETMALAQRVLQTREAT 203

Query: 188 IELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHY 247
            +LS L+   G  S + L + EA I+S ++D  +  K+     ++++ L+  P  E L  
Sbjct: 204 YKLSQLRHKAGVISAVDLHQQEALIESAKADYASAVKNREQARNSLAMLINQPLPEDLPA 263

Query: 248 MQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNG 307
               +  F+      +  G+ +DL+ NRPDIR  E  L  + A IG A++  +P +SL G
Sbjct: 264 GLPLNKQFK---MTKLPAGLSSDLLLNRPDIRAAEHALKQANANIGAARAAFFPRISLTG 320

Query: 308 SIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLN 364
           S+          F      W+F P + LPIFD G  K+N+  A+   Q Q + ++  V +
Sbjct: 321 SVGTASGELSGLFKSGTGIWAFAPSITLPIFDWGTNKANLDVAKLRQQAQIVAYEAAVQS 380

Query: 365 AIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKV 424
           A K+V NAL +  +  K    L      +  S+ L  + Y+ G  S LD+LD ER++   
Sbjct: 381 AFKDVSNALVAREQLDKSYAALSKQSRAYNDSLRLISLRYKHGVSSALDLLDAERSSYGA 440

Query: 425 EVDLSIAKRQLAKSYVDLYIAIGSG 449
           E  L   +    ++  DLY A+G G
Sbjct: 441 ETALLANQLTRLENLADLYKALGGG 465


>gi|197123995|ref|YP_002135946.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Anaeromyxobacter sp. K]
 gi|196173844|gb|ACG74817.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Anaeromyxobacter sp. K]
          Length = 483

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 124/452 (27%), Positives = 228/452 (50%), Gaps = 17/452 (3%)

Query: 7   IFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL---KWWESFNDTSLNK 63
           + SL    LA C VGP Y +P +P  P   +          D      WW +F+D  L  
Sbjct: 11  VTSLASFALAACAVGPRYVRPELPERPAWAAAAPGTRAAGADEALLASWWSAFDDPLLAS 70

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS-HRFIPNLKTNSTGQ--- 119
           LV+ A   NL +LQA  R+  A+    +  A+L PS  AS S  R  P+ ++   G    
Sbjct: 71  LVERAATSNLGLLQARARVREARARRGAAVAELAPSVTASTSASRSWPSEQSGGGGAADL 130

Query: 120 ----LDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
               LD+ W++DLFG +RR  E++ A+ ++A       ++++++++  SY+  R  + R+
Sbjct: 131 FQAGLDASWELDLFGGKRRASEAAAASAEAALEDARDVRVSLVAEVGLSYLGLRTTEARL 190

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
           ++A + L   ++  +L+  +   G T++L + +  A ++   + +P LE++   + + ++
Sbjct: 191 AVARRNLAALQETADLTRWRAEAGLTTQLDVEQARASLEQQRAAVPQLERTAASDRNALA 250

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
            LLG         +   ++   P +   + +G+PAD +R RPD+R  E++LA   A++G+
Sbjct: 251 VLLGLQPGALDAELA--ASRPVPAVSREVALGVPADALRRRPDVRRAERELAAQTAQVGV 308

Query: 295 AKSDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           A++  +PSL+L+GSI   AL   +   G     S G  L  PIFD G++   +    +  
Sbjct: 309 AQAARFPSLTLSGSIGLEALAAGDLVAGNAVTSSLGAGLLAPIFDAGRLARAVEVQAAVL 368

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
            E  + ++  VL A++EVE+AL + + ++     L  A     ++ +L+   Y+ G  + 
Sbjct: 369 DESLLAYRAAVLTALQEVEDALYAFDREQARRAALAEAEGAASQAAALARDQYQAGLVAF 428

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLY 443
             +LD ER    V+  L+ +  ++A   V L+
Sbjct: 429 TAVLDAERTLLGVQDSLAASDGEVASDLVRLF 460


>gi|326385330|ref|ZP_08206975.1| putative outer membrane protein oprJ [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326210136|gb|EGD60908.1| putative outer membrane protein oprJ [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 527

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 134/501 (26%), Positives = 232/501 (46%), Gaps = 60/501 (11%)

Query: 4   LRAIFS--LFIVLLAGCTVGPEYTKPHMPLLPTQF----SIGNSKNLINIDTLKWWESFN 57
           LR + S  L + +L GCTVGP Y     P  P Q+       +S       T +WWE + 
Sbjct: 11  LRRLLSATLSLAVLGGCTVGPNYHHTVQPA-PAQWHESLPAADSHVTTQPITARWWELYG 69

Query: 58  DTSLNKLVKIALQQNLTILQATERINA--AKENILSVRADLFP-----SSYASISHRFIP 110
           D  L  L +  +  NL +  A+ R++   A+ NI   RA   P     +SYA    R  P
Sbjct: 70  DPELTSLEEQVVAGNLDLRIASSRLDQSLAERNI--ARAARLPHVDGAASYA--RERASP 125

Query: 111 N-----LKTN---STGQLDSD----------------------------WKIDLFGQ-RR 133
           N     L T    STG + S                             W++DL+G  RR
Sbjct: 126 NGVMSLLGTGVNQSTGTIASGQQGFGPAAASGSSGSSDFDLPQYGVSASWEVDLWGHVRR 185

Query: 134 HIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHL 193
            IE + A L +A  Q     ++++++    YI  R  + +I++  Q LD  K+ ++L+ L
Sbjct: 186 QIEVANATLQAAQDQRRDILVSLMAETASDYIALRSVQAQIALTGQNLDTAKRLVDLTRL 245

Query: 194 KFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSN 253
           +  +GA+++        ++   E+ +P L       ++ +S L+G         + K   
Sbjct: 246 REREGASARFETAAANGQMHDFEARLPALRSQEAHLLNALSFLVGREPGALTAELGK--V 303

Query: 254 NFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSI---A 310
              P +   + +G+P+ L   RPD+R  E+KL  + A IG+A S+ +P L+L+GS+   A
Sbjct: 304 KAVPPVPKDLPVGLPSQLAERRPDVRMAEEKLHAATASIGVAISEFFPRLTLSGSLDIQA 363

Query: 311 LTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVE 370
           L   N     +  + FGP + LP+F+ GK+K  +R   +  +E  I  Q T+L A +E++
Sbjct: 364 LQFGNLGTWASRQYGFGPTMTLPLFEGGKLKGQVRLRRAEQREAAIALQRTMLKAWQEID 423

Query: 371 NALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSI 430
           +A+  ++  +    +L   VE ++ ++ ++   Y  G    L +L ++      E+ L+ 
Sbjct: 424 DAMADLSAAQTRRGRLADEVEANRVALDMAQRQYEAGSGDFLRVLTMQATLQTNEITLTE 483

Query: 431 AKRQLAKSYVDLYIAIGSGYN 451
           A   +A +   LY A+G G++
Sbjct: 484 AGADIASASTRLYRALGGGWD 504


>gi|284800004|ref|ZP_05985449.2| multiple transferable resistance system protein MtrE [Neisseria
           subflava NJ9703]
 gi|284796353|gb|EFC51700.1| multiple transferable resistance system protein MtrE [Neisseria
           subflava NJ9703]
          Length = 474

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 125/445 (28%), Positives = 213/445 (47%), Gaps = 14/445 (3%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F      + I    L W + F D  L++L+ IAL++N  
Sbjct: 25  LSACTMMPKYEQPQVAVADT-FKYDTVDDGIRAAELGWQDYFADPRLHRLIDIALERNTD 83

Query: 75  ILQATERINAAKENILSVRADLFPSSYASIS------HRFIPNLKTNSTGQLDSDWKIDL 128
           +  A       ++  +  R +L P+  AS +                S G   + +++DL
Sbjct: 84  LRTAALNAEIYRKQYMIARNNLLPTVNASGTGSRQGSLSGGSVSSQYSVGLGAASYELDL 143

Query: 129 FGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKN 187
           FG+ R   E++L    +  A  D A L +IS +  +Y + R+ +E +++A ++L   +  
Sbjct: 144 FGRVRSTSEAALQGYFNVAANRDAAHLTLISTVAKAYFNERYAEETMALAQRVLQTREAT 203

Query: 188 IELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHY 247
            +LS L+   G  S + L + EA I+S ++D  +  K+     ++++ L+  P  E L  
Sbjct: 204 YKLSQLRHKAGVISAVDLRQQEALIESAKADYASAVKNREQARNSLAMLINQPLPEDLPA 263

Query: 248 MQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNG 307
               S  F+      +  G+ +D++ NRPDIR  E  L  + A IG A++  +P +SL G
Sbjct: 264 GLPLSKQFK---MTKLPAGLSSDVLLNRPDIRAAEHALRQANANIGAARAAFFPRISLTG 320

Query: 308 SIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLN 364
           S+          F      W+F P + LPIFD G  K+N+  A+   Q Q + ++  V +
Sbjct: 321 SVGTASGELSGLFKSGTGIWAFAPSITLPIFDWGTNKANLDVAKLRQQAQIVAYEAAVQS 380

Query: 365 AIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKV 424
           A K+V NAL +  +  K    L      +  S+ L  + Y+ G  S LD+LD ER+    
Sbjct: 381 AFKDVSNALVAREQLDKSYDALSKQSRAYNDSLRLISLRYKHGVSSALDLLDAERSNYSA 440

Query: 425 EVDLSIAKRQLAKSYVDLYIAIGSG 449
           E  L   +    ++  DLY A+G G
Sbjct: 441 ETALLANQLTRLENLADLYKALGGG 465


>gi|121595243|ref|YP_987139.1| RND efflux system outer membrane lipoprotein [Acidovorax sp. JS42]
 gi|120607323|gb|ABM43063.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Acidovorax sp. JS42]
          Length = 511

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 121/470 (25%), Positives = 229/470 (48%), Gaps = 31/470 (6%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSI------GNSKNLINIDTLKWWESFNDTSLN 62
           +L  + L GC VGP++ KP   L   Q S        N  +  N  +  WW  FND  L 
Sbjct: 17  ALCTISLVGCAVGPDFVKPDDRLATVQLSPRADYAQPNETSAANFPS-SWWTLFNDPVLA 75

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPS-------SYASIS-HRFIPNLKT 114
            L   A   NL +  A+ERI  ++  +    + L PS       S  +IS H     L  
Sbjct: 76  GLQSRAQAGNLNLQIASERIEQSRAQLGIASSLLLPSVGVSAGYSREAISEHGKFAALGA 135

Query: 115 NSTGQ------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
            ++         ++ W++DL+G+ RR  E + A  ++   + + A++ + +++  +Y+  
Sbjct: 136 PTSASDFWQLGFEASWELDLWGRARRSREGAAAAFEATVYEREAARVALSAEVARAYLQL 195

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
           R  + ++ I  Q L++  + + L+  +   G  ++       A++ ++E+ +P L +   
Sbjct: 196 RGAQAQLDITRQNLEVADRTLRLAESRERNGVATRFETSSARAQLATVEALVPELVQRRN 255

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINI--GIPADLIRNRPDIRYQEKKL 285
             ++ ++ LLG    E    +  Q     P   +P N+  G+P++L   RPDI+  E +L
Sbjct: 256 TLMNALALLLG----EEPRALDAQLLEAMPLPSLPSNVPVGLPSELAHRRPDIQRAEAQL 311

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALT--HDNSFPGYNTHW-SFGPKLYLPIFDKGKIKS 342
             + A IG+AK+D YP + L G + +     N    +++ + S GP +YLPIF  G++K 
Sbjct: 312 HAATAAIGVAKADFYPRIGLRGRVGVEAFEFNDLDSWDSRFFSVGPTVYLPIFQGGRLKQ 371

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            +   E+  +   I +++TVL A  EV+NAL +    +    +L+ + E +K+++  +  
Sbjct: 372 RVALNEARQRTAAIAYRQTVLQAWHEVDNALDAWAAQQNRHAELRVSYEQNKQALHAAER 431

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            Y++G    L++L  +R     +  L+ +    A + V+LY ++G G++P
Sbjct: 432 GYQEGAADYLNVLAAQRGVLASQTSLNASATNAALTLVNLYKSLGGGWDP 481


>gi|115360753|ref|YP_777890.1| RND efflux system outer membrane lipoprotein [Burkholderia
           ambifaria AMMD]
 gi|115286081|gb|ABI91556.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia ambifaria AMMD]
          Length = 499

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 125/467 (26%), Positives = 231/467 (49%), Gaps = 49/467 (10%)

Query: 18  C-TVGPEYTKPHM-----PLLPTQFSIGN----SKNLINIDTLKWWESFNDTSLNKLVKI 67
           C +VGP+YT P       PL        N    S+N +  +   WW+ ++D  L+ LV+ 
Sbjct: 22  CKSVGPDYTLPQQAYVNAPLANHALDDANGALVSRNAVPGN---WWQLYDDPVLDALVRS 78

Query: 68  ALQQNLTILQATERINAAKENILSVRADL--------FPSSYASISHRF----------- 108
           AL+ N  +     R+ AA  N+   RA L        F  S  +   R            
Sbjct: 79  ALKSNTDL-----RVAAA--NLARSRAALEVANEQGGFSGSAEAAVQRAQESAEQYLLEN 131

Query: 109 -IPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYID 166
            +P +   + G ++  +++DLFG+ RR +E++ A+ ++  A  D+A++ V++ ++ +Y++
Sbjct: 132 KLPVVNEGTVG-INVSYELDLFGKLRRGVEAARADSEAVQAAADLARITVVADVVRAYVE 190

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
           +    + ++IA Q L L ++ ++LS      G  ++  + +   +++++ +DIP  E   
Sbjct: 191 SCSAGDELAIAKQSLALQQQRVKLSQRLRDAGRGNQTDVTRGVTQVRTLSADIPRFEGRR 250

Query: 227 RMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLA 286
           ++  + ++ LL     +    + +      P L  PI IG  A L+R RPD+R  E++LA
Sbjct: 251 KIAQYQLAALLARSPADLPKAVAECER--LPKLRQPIPIGDGAALLRRRPDVREAERQLA 308

Query: 287 DSVAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSN 343
            + A+IG+A + LYPS+S+    GS+ +  D   P  N  WSFGP +       G+ ++ 
Sbjct: 309 AATARIGVATAALYPSISIGASAGSVGVAADLFSPTTN-RWSFGPLISWSFPVNGQ-RAR 366

Query: 344 IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
           +R AE++       +   VLNA++E +++L +   D +    L+ A E  + S   +   
Sbjct: 367 VREAEAATGGALAHFDGVVLNALRETQSSLATYAADVQRTDALRTAYESARNSADETHRL 426

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +  GR S +  LD  R    V   ++ A+ Q+A   V L++A+G G+
Sbjct: 427 FVAGRESFISDLDATRTLTSVRAQVAAAEGQVAADQVKLFLALGGGW 473


>gi|222102783|ref|YP_002539822.1| nodulation protein T precursor [Agrobacterium vitis S4]
 gi|221739384|gb|ACM40117.1| nodulation protein T precursor [Agrobacterium vitis S4]
          Length = 490

 Score =  174 bits (440), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 125/469 (26%), Positives = 234/469 (49%), Gaps = 41/469 (8%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSI-----GNSKNLINIDTLKWWESFNDTSLN 62
            SL +V L+ C V    +   +  L  ++       G++  L++     WW +FND +L+
Sbjct: 21  LSLIVVPLSAC-VAVTQSNVDISKLANRWHATLPHSGSTAQLVD-----WWNTFNDPALS 74

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPS-----SY------ASISHRFIPN 111
           +L++ A   + T+  A   I  A+  + S +AD FPS     SY       S ++R  P+
Sbjct: 75  ELLRTAEANSPTLESAVAEIEEARATLASSKADYFPSLTGSGSYDRSGTRGSKANRVAPS 134

Query: 112 LKTNSTGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
             T  TG+LD+ W++D FG+ R+ +E++   +    A    A++ + +++   Y+  +  
Sbjct: 135 --TTGTGELDASWELDFFGKTRNTVEAARQRVAEETADWYDARVTLAAEVADDYVQYKGC 192

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQG--ATSKLSLVKLEAE-----IKSIESDIPTLE 223
           ++   I    L   ++ ++ + +    G  ++S L+L+K  A      +KS  +D   L 
Sbjct: 193 RQLQGIYAAELVSQQQTVKATEVSTASGLKSSSDLALIKASAASTSSSLKSQVADCEVLI 252

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           KS       I+ L+     +    + K S+       + ++  IPA++IR RPD+   EK
Sbjct: 253 KS-------ITELVAVDEDKVRDILNKSSSKIPRPAKLSVD-AIPANVIRQRPDVNALEK 304

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSN 343
           + A S+A +  AK+DLYPS SL+G++  +H  S  G +  WSFGP + +PIFD G +++ 
Sbjct: 305 EAAASLADVATAKADLYPSFSLSGTLTASHSTS-SGTSLPWSFGPAVSIPIFDGGSLRAT 363

Query: 344 IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
           ++  E++ +    +++  VL AI  VE A+ +++  ++ +     A + ++        N
Sbjct: 364 VKYKEAAYKAAIASYKSGVLTAINAVETAMVNVDSTERQIGDAVVAAKNYRAYFKAIDTN 423

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           ++ G  S+LD  D  R     E+ L   +R   + ++ LY A+G G+ P
Sbjct: 424 WKAGGASVLDREDARRELQAAELTLVENQRDAVRDWIALYKAMGGGWTP 472


>gi|221212236|ref|ZP_03585214.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia multivorans CGD1]
 gi|221168321|gb|EEE00790.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia multivorans CGD1]
          Length = 501

 Score =  174 bits (440), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 129/465 (27%), Positives = 230/465 (49%), Gaps = 45/465 (9%)

Query: 18  C-TVGPEYTKPHM-----PLLPTQFSIGNSKNLINIDTL--KWWESFNDTSLNKLVKIAL 69
           C +VGP+YT P       PL        N   L++ D +   WW+ ++D +LN LV+ AL
Sbjct: 22  CKSVGPDYTLPQQAYVNAPLANHALDDANG-TLVSHDAVPGNWWQLYDDPALNDLVRSAL 80

Query: 70  QQNLTILQATERINAAKENILSVRADL--------FPSSYASISHRF------------I 109
             N  +     R+ AA  N+   RA L        F     +   R             +
Sbjct: 81  TSNTDL-----RVAAA--NLARSRAALEVANQQGGFSGRTEAAVQRAQESAEQYLLENKL 133

Query: 110 PNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
           P +   S G ++  ++IDLFG+ RR +E++ A+ ++  A  D+A++ V++ ++ +Y++A 
Sbjct: 134 PVVNEGSVG-INVSYEIDLFGKLRRGVEAARADSEAVQAAADLARITVVADVVRAYVEAC 192

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
              E + IA Q + L ++ + LS      G  ++  + +   +++++ +DIP  E   ++
Sbjct: 193 SAGEELEIAKQSVALQRQRVALSQRLRDVGRGNQTEVTRGVTQVRTLAADIPRFESRRKI 252

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
             + ++ LL     +    + + +    P L  PI IG  A L+R RPD+R  E++LA +
Sbjct: 253 AQYQLAALLARAPADLPKAVTECAR--LPKLRRPIPIGDGAALLRRRPDVREAERQLAAA 310

Query: 289 VAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
            A+IG+A + LYPS+S+    GS+ +  D  F      WSFGP +       G+ ++ +R
Sbjct: 311 TARIGVATAALYPSISIGASAGSVGVAAD-LFSSTTNRWSFGPLISWTFPVNGQ-RARVR 368

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
            AE++       +   VLNA++E +++L +   D +   +L+ A E  + S   +   YR
Sbjct: 369 EAEAATGGALAHFDGVVLNALRETQSSLAAYAADVQRADELRTAYESARSSADETHRLYR 428

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            GR S +  LD  R    V   ++ A+ Q+A   V L++A+G G+
Sbjct: 429 AGRESFIADLDATRTLTSVHAQVAAAEGQVAADQVRLFLALGGGW 473


>gi|119386161|ref|YP_917216.1| RND efflux system outer membrane lipoprotein [Paracoccus
           denitrificans PD1222]
 gi|119376756|gb|ABL71520.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Paracoccus denitrificans PD1222]
          Length = 458

 Score =  174 bits (440), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 129/437 (29%), Positives = 234/437 (53%), Gaps = 16/437 (3%)

Query: 20  VGPEY-TKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQA 78
           VGP+   +P +P+ P  F  G + +   + +  +W  + D  LN L+   L+QNL    A
Sbjct: 22  VGPDPDARPAIPV-PATFVEGEAASAGKLASRAFWAEYRDPVLNDLIARGLKQNLDEAAA 80

Query: 79  TERINAAKENI--LSVRADLFPSSYASISHRFIPN---LKTNSTGQLDSDWKIDLFG-QR 132
            ERI AA  ++    V A     + ++   R       ++T     L +++  DLFG  R
Sbjct: 81  RERIRAAAADLRGTGVLAGQVSGTASAARERGASAGGAVQTAGNSSLGANFVFDLFGGAR 140

Query: 133 RHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSH 192
           R  + + A+L+SA A +  A+L  I++LI +Y DAR++++ +++  + +   ++ + ++ 
Sbjct: 141 RERQGAAASLESAKAGLGTARLAWIAELIDAYGDARYYRQALALTRKTVSTREETVRITR 200

Query: 193 LKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQS 252
            +   G  S+  + + EA + +  ++IP  +  +   V  I+TLL  PA+     M++ S
Sbjct: 201 DQREFGVVSEFDMAQAEALLAAARAEIPGYQAQYDAQVFAIATLLNEPASSVQAQMRRGS 260

Query: 253 NNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALT 312
              QP +      G+PADL+RNRPD+R  E  LA ++A +G+A +DL PSLSL GS+   
Sbjct: 261 G--QPRIPGSARAGVPADLLRNRPDLRSAEYDLAAALATVGVATADLLPSLSLTGSV--- 315

Query: 313 HDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENA 372
              S  G    W FGP +  P+ ++G +++   R  + A+E  I W+  V  A+++V+ A
Sbjct: 316 ---SESGGAKSWGFGPAISFPVLNQGALQATRARRIAEAREAEIAWRAAVSQAVEDVQVA 372

Query: 373 LTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAK 432
            +++   ++    L+ A   + ++  L+  ++ +G  +LLD+LD +R+TA   +  + A+
Sbjct: 373 QSNLRRYREQAAALEGAAAAYDRAYQLARTSFAEGELALLDLLDSDRSTASARLSAASAR 432

Query: 433 RQLAKSYVDLYIAIGSG 449
            Q AK +  L IA G+G
Sbjct: 433 NQAAKEWAALQIATGAG 449


>gi|302343075|ref|YP_003807604.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfarculus baarsii DSM 2075]
 gi|301639688|gb|ADK85010.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfarculus baarsii DSM 2075]
          Length = 500

 Score =  174 bits (440), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 123/451 (27%), Positives = 227/451 (50%), Gaps = 24/451 (5%)

Query: 20  VGPEYTKPHMPLLPTQFSIGNS---KNLINIDTLKWWESFNDTSLNKLVKIALQQNLTIL 76
           VGP++  P +   P ++S   +   ++  N+D   WW +F+D  L  L++ A+  N  + 
Sbjct: 32  VGPDFQPPQVET-PAKWSAEQAAKPQSDQNVDLTAWWRAFDDPLLESLIQRAVAANPDLK 90

Query: 77  QATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQ-------------LDSD 123
            A  R+  A        A L PS  AS S+    + +T+S GQ              D+ 
Sbjct: 91  LAEARVRQAMAQRGVSLAALGPSLDASGSYSRGQS-RTSSGGQYAGSNIGDQYVAGFDAS 149

Query: 124 WKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILD 182
           W++D+FG  RR +ES+ A + +         + + +++  +Y+  R  ++RI +A   L 
Sbjct: 150 WELDIFGGARRGLESADAQIRANVEDRRDVLVTLTAEVASNYLALRTTQQRIDVAQNNLA 209

Query: 183 LYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPAT 242
             ++  +++  ++  G  + L   + +A++ S  + IP LE + R  +HNI+ LLG P  
Sbjct: 210 AQQRTAQITIKRYQAGFANGLESAQAQAQVASTAAQIPALEATARQTMHNIAILLGQPPA 269

Query: 243 EFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPS 302
             +  +   +         P+ +  PADL+R RPDIR  E ++  + A IG+A ++L+P 
Sbjct: 270 ALVAELSAAAPAPLTPPTPPLGL--PADLLRRRPDIRRAEAEIHVATANIGVATAELFPK 327

Query: 303 LSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQ 359
           +++ GS   +   +   F   N  WSFGP +   +F  G+ K+ I   +   ++  I ++
Sbjct: 328 INIIGSSGYSASQAASWFTPANLIWSFGPSVSWNLFGSGRTKAQIEVQKMLEEQAVIAYR 387

Query: 360 ETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIER 419
           +TVL A++EVE+AL    ++ +    L  AV+ ++K+++LS+  Y QG    L +L+ +R
Sbjct: 388 QTVLTAMREVEDALIVSGKEVQRRALLAQAVQANQKAVALSLELYTQGHGDFLSVLEAQR 447

Query: 420 ATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +    +  L+ +    A   V LY A+G G+
Sbjct: 448 SLYSAQDSLAQSAGGAATDMVALYKALGGGW 478


>gi|301058945|ref|ZP_07199914.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [delta proteobacterium NaphS2]
 gi|300446941|gb|EFK10737.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [delta proteobacterium NaphS2]
          Length = 496

 Score =  173 bits (439), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 120/483 (24%), Positives = 234/483 (48%), Gaps = 45/483 (9%)

Query: 10  LFIVLLAGCTVGPEYTKPHM--PLLPTQFSIGNSKNLINIDT----LKWWESFNDTSLNK 63
           L +V L GC +GP+YT+P +  P     +  G+      I +     +WW+ ++D  L+ 
Sbjct: 13  LLLVSLGGCALGPDYTRPDVAAPDSWDDWHSGDDALHAKIGSGPLHTEWWKDYHDPVLDD 72

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST------ 117
           LV  AL  +  I  A  R   A+  +    +  FP   A+ S  +   L  + T      
Sbjct: 73  LVARALGASPDIETAALRFVQARIQMQVTSSRQFPELKATGSATY-NRLSEHGTATRLYD 131

Query: 118 -------------------------GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDI 151
                                    G LD  W+ID +G   R++E++ A      A +++
Sbjct: 132 EIGDEIGFDKDIVVDILSDPFAWYQGGLDFSWEIDFWGHVARNVEAAGAGAAEQAAMLEV 191

Query: 152 AKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAE 211
           A+L+VI  L+ +Y   R  + +I ++ + + + ++ + +   + + G  +   +   +A 
Sbjct: 192 ARLSVIGDLVNAYWSLRRVQRQIQLSREDIRVVEERLAIQQAQASGGLINHGEIADQKAG 251

Query: 212 IKSIESDIPTLEKSFRMNVHNISTLLG-YPAT--EFLHYMQKQSNNFQPNLYIPINIGIP 268
           + +I++ +P L+     +++ I  L+G +P    + L    ++S+  Q +    +N+G+P
Sbjct: 252 LAAIQAGLPALQAGESRDMNRILLLVGEHPGALQDLLKARGRESDKVQEDNLPALNMGLP 311

Query: 269 ADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALT--HDNSFPGYNTH-WS 325
           + +   RPD+R  E +L  + AKIG+A+++LYP ++L  S+ L       F  + +  WS
Sbjct: 312 STVALRRPDVRAAEARLHQATAKIGVARAELYPGITLGASLGLDSYQGKDFVDWGSRVWS 371

Query: 326 FGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTK 385
            GP L LP+F+ G++K+ +   E + QE  I + +TVL A  E+++ L+     ++ + K
Sbjct: 372 IGPSLSLPLFNHGRLKNTVLLREKAQQEAAIAFHQTVLGAWHEIDDGLSRYEAARQALIK 431

Query: 386 LQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIA 445
            Q  +   +++ +L    +R G  S L +LD  R   + E DL+ ++  L  ++  + +A
Sbjct: 432 QQKRMHNAREACTLLNARFRGGNGSYLSVLDGRRNVLRAERDLAESRENLCTAFAAVNMA 491

Query: 446 IGS 448
           IG+
Sbjct: 492 IGN 494


>gi|332308345|ref|YP_004436196.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332175674|gb|AEE24928.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 460

 Score =  173 bits (439), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 124/471 (26%), Positives = 222/471 (47%), Gaps = 40/471 (8%)

Query: 2   NILR-AIFSLFIVLLAGCTVGPEYTKP----HMPLLPTQFSIGNSKNLINIDTLKWWESF 56
           NIL+    +  I  LA C VGP+Y  P    ++ L  T      ++ L N     WW +F
Sbjct: 3   NILKIGTLAGLISALAACAVGPDYQAPTKANNIELAST---YEQAEKLTN-----WWHAF 54

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
            D  LN+L+  AL++N T+ QA   +  A         DL P    +  +    N+    
Sbjct: 55  GDEDLNQLIDQALKENRTLFQAQANVLRAYAIFRDSDNDLLPKGSLNAGYEAGKNITL-- 112

Query: 117 TGQLDSD---------------WKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKL 160
              L+SD               W +DLFG+ RR IE+SLA  + A      A+L +IS++
Sbjct: 113 ---LESDDDTIARGYNAGANLTWDVDLFGKVRRAIEASLAEAEQADILWHDAQLQIISQV 169

Query: 161 IPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIP 220
             +Y D R  + R+ +A Q L   ++   +   +F  G  S+L + +++A++  +E+ +P
Sbjct: 170 AATYGDYRGAQFRLKVAEQNLANLRQTRTIVKARFQAGFASELEMARIDAQVFQVEASVP 229

Query: 221 TLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRY 280
            +          +S LL     E     + +     P L  P+ +    + +R R D+  
Sbjct: 230 QMRNLLARADATLSALLAKKPGELALSTEPEL----PQLSKPVALVPGENYLRYRADVAS 285

Query: 281 QEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDN--SFPGYNTHWSFGPKLYLPIFDKG 338
            E+ LA S A+IG+A +DLYP++S++G +        +  G    WS  P +     D G
Sbjct: 286 SERALAASTARIGVATADLYPNVSVSGFLGFLSGPGLTLGGDTKSWSVAPTISWQAADLG 345

Query: 339 KIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMS 398
            IK+ IR+AE+++      +++ V +A+ +++ +L S N  ++     +H  +  +++M+
Sbjct: 346 SIKARIRQAEANSDIALAQFEQQVFDALADMQFSLQSYNFSRQQQQSTEHQWQASERAMT 405

Query: 399 LSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           L+   +  G    L++L+ +R   +    L++ ++Q     VD+Y A G G
Sbjct: 406 LARQRFEAGSGEFLELLEAQRDALQSREQLAVQEQQSFNRLVDIYRAFGGG 456


>gi|170721627|ref|YP_001749315.1| RND efflux system outer membrane lipoprotein [Pseudomonas putida
           W619]
 gi|169759630|gb|ACA72946.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Pseudomonas putida W619]
          Length = 471

 Score =  173 bits (439), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 124/453 (27%), Positives = 227/453 (50%), Gaps = 25/453 (5%)

Query: 18  CTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK--WWESFNDTSLNKLVKIALQQNLTI 75
           C VGP+Y  P     P + +        +    +  WW+ F+D  LN+LV+ +L  N  +
Sbjct: 19  CAVGPDYKAPDTE--PARLASDVQAKAFDRSRFESVWWKQFDDPVLNQLVQASLDGNRDL 76

Query: 76  LQATERINAAKENILSVRADLFP--SSYAS--ISHRFIP---NLKTNSTG---QLDSDWK 125
             A  R+ +A+        D  P  +S AS  I    +P   + + NS      LD  W+
Sbjct: 77  RVAFARLKSARAIRDDAANDQLPVVTSRASSEIGKGQVPGQTDQRVNSERYDLGLDMAWE 136

Query: 126 IDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR--HFKERISIAHQILD 182
           +DLFG+ +R IE+S A   +A A +   ++++I++L+ +Y   R    +E+I++A+  L 
Sbjct: 137 LDLFGRIQRQIEASDAQAAAAQADLQQLQVSLIAELVDAYGQLRGAQLREKIAVAN--LK 194

Query: 183 LYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPAT 242
             +++  ++      G  ++L +V+ +A +  +E+ +P L+       H I+TLLG    
Sbjct: 195 TQQESRSITVTLRDAGVGNELDVVRADARLAGVEATVPQLQAEQARARHRIATLLGQRPD 254

Query: 243 EFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPS 302
                +   S    P +   + +G P +L+R RPDIR  E++LA + A +G+A +DL+P 
Sbjct: 255 ALSVDL---SPKALPAIAKALPVGDPGELLRRRPDIRSAERQLAAATANVGVATADLFPR 311

Query: 303 LSLNGSIALTH-DNSFPGYNTH--WSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQ 359
           +SL+G +  T    S  G +    W  GP +    FD G +++ +R A++ A+     ++
Sbjct: 312 VSLSGFLGFTAARGSQIGSSAANAWGLGPSITWAAFDLGSVRARLRGAKADAEGALANYE 371

Query: 360 ETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIER 419
           + VL A++E  NA +  ++ ++ +  L    +  +K+  L+ + YR+G    L +LD ER
Sbjct: 372 QQVLLALEESANAFSDYDKTQQRLLSLMRQSDASRKAADLASVRYREGTVDYLVLLDAER 431

Query: 420 ATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
                E   +  +  L +  V +Y A+G G+ P
Sbjct: 432 ERLSAEDAQAQGEVDLYRGIVSIYKALGGGWQP 464


>gi|307725976|ref|YP_003909189.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. CCGE1003]
 gi|307586501|gb|ADN59898.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. CCGE1003]
          Length = 486

 Score =  173 bits (439), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 121/481 (25%), Positives = 231/481 (48%), Gaps = 42/481 (8%)

Query: 4   LRAIFSLFIVLLAGCTVGPEYTKPHMP--------LLP--TQFSIGNSKNLINIDTLK-- 51
           ++A+  +  + L+GC VGP++  P  P         LP  T  S G +      DT +  
Sbjct: 1   MKALLVVCAIALSGCAVGPDFKAPGAPDTQTYTPNALPERTVSSDGPNGASQTFDTARGV 60

Query: 52  ---WWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADL-FPSSYASISHR 107
              WW  F   +LN+LV  AL QN T+ QA  R+  A++N  ++     FP   A++S  
Sbjct: 61  MPMWWHEFKSDALNRLVDEALHQNPTLAQARARLIQAQQNYTALAGTTQFPGIDATLSGA 120

Query: 108 ---------FIPNLKTNS-----TGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIA 152
                     IP++++          +   +  D+FG  RR +E+S+A +D    ++D A
Sbjct: 121 RQKVDPAAFGIPHVESAGPFSLFGASVSVSYVFDIFGGNRRALEASMAQVDYESYELDAA 180

Query: 153 KLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEI 212
           +L++   ++ + +     +E+I++  ++ D   + + ++  +F  G  S+L +      +
Sbjct: 181 RLSIAGNIVSTAVQRASLREQIALTERLADAQAQQLSITEARFAAGGVSQLDVRSQRTLL 240

Query: 213 KSIESDIPTLEKSFRMNVHNISTLLGYPATE--FLHYMQKQSNNFQPNLYIPINIGIPAD 270
               + +P L        H ++ LLG   ++  F H      ++ Q  L+IP+ +  P+ 
Sbjct: 241 AQTRALLPPLATQLAAADHQLAILLGRAPSQADFEHLT---FDSLQLPLHIPLTL--PSA 295

Query: 271 LIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFG 327
           L R RPDI+  E  L ++ A +G+A ++LYP  +L+  I        +   G N  W+ G
Sbjct: 296 LARARPDIKAAEALLHEASANVGVATANLYPQFALSAGIGSQRTRVGDIVNGLNI-WNVG 354

Query: 328 PKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQ 387
             L  PIF  G++ +  R AE++    +  +++ VL A+++V ++L+++  D + +    
Sbjct: 355 LNLTQPIFHGGELHAKKRAAEAAHDGAFANYRQVVLQALQQVADSLSAVQNDARELQART 414

Query: 388 HAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIG 447
            A +  + S++++   Y  G  S L +LD ER + +  +D + A+         L+ A+G
Sbjct: 415 EAAQEAQASLNVATERYAAGGISQLALLDAERQSLQTTLDRTRAQANRFSDTAALFQALG 474

Query: 448 S 448
           S
Sbjct: 475 S 475


>gi|325525698|gb|EGD03454.1| RND efflux system outer membrane lipoprotein [Burkholderia sp.
           TJI49]
          Length = 505

 Score =  173 bits (439), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 124/483 (25%), Positives = 225/483 (46%), Gaps = 51/483 (10%)

Query: 13  VLLAGCTVGPEY-TKPHMPLLPTQFSIGNSKNLINIDT-----LKWWESFNDTSLNKLVK 66
            +LAGCTVGP+Y   P  P  PT F    +   + +D       +WW + ND  L++L+ 
Sbjct: 26  CVLAGCTVGPDYRGAPAAPDAPT-FVRAPA---VGVDAGAPAPSEWWRALNDRQLDELIV 81

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFPSSYASIS--------------------- 105
            AL  N  +  A  R+  A+  +   RA   P S A+++                     
Sbjct: 82  AALAFNPDMHAAQARLREARAQLTQQRAAQLPKSSATVAAIRMREPDISALGSLLPSSSS 141

Query: 106 ----HRFIPNLKTNSTGQL-------DSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAK 153
                   P      +G L       D+ W+IDLFG  RR +E++ A  ++  A +   +
Sbjct: 142 GQSGTSGSPASSLGGSGPLQLYSAGFDATWEIDLFGGTRRAVEAASAQAEAVDADLADTQ 201

Query: 154 LNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIK 213
           +++ +++  +Y+D R  ++R++++ +   L ++ +EL+  +  +G  +   + +L  +++
Sbjct: 202 VSLAAEVATAYVDLRDQQQRLALSQRTAALQQRMLELTQQRRARGVAADADIERLTTQVE 261

Query: 214 SIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIR 273
           +  + +  L+     ++  ++ L G  A   L      +N   P L   + IG PA L++
Sbjct: 262 NTRASLIPLDAQVTESLDRLAILTGR-APGALDAELSSANAPLPTLPATVPIGDPAALLK 320

Query: 274 NRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGY-----NTHWSFGP 328
            RPDIR  E++LA S A+IG   +D +P ++L G +  +  +  PG+     N  W   P
Sbjct: 321 QRPDIRSAERRLAASNAQIGEHIADYFPKVTLLGDLGFSATD--PGHLFRKQNFTWIGAP 378

Query: 329 KLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQH 388
            L   I D G+ +  +R AE+S  E    +++ VL A+++   AL      ++ V  L  
Sbjct: 379 YLQWNILDFGRTRGAVRAAEASRDEAEANYRKAVLGALQDANTALQRYGHQREHVVALTK 438

Query: 389 AVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGS 448
                  S SL    YR G  S++D+LD +R     + ++   + +L K YV L  ++G 
Sbjct: 439 VQASATHSASLMDERYRAGVASMIDLLDTQREALSAQQNVIAGQAELLKDYVSLQKSLGL 498

Query: 449 GYN 451
           G+ 
Sbjct: 499 GWQ 501


>gi|270158445|ref|ZP_06187102.1| NodT family efflux transporter [Legionella longbeachae D-4968]
 gi|289166717|ref|YP_003456855.1| outer membrane efflux protein [Legionella longbeachae NSW150]
 gi|269990470|gb|EEZ96724.1| NodT family efflux transporter [Legionella longbeachae D-4968]
 gi|288859890|emb|CBJ13876.1| putative outer membrane efflux protein [Legionella longbeachae
           NSW150]
          Length = 517

 Score =  173 bits (439), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 122/472 (25%), Positives = 225/472 (47%), Gaps = 36/472 (7%)

Query: 7   IFSLFI-VLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
           IF+L I ++L+ C VGP Y +P  P+         S          WW+ F+D  L  L+
Sbjct: 4   IFTLAISLMLSACMVGPNYKEPIKPVAAHWPQKNASVKETPFKDTNWWQVFHDPVLTSLI 63

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH-------------RFIPNL 112
                 NLT+     R+   +  +     +L+P   A++S                 P  
Sbjct: 64  YQGYHNNLTLQATGVRVLQTRALLAQSVGELYPQQQAAVSSFNYYKIGGSELQTVLPPTF 123

Query: 113 KTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
           +T S G   ++W+ID +G+ RR I+++ A   S+ A  D A + + + +  +YI+ R ++
Sbjct: 124 ETLSLG-FSANWEIDFWGKYRRAIQANDAVFLSSLAAYDNALVTLTADVATTYINIRMYE 182

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
            +I +  Q + + ++ + ++  ++  G T+ + + + + E+   E+ +P LE S     +
Sbjct: 183 TKIKVTKQNIVVQREGLNIARARYNAGQTNLIDVEQAQTELSQTEASLPPLESSLEQQKN 242

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPIN-----IGIPADLIRNRPDIRYQEKKLA 286
            ++ LLG       + ++K          IPI      +GIP + +  RPDI     +  
Sbjct: 243 ALALLLGTVPNGVDNQLRKSRG-------IPIAPSTVAVGIPKETLARRPDIYEARLEAV 295

Query: 287 DSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGY--------NTHWSFGPKLYLPIFDKG 338
              AKIG  K++L+PSL+LNG+ + + +N  P          N + + GP L  PI + G
Sbjct: 296 SESAKIGEIKANLFPSLALNGTFSFSSNNIGPNSLSDLFQPSNRNITAGPSLTWPILNYG 355

Query: 339 KIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMS 398
           +I + +R  +++ Q+  + +   VL A +EV+N++T+  E KK    L  A     K++ 
Sbjct: 356 QITNAVRAQDAAYQQSLLRYVNLVLKAQQEVQNSITAYIEAKKAERALTTANIAAVKTLK 415

Query: 399 LSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           L++I Y +G      +L+ E+    V+  L  A+  +  + V LY A+G G+
Sbjct: 416 LAIIRYMEGETDFTPVLNAEQQQLSVQTSLVSAQANIPAALVSLYRALGGGW 467


>gi|85860352|ref|YP_462554.1| type I secretion outer membrane protein [Syntrophus aciditrophicus
           SB]
 gi|85723443|gb|ABC78386.1| type I secretion outer membrane protein [Syntrophus aciditrophicus
           SB]
          Length = 503

 Score =  173 bits (438), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 135/474 (28%), Positives = 239/474 (50%), Gaps = 40/474 (8%)

Query: 5   RAIFSLFIVLLAGC-TVGPEYTKPHMPLLP---TQFSIGNSKNLINIDTL-KWWESFNDT 59
           RA+  L  ++L+GC TVGP+YT P   L     T    G +       +L KWW + ND 
Sbjct: 18  RALM-LAALILSGCATVGPDYTPPATELSKSWHTPLKSGLTAEETGPASLEKWWTNLNDP 76

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQ 119
            L+ L+  A+  N  + +A  R+  A+ +    RA LFP+   S S     + +    G 
Sbjct: 77  ELSSLMTRAIAGNRDLRKARARVRQARASRGVTRAGLFPTLDVSSSATRSRSSEETGGGT 136

Query: 120 --------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                   LD+ W++DLFG  RR +E++ A+L ++   +  A +++++++  +Y++ R +
Sbjct: 137 TSSFYVAGLDAGWELDLFGGVRRSVEAAEADLQASQEDLRDALVSLLAEVALNYVEVRKY 196

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           ++ +++A   L   ++  EL+  +   G + +L++ +    ++   S IPTL        
Sbjct: 197 QDLLTVAESNLATQQETFELTRWRQQAGLSDELAVQQARYNLERTRSQIPTLRTGLEEAK 256

Query: 231 HNISTLLG-YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
           +N++ LLG  P T  LH   ++     P     +  G+PAD++  RPD+R  E++LA   
Sbjct: 257 NNLAVLLGEQPGT--LHGELEERKPV-PVANPAVAAGVPADVLLQRPDVRRAERELAAQT 313

Query: 290 AKIGIAKSDLYPSLSLNGSIAL-----------THDNSFPGYNTHWSFGPKLYLPIFDKG 338
           A+IG+A ++LYP  +L+GSI L               +  G    W         IFD  
Sbjct: 314 ARIGVATAELYPKFTLSGSIGLEAFSSSNLFSSGSRTAGGGAGVTWR--------IFDAR 365

Query: 339 KIKSNIRRAESSAQEQYITWQET-VLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSM 397
            I+ NI   +++ QEQ +T  ET VLNA+KEVENALT+  E+++    L  AV   +++ 
Sbjct: 366 AIRQNIE-VQTALQEQALTGYETAVLNALKEVENALTAYAEEEQRRQALSEAVSAAQQAA 424

Query: 398 SLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             +   Y+ G      +L+ +R+   ++ +L+ +   +  + + LY A+G G+ 
Sbjct: 425 RQAGYKYQSGLADFDSVLEAQRSLLILQEELAQSNGAVLSNLIRLYKALGGGWT 478


>gi|299069037|emb|CBJ40286.1| putative outer membrane chanel lipoprotein [Ralstonia solanacearum
           CMR15]
          Length = 524

 Score =  173 bits (438), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 118/471 (25%), Positives = 213/471 (45%), Gaps = 43/471 (9%)

Query: 18  CTVGPEYTKPHMPLL--PTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTI 75
           C VGP+Y  P +  +  P  +      +   +   +WWE F+D +L +L++ A   + T+
Sbjct: 33  CAVGPDYRAPRLAGVEAPAGWHATLPHHGSRMMLARWWEQFHDPALTQLIEQADVDSPTL 92

Query: 76  LQATERINAAKENILSVRADLFPS---------------------------SYASISHRF 108
            QA  R+  A+ ++ S RA LFP                            S  S+S   
Sbjct: 93  AQAVGRVREARASVSSSRAALFPQLKGSGSAVRQGGFGGSQVLGGAGGTGVSATSVSPTL 152

Query: 109 IPNLKTNSTGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
                T      D  W++DLFG +RR +E + A LD++ A    A++ + +++  +Y+  
Sbjct: 153 GLGTFTTLAATADVSWELDLFGGKRRSLEGADARLDASLADWHDARVTLSAEVASTYLQQ 212

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
           R  +  ++I    L   ++ ++L+  KF  G  +   L + +A +    + + +      
Sbjct: 213 RECEALVAIGETTLASRQETLQLTERKFGAGFVAPADLAQAQATVADATNALESQRAQCA 272

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQ--PNLYIPINIGIPADLIRNRPDIRYQEKKL 285
             +  + TL G         +   +      P+  +P    +PA ++  RPD+   E+ +
Sbjct: 273 QGLDRLVTLTGLDHAALAALLASGTGRMPAPPDAAVPD---VPAQVLSQRPDVSSAERAV 329

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHDNSF--PGYN---THWSFGPKLYLPIFDKGKI 340
           A + A IG+A +   PSL+L GSI +   N+F   G +     WSFGP + LP+FD G  
Sbjct: 330 AGASADIGVAVASRLPSLTLAGSIGI---NTFRISGQSLTSKSWSFGPSVSLPLFDGGSG 386

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
            + +  A +   +    ++  V  A +EVE+AL  ++   + +     A   + K +  +
Sbjct: 387 AARVETARARYDQALAAYRAKVRQAAQEVEDALVRLDAAGRRLDAAAVADAQYAKVLQAA 446

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
              YR G  SLL + D+ RAT      L+  + + A+++V LY A+G G+ 
Sbjct: 447 SARYRLGAGSLLQLEDVRRATLSASQSLAAVRLERAQAWVALYKAVGGGWR 497


>gi|312961194|ref|ZP_07775699.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           fluorescens WH6]
 gi|311284852|gb|EFQ63428.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           fluorescens WH6]
          Length = 471

 Score =  173 bits (438), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 132/470 (28%), Positives = 228/470 (48%), Gaps = 41/470 (8%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK----WWESFNDTSLNKL 64
           SL ++ L+ C VGP+Y K   P      +  ++K     D  K    WW+ F+D +LN+L
Sbjct: 9   SLLVLALSACAVGPDY-KTQTPEAANITAAADAKQ---YDHAKFEGIWWQQFDDPTLNQL 64

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQ----- 119
           V  +LQ N  +  A  R+ AA+        D  P+  + +S       K    GQ     
Sbjct: 65  VTQSLQGNRDLRVAFARLRAARAIRDDASNDAMPTITSRVSS---DQGKGQVPGQTSRRI 121

Query: 120 --------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR-- 168
                   LD  W++DLFG+ +R++E++ A+  +A A +   ++ +I++L+ +Y   R  
Sbjct: 122 KTERYDLGLDMAWELDLFGRIQRNLEATDADQQAAEADLYQLQVTMIAELVDAYGQLRGA 181

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFT---QGATSKLSLVKLEAEIKSIESDIPTLEKS 225
             +ERI+     LD  K   E   +  +    G   +L + + +A + ++E+ +P L+  
Sbjct: 182 QLRERIA-----LDNLKNQQESRTITVSLRDAGVGDQLDVERADARLAAVEASVPQLQAE 236

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
                + I+TLLG    +    +   S    P +   + IG P  L++ RPDI   E+KL
Sbjct: 237 QVRERNRIATLLGQRPDKLSVGL---SPKDLPAIAKALPIGDPGQLLQRRPDILSAERKL 293

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKS 342
           A + A+IG+AK+DL+P +SL+G +  T              WS GP +    FD G +++
Sbjct: 294 AAATARIGVAKADLFPRVSLSGFLGFTAGRGSQIGSAAANAWSLGPSITWAAFDLGSVRA 353

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            +R A++ A     T+++ VL A++E ENA +   + ++ +  L    E  + +  L+ I
Sbjct: 354 RLRGADAEADGALATYEQQVLLALEESENAFSDYGKRQQRLVSLIRQSESSRAAADLAAI 413

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            YR+G    L +LD +R     E   + A+  L +  V +Y A+G G+ P
Sbjct: 414 RYREGTVDFLVLLDAQRERLAAEDTQAQAEVDLYRGIVAIYKALGGGWQP 463


>gi|302038615|ref|YP_003798937.1| efflux transporter outer membrane factor lipoprotein [Candidatus
           Nitrospira defluvii]
 gi|300606679|emb|CBK43012.1| Efflux transporter, outer membrane factor lipoprotein [Candidatus
           Nitrospira defluvii]
          Length = 506

 Score =  173 bits (438), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 126/487 (25%), Positives = 226/487 (46%), Gaps = 48/487 (9%)

Query: 6   AIFSLFIVL---LAGCTVGPEYTKPHMP-------LLPTQFSIGNSKNLINIDTLKWWES 55
           AI ++ ++L    +GC  GP Y +P +        +     + G ++ +   D   WW++
Sbjct: 11  AISTVLVMLSLSASGCLQGPNYHRPPVDTPADWTRMASGPLAAGATETMPEAD---WWQA 67

Query: 56  FNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFP-----SSYASI--SHRF 108
           F++  L + V+ AL QN  + +A  R+   + ++ +  A L+P      SY++I  S   
Sbjct: 68  FHNQELTQFVERALAQNHDVRRAVSRVLEGRASVTTAGAGLYPQLNVQGSYSNIVVSKNT 127

Query: 109 IPNL--------------KTNST-----GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQ 148
           +  L              K  S+     G  D  W++D++G+ RR +E++ A+  +    
Sbjct: 128 LAGLGLATGQQPGPQVFAKPGSSFDLWNGAADLRWELDVWGRIRRGMEAASADAQAIEQD 187

Query: 149 VDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKL 208
                L ++  +  SY   R   E+I IA + L L + ++++   + + G  S L + + 
Sbjct: 188 ARAIALTLVGDVGQSYFRIRELDEQIEIAQRALTLRRDSLDIITKRASVGLASDLDVKRT 247

Query: 209 EAEIKSIESDIPTLEKSFRMNVHNISTLLG-YPATEFLHYMQKQSNNFQPNLYIPINIGI 267
           E  +      IP L +   + +H +  L G  P +  L     +    QP     I +G+
Sbjct: 248 EVLVAESAGQIPDLTRLRAVELHRLEVLTGSAPGSVVLAPTSLRKVIVQPE----IPVGL 303

Query: 268 PADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHW 324
           P+ L+  RPDI   E  L  + A+IG A++  +P+LS+ G   L      N F G + ++
Sbjct: 304 PSQLLERRPDILQAEASLVAANARIGQARAYFFPTLSITGQGGLQSAEFVNWFSGNSANF 363

Query: 325 SFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVT 384
           S GP + LPIF  G   + +  AES  Q+    +Q+T+L A +EV + L SI    + + 
Sbjct: 364 SIGPSVTLPIFLGGTNVARLEAAESRYQQMLEGYQQTILLAFREVADLLVSIQSRSEQLA 423

Query: 385 KLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYI 444
           + +        ++ L+ + YR+G  + LD+LD +R     E  L+  +R      V LY 
Sbjct: 424 RQREQATAATAAVGLAEVRYRKGLVNYLDVLDAQRTMLAAETQLAQTERARLTDMVGLYK 483

Query: 445 AIGSGYN 451
           A+G G+ 
Sbjct: 484 ALGGGWQ 490


>gi|221199116|ref|ZP_03572161.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia multivorans CGD2M]
 gi|221205374|ref|ZP_03578390.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia multivorans CGD2]
 gi|221175165|gb|EEE07596.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia multivorans CGD2]
 gi|221181567|gb|EEE13969.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia multivorans CGD2M]
          Length = 501

 Score =  173 bits (438), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 129/465 (27%), Positives = 230/465 (49%), Gaps = 45/465 (9%)

Query: 18  C-TVGPEYTKPHM-----PLLPTQFSIGNSKNLINIDTL--KWWESFNDTSLNKLVKIAL 69
           C +VGP+YT P       PL        N   L++ D +   WW+ ++D +LN LV+ AL
Sbjct: 22  CKSVGPDYTLPQQAYVNAPLANHALDDANG-TLVSHDAVPGNWWQLYDDPALNDLVRSAL 80

Query: 70  QQNLTILQATERINAAKENILSVRADL--------FPSSYASISHRF------------I 109
             N  +     R+ AA  N+   RA L        F     +   R             +
Sbjct: 81  TSNTDL-----RVAAA--NLARSRAALEVANQQGGFSGRTEAAVQRAQESAEQYLLENKL 133

Query: 110 PNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
           P +   S G ++  ++IDLFG+ RR +E++ A+ ++  A  D+A++ V++ ++ +Y++A 
Sbjct: 134 PVVNEGSVG-INVSYEIDLFGKLRRGVEAARADSEAVQAAADLARITVVADVVRAYVEAC 192

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
              E + IA Q + L ++ + LS      G  ++  + +   +++++ +DIP  E   ++
Sbjct: 193 SAGEELEIAKQSVALQRQRVALSQRLRDVGRGNQTEVTRGVTQVRTLAADIPRFESRRKI 252

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
             + ++ LL     +    + + +    P L  PI IG  A L+R RPD+R  E++LA +
Sbjct: 253 AQYQLAALLARAPADLPKAVTECAR--LPKLRRPIPIGDGAALLRRRPDVREAERQLAAA 310

Query: 289 VAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
            A+IG+A + LYPS+S+    GS+ +  D  F      WSFGP +       G+ ++ +R
Sbjct: 311 TARIGVATAALYPSISIGASAGSVGVAAD-LFSSTTNRWSFGPLISWTFPVNGQ-RARVR 368

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
            AE++       +   VLNA++E +++L +   D +   +L+ A E  + S   +   YR
Sbjct: 369 EAEAATGGALAHFDGVVLNALREPQSSLAAYAADVQRADELRTAYESARSSADETHRLYR 428

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            GR S +  LD  R    V   ++ A+ Q+A   V L++A+G G+
Sbjct: 429 AGRESFIADLDATRTLTSVHAQVAAAEGQVAADQVRLFLALGGGW 473


>gi|146307206|ref|YP_001187671.1| RND efflux system outer membrane lipoprotein [Pseudomonas mendocina
           ymp]
 gi|145575407|gb|ABP84939.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Pseudomonas mendocina ymp]
          Length = 462

 Score =  173 bits (438), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 126/459 (27%), Positives = 228/459 (49%), Gaps = 20/459 (4%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINID-TLKWWESFNDTSLNKLVKI 67
           +L  + L+ C VGP+Y  P     P + +   + +         WW+ F+D +LN+LV+ 
Sbjct: 7   ALLTLALSACAVGPDYRAPVTE--PARIAALEAADYDRSRFEAAWWQQFDDPTLNQLVQR 64

Query: 68  ALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF----IPNLKTNSTGQ---- 119
           +LQ N  +  A  R+ AA+     V  D  P+  +  S  F     P +      Q    
Sbjct: 65  SLQDNRELRVAFNRLRAARAIRDDVANDRLPTVTSRASGEFGKAQQPPVSEERIRQERYD 124

Query: 120 --LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISI 176
             LD  W++DLFG+ +R +E+S A ++ A A     ++++I++L+ +Y   R  + R SI
Sbjct: 125 LGLDMAWELDLFGRIQRQLEASEARIEVAEADYYQLQVSLIAELVDAYGTLRGAQLRESI 184

Query: 177 AHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL 236
           A + L   + +  ++      G  ++L +++ +A + + E+ +P L+       + I+TL
Sbjct: 185 ARENLKNQQDSRGITEQLRDAGVGNELDVLRADARLAATEASLPQLQAQQVRAQNRIATL 244

Query: 237 LGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
           LG    +    +   S    P +   + IG P++L+R RPDI+  E++LA + A++G+A 
Sbjct: 245 LGQRPEQLQIDL---SPKPLPVIAKALPIGNPSELLRRRPDIQAAERQLAAATAEVGVAT 301

Query: 297 SDLYPSLSLNGSIALTHD-NSFPGYNTH--WSFGPKLYLPIFDKGKIKSNIRRAESSAQE 353
           +DL+P +SL+G +  T    S  G +    W   P +    FD G +++ +R AE+ A  
Sbjct: 302 ADLFPRVSLSGFLGFTAGRGSQLGSSAARAWGVAPSISWAAFDLGSVRARLRGAEAEADG 361

Query: 354 QYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLD 413
               +++ VL A++E ENA +   + ++ +  L    E  + +   + I YR+G    L 
Sbjct: 362 ALSQYEQQVLLALEESENAFSDYAKRQQRLVSLVRQAEASRAAADQAAIRYREGTVDFLV 421

Query: 414 ILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           +LD ER     E   + A+ +L    V +Y A+G G+ P
Sbjct: 422 LLDAERERLAAEDAQAAAEVELYSGIVAIYKALGGGWQP 460


>gi|170699453|ref|ZP_02890497.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia ambifaria IOP40-10]
 gi|170135653|gb|EDT03937.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia ambifaria IOP40-10]
          Length = 495

 Score =  172 bits (437), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 122/476 (25%), Positives = 226/476 (47%), Gaps = 40/476 (8%)

Query: 13  VLLAGCTVGPEY-TKPHMPLLPTQF-SIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQ 70
            LLAGCTVGP+Y   P  P  PT   +   S +        WW + +D  L++L+  AL 
Sbjct: 19  CLLAGCTVGPDYRGAPAAPDAPTFVRAPATSVDPTAPAPSAWWHALDDRQLDELIAAALA 78

Query: 71  QNLTILQATERINAAKENILSVRADLFPSSYASIS--HRFIPNLKT--------NST--- 117
            N  +  A  R+ A++  +   RA   P S A+++      P++          NST   
Sbjct: 79  HNPDLQAAQARLRASRAQLSQQRAAQLPKSSATVAAIRTREPDVSALGSLLPSGNSTQSG 138

Query: 118 ----------------GQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKL 160
                              D+ W++DLFG  RR +E++ A  ++  A +   ++++ +++
Sbjct: 139 GSSPSLGGSGPLQLYSAGFDATWEVDLFGGTRRAVEAASAQAEAVDADLADTQVSIAAEV 198

Query: 161 IPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIP 220
             +Y+D R  ++R++++ +  +L ++ +EL+  +  +G  + + + +L  ++++  + + 
Sbjct: 199 ATAYVDLRDQQQRLALSQRTAELQQQMLELTQQRRARGVAADVDIERLTTQVENTRASLI 258

Query: 221 TLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRY 280
            L+     ++  ++ L G  A   L      S    P L + + +G PA L++ RPDIR 
Sbjct: 259 PLDAQVTESLDRLAILTGR-APGALDAALSASAAPLPTLPVSVPVGDPAALLKQRPDIRA 317

Query: 281 QEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGY-----NTHWSFGPKLYLPIF 335
            E++LA S A+IG   +D +P ++L G +  +  +  PG+     N  W   P L   I 
Sbjct: 318 AERRLASSNAQIGEHIADYFPKVTLLGDLGFSATD--PGHLFRKQNFTWVGAPYLQWNIL 375

Query: 336 DKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKK 395
           D G+ +  +R AE+S  E    +++ VL A+++   AL      ++ V  L         
Sbjct: 376 DFGRTRGAVRAAEASRDEAEANYRKAVLGALQDANTALQRYGHQREHVVALTKVQTSATH 435

Query: 396 SMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           S +L    YR G  S +D+LD +R     + ++   K +L K YV L  ++G G+ 
Sbjct: 436 SATLMDQRYRAGVASTIDLLDTQREALAAQQNVIAGKAELIKDYVSLQKSLGLGWQ 491


>gi|218891325|ref|YP_002440192.1| outer membrane channel protein [Pseudomonas aeruginosa LESB58]
 gi|218771551|emb|CAW27319.1| outer membrane channel protein [Pseudomonas aeruginosa LESB58]
          Length = 502

 Score =  172 bits (437), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 119/487 (24%), Positives = 228/487 (46%), Gaps = 41/487 (8%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK---------NLINIDTLKW 52
            +LR +  L  +  + CTVGP+Y +P   + P ++   +S              +    W
Sbjct: 17  GVLRGLVLLLSLSSSACTVGPDY-QPPQSVSPQRWGDWHSGPEALRSTQHEGERLRDQAW 75

Query: 53  WESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS------------S 100
           W+ F D  L+ L   A+Q N  +  A  R   A+     V +   P             S
Sbjct: 76  WKVFGDPVLDDLQARAIQANPELHGAILRFAQARMQRRIVSSAYLPEVTLEGGVSRQKQS 135

Query: 101 YASISHRFIPNLKTNSTGQL---------------DSDWKIDLFGQ-RRHIESSLANLDS 144
              +++R +   +  +   L               D+ W+ DL+G+  R +E++ A +  
Sbjct: 136 LYGMNNRLLEATEPGNREALEKALGDPFTLYQAGFDASWEPDLWGRVGRSVEAARAEIGM 195

Query: 145 AYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLS 204
           A A +D   L++ S++  SYI+ R  + +I +  + + + ++ + L  ++  +G T +L 
Sbjct: 196 AAAALDDTLLSISSEVARSYIEVRTAQRQIRLLEEDIRMLEERLRLVRVRAGEGLTDELY 255

Query: 205 LVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPIN 264
           + + +AE++++   +P  + S     + I+ LLG         ++ +  N          
Sbjct: 256 VERQKAELEALRGRLPAWQASETEATNRIAVLLGERPGALARALEAKPGNVLERALPDFR 315

Query: 265 IGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALT--HDNSFPGYNT 322
           +G+P++L+R RPDIR  E+ L  + A IGIAK+ LYPS++L          D  F  + +
Sbjct: 316 LGVPSELVRQRPDIRAAEQSLHRATADIGIAKAALYPSIALGARFGYESYRDGKFGEWGS 375

Query: 323 H-WSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKK 381
             WS GP L LP+FD G+ ++ +R  E   QE  +T+Q TVL A +EV++AL+  + + +
Sbjct: 376 RAWSIGPTLDLPLFDAGRRRTVVRLRELEQQEAAVTFQRTVLGAWQEVDDALSRYHAEYQ 435

Query: 382 IVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVD 441
               ++      +++   + + Y QG+   L+ +D +R + + + +L  ++  L    + 
Sbjct: 436 RNLHMRDKAASSRQAYEWTQVKYAQGQVDFLEEIDAQRTSMQAQRELIDSEALLRTQLIA 495

Query: 442 LYIAIGS 448
           LY  +G 
Sbjct: 496 LYKTLGG 502


>gi|73539464|ref|YP_299831.1| RND efflux system, outer membrane lipoprotein, NodT [Ralstonia
           eutropha JMP134]
 gi|72122801|gb|AAZ64987.1| RND efflux system, outer membrane lipoprotein, NodT [Ralstonia
           eutropha JMP134]
          Length = 481

 Score =  172 bits (437), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 125/474 (26%), Positives = 224/474 (47%), Gaps = 38/474 (8%)

Query: 10  LFIVLLAGCTVGPEYTKPHMPLLP---TQFSIGNSKNLINIDTLKWWESFNDTSLNKLVK 66
           L   ++AGC VGP+Y  P +PL      Q  +   +     + + WWE F D  L +LV 
Sbjct: 11  LSAAVVAGCAVGPDYHAPDVPLSERYLGQPQVEQRRAASTAELVNWWEGFGDPQLTRLVS 70

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFPS---------SYASIS------------ 105
           +AL QNL + QAT R+  A+  + +  A L PS         SY SI             
Sbjct: 71  VALDQNLDLAQATARVAQARAGLGAATAALLPSAGVSAQAARSYQSIETPLGRLQSATQG 130

Query: 106 -HRFIPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPS 163
             R+  N + N    L + W++D+FG  RR  E++LA+  ++ A     +L V ++    
Sbjct: 131 FDRYGNNYEAN----LGASWELDVFGGLRRGREAALADYRASEAGAMATRLAVAAQTADL 186

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           YI  R  + R++IA +  +  +K +    L + +G  ++L + + E  +  +++ IP LE
Sbjct: 187 YITVRGLQARLAIATRQAETQQKLVSTVGLLYGKGLAAELEVRQAEGALAEVQATIPVLE 246

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQK-QSNNFQPNLYIPINIGIPADLIRNRPDIRYQE 282
                 ++ +  +LG P   +   +Q  Q     P +      G PADL+R RPD+   E
Sbjct: 247 AGLDAALNALDVMLGVPPGTYRAELQGVQDIPAAPEI---TGSGSPADLLRRRPDLVVAE 303

Query: 283 KKLADSVAKIGIAKSDLYPSLSLNG----SIALTHDNSFPGYNTHWSFGPKLYLPIFDKG 338
           ++LA + A+IG+A ++ YP  SL      +  +   N F    +  +    L   +FD G
Sbjct: 304 RRLAAANARIGVAIAEYYPKFSLGALLGSATTVASGNLFSAGASQAAGVAGLRWRLFDFG 363

Query: 339 KIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMS 398
           +I + I +A+    E    +++ VL+A ++VENA +++ + +     L        ++  
Sbjct: 364 RINAQIEQAQGQEAESLAAYRQAVLHATEDVENAFSALVKRENQAQTLARGEASLSQARD 423

Query: 399 LSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            S   Y++G   L+++L  +    +     + A+ + A++ V  + A+G G+ P
Sbjct: 424 ASFAAYQKGVVRLIEVLHADERLLQTSDARAQARTESARAAVAAFKALGGGWQP 477


>gi|325280866|ref|YP_004253408.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Odoribacter splanchnicus DSM 20712]
 gi|324312675|gb|ADY33228.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Odoribacter splanchnicus DSM 20712]
          Length = 451

 Score =  172 bits (437), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 113/456 (24%), Positives = 233/456 (51%), Gaps = 16/456 (3%)

Query: 3   ILRAIFSLFIVLL----AGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFND 58
           +++ I++L IVLL    + C +G  Y++P + L P Q   G   + ++   ++W + + D
Sbjct: 1   MMKKIYTLAIVLLVLGVSSCKLGKHYSRPELRL-PEQIE-GTVPDSVSAGDIRWTDLYTD 58

Query: 59  TSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS-HRFIPNLKTNS- 116
             L +L++  L+ N  ++ A  ++  + E     +ADLFP + A++S  R       N+ 
Sbjct: 59  PVLRQLIRKTLEGNKDLMIAAAKVKESMELRRIAKADLFPKAEATVSAEREYDETPGNTF 118

Query: 117 TGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERIS 175
            G++ + W++DL+G+ R   +++LA    +       +  +++++  +Y +     + ++
Sbjct: 119 EGKVLASWEVDLWGKLRWAGQAALAEYLQSVEGRQALQSALVAQVAQAYFELIALDQELA 178

Query: 176 IAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIST 235
           I  Q L   ++ + L+ L+F  G TS+  L + + E+   ++ +P LE+  R+  + I+ 
Sbjct: 179 IVRQTLAARQEGVRLAKLRFEGGLTSENPLRQAQVELARTQTLVPGLEREIRLKENQITL 238

Query: 236 LLG-YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
           L G YP       + +  +  Q  L   + +G+ + ++  RPDIR  E +L  + AK+G+
Sbjct: 239 LAGEYPGE-----VARGKSIGQQQLMTALPVGLSSRILERRPDIRQAEYRLKAAHAKVGV 293

Query: 295 AKSDLYPSLSLNGSIALTHDNSFPGYNTHWSF-GPKLYLPIFDKGKIKSNIRRAESSAQE 353
           A + ++P  +L G   L   +        + F G +L  P+F+ GK ++ ++ + +  ++
Sbjct: 294 AYTSMFPKFTLTGHYDLESSDLTDFLKAPYFFVGGELLAPVFNLGKNRARLKASRAVQEQ 353

Query: 354 QYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLD 413
           +   +Q+ VL A  EV NAL +  + ++I    +H  +  + ++ L+ + Y  G  S LD
Sbjct: 354 ETYNYQKVVLQAFTEVSNALVNSRKSREIRESREHLEQSARSNLDLATLQYINGVISYLD 413

Query: 414 ILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           +LD +R     ++ L+ A R    + V LY  +G G
Sbjct: 414 VLDAQRGYFDAQIGLNTAIRDELLATVQLYQVLGGG 449


>gi|218887252|ref|YP_002436573.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218758206|gb|ACL09105.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 489

 Score =  172 bits (437), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 125/457 (27%), Positives = 229/457 (50%), Gaps = 31/457 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTIL 76
           GC+ GP++ +P M L P  +  G +      D   WW+ F D +L+ LV  AL  N  + 
Sbjct: 13  GCSFGPDHARPAMDL-PDAWRPGTADTGTVQD--GWWKGFGDPALDALVASALDHNRDLA 69

Query: 77  QATERINAAKENILSVRADLFP---SSYASISHRF-------------IPNLKTNSTGQL 120
           +A   ++ A+  +   RA+  P   +  AS   R+             + +L  N+ G L
Sbjct: 70  KAIANVDEARAQLGLARANQMPRVDAQGASQRQRYSLEGFNSFDESTRVQDLH-NAGGVL 128

Query: 121 DSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQ 179
              +++DL+G+ RR  E++ A+L S  A  D  +L + +++  +Y D R + +++ +A  
Sbjct: 129 S--YEMDLWGRYRRASEAARADLLSTMAARDTVRLALTAQVARTYFDLRAYDQQLQVARD 186

Query: 180 ILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGY 239
            L   +   EL  ++F  G TS+L   +  AE  +  S + TL+ +   +   +  L G 
Sbjct: 187 TLASRESTQELRKVRFELGLTSELDYRQAIAEAAAARSTVHTLQYNVSASEAALGVLTGK 246

Query: 240 PATEFLHYMQKQSNNFQPNLYIP-INIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSD 298
              + +    ++          P +  G+P+ L+  RPDI   E++LA + A IG+AK+ 
Sbjct: 247 SPRDIVTGTVERGLAVDAVPVPPSVPAGLPSALLERRPDIVQAEQQLAAASANIGVAKAA 306

Query: 299 LYPSLSLNGSIALTHDNS-----FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQE 353
            +PS+SL G   L +++S     F G    W +   + +PIFD G+IK+ +  AE+  + 
Sbjct: 307 YFPSISLTG--LLGYESSDLTRLFTGPAGTWRYAGSVSMPIFDFGRIKAGVEAAEARQRA 364

Query: 354 QYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLD 413
               +++ V +A +E ++AL +  + + +V      V   ++S+ L+ + Y  G  S L+
Sbjct: 365 ALAGYEKAVQDAFREAQDALVANRKARGVVEAQTTQVTALRRSLHLAKLRYDNGYSSYLE 424

Query: 414 ILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +LD ER+   VE+ L+ A+R    + V++Y A+G G+
Sbjct: 425 VLDAERSLFDVEISLASAQRDQLVAVVEVYRALGGGW 461


>gi|296156856|ref|ZP_06839693.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. Ch1-1]
 gi|295892742|gb|EFG72523.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. Ch1-1]
          Length = 484

 Score =  172 bits (436), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 129/470 (27%), Positives = 223/470 (47%), Gaps = 34/470 (7%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGN-SKNLINIDTLKWWESFNDTSL 61
           + R + ++     AGCTVGP Y +P +   P+ F   +    +++   ++WW  F+D  L
Sbjct: 5   LFRLLPAMCACWFAGCTVGPNYQRPAVDT-PSSFRYASPDAEVVDQGVVQWWSQFDDPVL 63

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFP---SSYASISHRFIPNLKTNSTG 118
           + L++ AL QN  +  A  R++     +++ RA LFP   +++A    R +P      T 
Sbjct: 64  DSLIERALVQNRDLAIAAARVDEFYGRLMTTRAGLFPQIGANFAGSRSRGVPAPGFAPTV 123

Query: 119 ----QLD--SDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
               QLD  + W+IDLFG+ RR  E++ A+     A     ++ +I+ +  SY+  R   
Sbjct: 124 GNQVQLDVMASWEIDLFGRLRRMTEAARADYLGTQAVQQATRIALIASVATSYLLLRDLD 183

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
           +R+ IA   L      + L   +F  G  S+L + + ++E +S ++ +   ++      +
Sbjct: 184 QRLDIAKSTLASRADALALFQERFGGGVVSQLQVSQAKSEYESAQASVYAFQQQIAQQEN 243

Query: 232 NISTLLG-----YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLA 286
            +S LLG      P  + L  +   +          I  G+P+ L+  RPDI   E+ L 
Sbjct: 244 ALSLLLGDNPGPIPRGKPLTQLSAPT----------IPAGLPSSLLERRPDILQAEQALV 293

Query: 287 DSVAKIGIAKSDLYPSLSLNG-----SIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIK 341
            + A IG A++  +P++SL G     S AL+    + G    WSF   +  PIF  G I 
Sbjct: 294 SANASIGAARAQYFPTISLTGVFGAASTALS--GLWTGPARVWSFAGAIAQPIFTGGAIT 351

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
            ++R AE+  QE    +++T+ +A  +VENAL  +   +  +      VE   +  SL+ 
Sbjct: 352 GSVRIAEAQQQEALFGYEQTIQSAFADVENALVGVARVRDQLQATNRQVEALAQYASLAR 411

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             Y  G  S L++LD ER+    ++  S  +       V LY A+G G+ 
Sbjct: 412 DLYEGGYTSYLEVLDAERSLFAAQLQQSQLQDLELAQIVALYKALGYGWT 461


>gi|256839349|ref|ZP_05544858.1| outer membrane efflux protein oprM [Parabacteroides sp. D13]
 gi|256738279|gb|EEU51604.1| outer membrane efflux protein oprM [Parabacteroides sp. D13]
          Length = 468

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 104/417 (24%), Positives = 218/417 (52%), Gaps = 20/417 (4%)

Query: 52  WWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS-----------S 100
           WW +F D  L+ L+++A++QN ++  A +RI  AK N+ S +    P+           S
Sbjct: 55  WWRNFKDPLLDSLIEVAVKQNYSVQMAMDRIAMAKANLRSAQGSYSPTLGLSAGWTRQQS 114

Query: 101 YASISHRFIPNLKTN-STGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVIS 158
             +I+   +P   T  S+  +D +W++D+FG  R  +++   N  ++  + + A +++ +
Sbjct: 115 SGNINQ--VPKAITQYSSATVDMNWEVDVFGSIRNRVKAEKENFAASKEEYNAAMVSLCA 172

Query: 159 KLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESD 218
           ++  SYI+ R  ++ + +A Q     +  ++++  ++  G  SKL + + ++   S ++ 
Sbjct: 173 QVASSYINMRELQQEVKVAQQNCRSQQTVVQITQKRYETGLVSKLDVAQAQSVYYSTKAS 232

Query: 219 IPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDI 278
           +P LE       ++++ LLG   ++    M+ +++   P    P+ +G+PA+L+  RPD+
Sbjct: 233 LPMLEAGIIQYANSLAILLGLYPSDLQKIMETEAS--LPEYIEPVGVGLPANLLLRRPDV 290

Query: 279 RYQEKKLADSVAKIGIAKSDLYPSLSLNGSIAL-THD-NSFPGYNT-HWSFGPKLYLPIF 335
           R  E+++    A +G +KSD +P + + GS+   +HD +    +N+  +   P L    F
Sbjct: 291 RAAERQVNALAASLGASKSDWWPKVFVKGSVGFASHDFDKLANHNSLTYEIAPTLTWNFF 350

Query: 336 DKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKK 395
              +     R A++   E    + +TVL +++EV+NA++S     K +  L+  V   K+
Sbjct: 351 QGTQKIQATRLAKAQLDESIRQFNQTVLTSVQEVDNAMSSYKNSIKQIVALREVVNQGKQ 410

Query: 396 SMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           ++ LS+  Y+QG     ++LD +R+    +  L+ A+     + + LY ++G G+NP
Sbjct: 411 TLDLSLDLYKQGLTPFQNVLDAQRSLLTYQNQLTQAQGSSLLNLIQLYQSLGGGWNP 467


>gi|82701981|ref|YP_411547.1| RND efflux system, outer membrane lipoprotein, NodT [Nitrosospira
           multiformis ATCC 25196]
 gi|82410046|gb|ABB74155.1| RND efflux system, outer membrane lipoprotein, NodT [Nitrosospira
           multiformis ATCC 25196]
          Length = 504

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 114/452 (25%), Positives = 220/452 (48%), Gaps = 27/452 (5%)

Query: 18  CTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQ 77
           C  GP Y +P +  +  ++  G  K   +I    WWE F D  LN+L++IAL +N  I  
Sbjct: 21  CMFGPNYRRPEIETM-EKYRFGE-KVARDIADTAWWEQFGDPILNELIRIALVENKDIRI 78

Query: 78  ATERINAAKENILSVRADLFPSSYASISH---RFIPNLKTNSTGQLD-----------SD 123
           AT RI   +    + R++LFP      S    R    +     G +D           ++
Sbjct: 79  ATARIEEFQGRYGATRSELFPQIGGDASAERLRSTAFVWPRGLGGIDPYYSYYQVSINAN 138

Query: 124 WKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILD 182
           W+ID++G+ RR  E++   L ++ A      L +++ +  SYI+      ++ IA     
Sbjct: 139 WEIDIWGRIRRLSEAARHQLFASEAARRATILTLVTSVASSYINLLILDRQLEIARATAA 198

Query: 183 LYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPAT 242
             +  +E+  +++  G  S+L L ++E++ ++  + IP LE S     + ++ LLG    
Sbjct: 199 TRRDTLEVFRMRYEGGVISQLELAQIESQYETAVAAIPPLESSIAQQENALAVLLGRNPG 258

Query: 243 EFLHYMQKQSNNFQPNLYIP-INIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYP 301
                 +         L +P ++ G+P++L+  RPD+R  E+ L  + A+IG A++  +P
Sbjct: 259 PIARGREL------AKLELPMVSAGLPSELLMRRPDLREAEQNLISANAQIGAARALYFP 312

Query: 302 SLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITW 358
            +SL G + +        F G     +FG    +PIF  G I   +++AE+  ++  + +
Sbjct: 313 RISLTGVLGVASTQLATLFTGPAYMAAFGVLTSVPIFTAGGIAGQVKQAEARHEQALVGY 372

Query: 359 QETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIE 418
           Q  +  A +EVE++L ++ +++  +      VE  +  + ++ + Y +G  S +++LD +
Sbjct: 373 QRAIQIAFREVEDSLIAVQKNRAELAAQTRRVEASRTYLEMAQLRYDEGYISFIEVLDAQ 432

Query: 419 RATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           R   + E   +  + ++  S VDLY ++G G+
Sbjct: 433 RTLFEAETTQAQTRGRVFNSLVDLYKSLGGGW 464


>gi|237748510|ref|ZP_04578990.1| outer membrane efflux protein [Oxalobacter formigenes OXCC13]
 gi|229379872|gb|EEO29963.1| outer membrane efflux protein [Oxalobacter formigenes OXCC13]
          Length = 485

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 129/467 (27%), Positives = 225/467 (48%), Gaps = 31/467 (6%)

Query: 10  LFIVL-LAGCT-VGPEYTKP-----HMPLLPTQFSIGNSKNLINIDTLK--WWESFNDTS 60
           LF+ + + GCT VGP+Y  P     + P     F+    K +   D L   WW+ ++D  
Sbjct: 13  LFVCVGMVGCTTVGPDYKIPENADINKPGAAEPFAAAQEK-VFKSDALPDHWWKLYDDPV 71

Query: 61  LNKLVKIALQQNLTI------------LQATERINAAKENILSVRADLFPSSYAS--ISH 106
           LN L++ +L  N  +                  +    +  +S       SS AS    +
Sbjct: 72  LNSLIEKSLSNNTDLRVASANLARARAALEEAAMGTIPQVSVSAEPAFGRSSAASHGFGN 131

Query: 107 RFIPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
           RF    K +  G L+  +++DLFGQ  R IE++ A+ D+A A +D+ ++ V +    +Y 
Sbjct: 132 RFSDAWKFD--GGLNVSYQLDLFGQIARGIEAASADTDAAQAALDVTRITVAADTAKAYA 189

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
           DA    +RI IA    +L ++ ++ +      G  + + + +  A+ +S+ + +P L+  
Sbjct: 190 DACSSAQRIGIAEHSAELQRQFLDTTQQLTRGGRGTAMDVSRARAQYESLRAAVPPLQAQ 249

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
            ++ ++ ++ L G      +  + +      P L   I +G  A L++ RPDIR  E+KL
Sbjct: 250 QKIALYKLAVLTGELPNALVATIGQCKT--APKLSQAIPVGDGAALLKRRPDIRQAERKL 307

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHD-NSFPGYNTH-WSFGPKLYLPIFDKGKIKSN 343
           A + A+IG+A +DLYP ++L  S   T   N F   N + WS GP +   I D G  +S 
Sbjct: 308 AATSARIGVATADLYPKINLGLSGGFTGRMNGFDQNNGYRWSIGPLISWTIPDTGTARSR 367

Query: 344 IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
           I++A++  Q  +  +  +VLNA+KE E+ALTS   +      L+ A +    +   +   
Sbjct: 368 IKQAKAEHQAAFARFDASVLNALKETESALTSYARELDRNALLKAARDQSALAADQAHRL 427

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           Y+ GR   L  LD ER  A  E   + +  +L    + +++A+G G+
Sbjct: 428 YKHGRIDFLATLDAERTLANDESAYAASSAKLVNDQIGVFLALGGGW 474


>gi|187920527|ref|YP_001889559.1| NodT family RND efflux system outer membrane lipoprotein
           [Burkholderia phytofirmans PsJN]
 gi|187718965|gb|ACD20188.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia phytofirmans PsJN]
          Length = 523

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 126/433 (29%), Positives = 213/433 (49%), Gaps = 35/433 (8%)

Query: 15  LAGC-TVGPEYTKPHMPLLPTQF--SIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQ 71
           L+GC +VGP++ +P    L  Q+  S+  +          WW +FND  L  L + A ++
Sbjct: 24  LSGCVSVGPDFKQPEA-TLENQWLESLPRAAQATPAAQAAWWTAFNDPVLTALEQRAYER 82

Query: 72  NLT-------ILQATERINAAKENIL------SVRADLFPSSYASI---SHRFIPNLKTN 115
           NL+       I +A  ++  + EN+L      SV AD   +S       +H +  +L+ N
Sbjct: 83  NLSLQVAGLHIFKARAQLATSAENLLPQSGSVSVGADHINTSGVGPIPPAHLWAEHLRAN 142

Query: 116 STGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
                   W+ID +G+ RR IES  A L  + A  D + +++   +  +YID R  ++RI
Sbjct: 143 V------GWEIDFWGKYRRQIESDRAQLRVSEAAYDNSLVSLFGDVANAYIDLRALEQRI 196

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
            +A Q L   ++++ L+  ++  GA+S+L + +    +   E+ IP L K+   +   ++
Sbjct: 197 VVAQQNLKSVQQSLTLTQARYKHGASSQLDVEQAATLVAETEAQIPPLIKARAQDRDTLA 256

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
            LL  P        Q + ++  P     I++GIPADL+R RPD+R      A   A IG 
Sbjct: 257 VLLADPPDAV--DAQLKGSSAIPVPPTQIDVGIPADLLRRRPDVRQAALNAAAQSALIGA 314

Query: 295 AKSDLYPSLSLNGSIALTHDNSFPGYNTHWS------FGPKLYLPIFDKGKIKSNIRRAE 348
           AK+ LYPSLSL G   L+         T W       F   + LPI D+G++K+ +R  +
Sbjct: 315 AKAKLYPSLSLTGLFGLSSGEQHGIGLTQWGSKTIGLFSAGITLPILDRGQLKNAVRIQD 374

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           ++ QE  + +Q TVL A K+VE+A+  +      +     A +  ++++ L+   YR G 
Sbjct: 375 ATFQEAVLDYQNTVLQAQKDVEDAIAGLRTSLDALAASARASDASQRALRLANAQYRSGS 434

Query: 409 YSLLDILDIERAT 421
            +   +LD  R+ 
Sbjct: 435 VTYDTVLDASRSA 447


>gi|167621647|ref|YP_001672155.1| RND efflux system outer membrane lipoprotein [Caulobacter sp. K31]
 gi|167351770|gb|ABZ74496.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Caulobacter sp. K31]
          Length = 482

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 127/475 (26%), Positives = 226/475 (47%), Gaps = 39/475 (8%)

Query: 7   IFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL-KWWESFNDTSLNKLV 65
           +F+L  VL A CTVGP+Y  P    + ++F       +I    + +WWE+ +D  L+ + 
Sbjct: 8   LFALLPVLSA-CTVGPDYVGPPDKGISSRFVRMEDTAVIATPLVARWWETLDDPILDGIE 66

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFP--SSYASISHRFIPNLKTNSTGQL--- 120
           + AL+ N  +  +  R+  A+  +   RA+  P  ++ A   H  +P   + + G +   
Sbjct: 67  ERALRANPNMAASQARLRQARAMLRIERANAAPNVAAGALAGHGRVPESGSGAAGAMIPA 126

Query: 121 ----------------DSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPS 163
                           D+ W+IDLFG +RR +E++ A   +A A +  A++++ +++  +
Sbjct: 127 LVGTDERSFDLYTAAFDASWEIDLFGGRRRGVEAATATAQAAEATLADAQVSLTAEVAHA 186

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           YI  R  ++RI +A + ++L ++ ++L+  +F +G  S L + +L  + ++  + +  L 
Sbjct: 187 YIGLRDTQKRIVLAKRSVELQQQMLDLTRQQFERGVASALDVERLSMQFENTNARVAPLV 246

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
                 ++ ++ L G         +        P   +   IG P  ++R RPD+R  E+
Sbjct: 247 AQAEGFMNALAWLCGEQPGALDAILDPPRPAPLPPPAV--AIGDPEAMLRRRPDVRAAER 304

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIA--------LTHDNSFPGYNTHWSFGPKLYLPIF 335
           +LA   A+IG+A++  +P LS  G I         LTH + F          P L   + 
Sbjct: 305 RLAADTARIGVAEAARFPRLSWMGVIGIGGTQPSDLTHLDDFVALGA-----PTLQWSVL 359

Query: 336 DKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKK 395
           + G+++  IR+ ES+  E    +   VL A+++ E+AL      +  V  L  A     +
Sbjct: 360 NFGRVQGQIRQRESARDEAEALYDAAVLGALRDTEDALARFRAGRATVAILARAKASADR 419

Query: 396 SMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S +L+  NYR GR SL+D L  ER     E  LS A   L   YV L  A+G G+
Sbjct: 420 SANLTQQNYRAGRASLIDALGAERHRIDAEDGLSAATAGLTADYVALQKALGLGW 474


>gi|187926717|ref|YP_001893062.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Ralstonia pickettii 12J]
 gi|241665049|ref|YP_002983408.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Ralstonia pickettii 12D]
 gi|187728471|gb|ACD29635.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Ralstonia pickettii 12J]
 gi|240867076|gb|ACS64736.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Ralstonia pickettii 12D]
          Length = 525

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 124/487 (25%), Positives = 218/487 (44%), Gaps = 48/487 (9%)

Query: 5   RAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLIN----IDTLKWWESFNDTS 60
           R + +    L+AGC VGP+Y+ P   L  T+   G    L +    +   +WWE F D  
Sbjct: 17  RCVLAALTALVAGCAVGPDYSPPQ--LSGTEAPRGWHATLPHHGSRLALARWWEQFQDPV 74

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH-------------- 106
           L +LV+ A   + T+ QA  R+  A+  + S +A L P S  S S               
Sbjct: 75  LAQLVEQADASSPTVAQAVGRVREARAVVSSSQAALLPQSKGSGSATRQGGFGGSQFGTG 134

Query: 107 ----------RFIPNLK----TNSTGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDI 151
                        P L     T    Q D+ W+IDLFG +RR +E + A L ++ A    
Sbjct: 135 AGFGGLSSGAALGPALGLGTITTLAAQADASWEIDLFGGKRRSLEGADARLAASEADWHD 194

Query: 152 AKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAE 211
           A++++ +++  +Y+  R  +  + I    L   ++ ++L+  KF  G  +     + +A 
Sbjct: 195 ARVSLAAEVASTYLQQRQCEALVGIDAATLASRQETLQLTERKFRAGFAAPADDAQAQAS 254

Query: 212 IKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQ--PNLYIPINIGIPA 269
           +    + +          +  + TL G         + K +      P+  +P    +PA
Sbjct: 255 VADAINVLEGQRAQCAQGIDKLVTLTGLDHDALNGLLAKANAQIPAPPDAGVPD---VPA 311

Query: 270 DLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSF-----PGYNTHW 324
            ++  RPD+   E+ +A + A IG+A +   PS++L GSI +   N+F           W
Sbjct: 312 RVLSQRPDVASAERAVAGASADIGVAVASRLPSITLAGSIGI---NAFRFSGQSATTKSW 368

Query: 325 SFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVT 384
           SFGP + LPIFD G   + +  A +   +   +++  V  A++EVE+AL  ++   + + 
Sbjct: 369 SFGPSVSLPIFDGGAGAARVETARARYDQALASYRAKVRQAVQEVEDALVRLDAADRRLD 428

Query: 385 KLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYI 444
               A   + K +  +   YR G  SLL + D+ R   +    L+  + + A+++V LY 
Sbjct: 429 AATKADAQYAKVLDAASARYRLGAGSLLQLEDVRRTALQASQSLAAVRLERAQAWVALYK 488

Query: 445 AIGSGYN 451
           A+G G+ 
Sbjct: 489 AVGGGWR 495


>gi|172065051|ref|YP_001815763.1| RND efflux system outer membrane lipoprotein [Burkholderia
           ambifaria MC40-6]
 gi|171997293|gb|ACB68210.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia ambifaria MC40-6]
          Length = 499

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 124/467 (26%), Positives = 229/467 (49%), Gaps = 49/467 (10%)

Query: 18  C-TVGPEYTKPHM-----PLLPTQFSIGN----SKNLINIDTLKWWESFNDTSLNKLVKI 67
           C +VGP+YT P       PL        N    S+N +  +   WW+ ++D  L+ LV+ 
Sbjct: 22  CKSVGPDYTLPQQAYVNAPLANHALDDANGALVSRNAVPGN---WWQLYDDPVLDALVRS 78

Query: 68  ALQQNLTILQATERINAAKENILSVRADL--------FPSSYASISHRF----------- 108
           AL+ N  +     R+ AA  N+   RA L        F  S  +   R            
Sbjct: 79  ALKSNTDL-----RVAAA--NLARSRAALEVANEQGGFSGSAEAAVQRAQESAEQYLLEN 131

Query: 109 -IPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYID 166
            +P +   + G +   +++DLFG+ RR +E++ A+ ++  A  D+A++ V++ ++ +Y++
Sbjct: 132 KLPVVNEGTVG-ISVSYELDLFGKLRRGVEAARADSEAVQAAADLARITVVADVVRAYVE 190

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
           +    + ++IA Q L L ++ ++LS      G  ++  + +   +++++ +DIP  E   
Sbjct: 191 SCSAGDELAIAKQSLALQQQRVKLSQRLRDAGRGNQSDVTRGVTQVRTLSADIPRFEGRR 250

Query: 227 RMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLA 286
           ++  + ++ LL     +    + +      P L  PI IG  A L+R RPD+R  E++LA
Sbjct: 251 KIAQYQLAALLARSPADLPKAVAECER--LPKLRRPIPIGDGAALLRRRPDVREAERQLA 308

Query: 287 DSVAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSN 343
            + A+IG+A + LYPS+S+    GS+ +  D  F      WSFGP +       G+ ++ 
Sbjct: 309 AATARIGVATAALYPSISIGASAGSVGVAAD-LFSSTTNRWSFGPLISWSFPVNGQ-RAR 366

Query: 344 IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
           +R AE++       +   VLNA++E +++L +   D +    L+ A E  + S   +   
Sbjct: 367 VREAEAATGGALAHFDGVVLNALRETQSSLATYAADVQRTDALRTAYESARNSADETHRL 426

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +  GR S +  LD  R    V   ++ A+ Q+A   V L++A+G G+
Sbjct: 427 FVAGRESFISDLDATRTLTSVRAQVAAAEGQVAADQVKLFLALGGGW 473


>gi|150008362|ref|YP_001303105.1| outer membrane efflux protein oprM [Parabacteroides distasonis ATCC
           8503]
 gi|149936786|gb|ABR43483.1| outer membrane efflux protein oprM precursor [Parabacteroides
           distasonis ATCC 8503]
          Length = 468

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 105/417 (25%), Positives = 217/417 (52%), Gaps = 20/417 (4%)

Query: 52  WWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS-----------S 100
           WW +F D  L+ L+++A++QN ++  A +RI  AK N+ S +    P+           S
Sbjct: 55  WWRNFKDPLLDSLIEVAVKQNYSVQMAMDRIAMAKANLRSAQGSYSPTLGLSAGWTRQQS 114

Query: 101 YASISHRFIPNLKTN-STGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVIS 158
             +I+   +P   T  S+  +D +W++D+FG  R  +++   N  ++  + + A +++ +
Sbjct: 115 SGNINQ--VPKAITQYSSATVDMNWEVDVFGSIRNRVKAEKENFAASKEEYNAAMVSLCA 172

Query: 159 KLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESD 218
           ++  SYI+ R  ++ + +A Q     +  ++++  ++  G  SKL + + ++   S ++ 
Sbjct: 173 QVASSYINMRELQQEVKVAQQNCRSQQTVVQITQKRYETGLVSKLDVAQAQSVYYSTKAS 232

Query: 219 IPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDI 278
           +P LE       ++++ LLG   ++    M+  ++   P    P+ +G+PA+L+  RPD+
Sbjct: 233 LPMLEAGIIQYTNSLAILLGLYPSDLQKIMETDAS--LPEYIEPVGVGLPANLLLRRPDV 290

Query: 279 RYQEKKLADSVAKIGIAKSDLYPSLSLNGSIAL-THD-NSFPGYNT-HWSFGPKLYLPIF 335
           R  E+++    A +G +KSD +P + + GSI   +HD +    +N+  +   P L    F
Sbjct: 291 RAAERQVNALAASLGASKSDWWPKVFVKGSIGFASHDFDKLANHNSLTYEIAPTLTWNFF 350

Query: 336 DKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKK 395
              +     R A++   E    + +TVL +++EV+NA++S     K +  L+  V   K+
Sbjct: 351 QGTQKIQATRLAKAQLDESIRQFNQTVLTSVQEVDNAMSSYKNSIKQIVALREVVNQGKQ 410

Query: 396 SMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           ++ LS+  Y+QG     ++LD +R+    +  L+ A+     + + LY ++G G+NP
Sbjct: 411 TLDLSLDLYKQGLTPFQNVLDAQRSLLTYQNQLTQAQGSSLLNLIQLYQSLGGGWNP 467


>gi|241759782|ref|ZP_04757882.1| outer membrane protein OprM [Neisseria flavescens SK114]
 gi|241319790|gb|EER56186.1| outer membrane protein OprM [Neisseria flavescens SK114]
          Length = 468

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 123/445 (27%), Positives = 214/445 (48%), Gaps = 14/445 (3%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F      + I    L W + F D  L++L+ IAL++N  
Sbjct: 19  LSACTMMPKYEQPQVAVADT-FKYDTVDDSIRAAELGWQDYFADPRLHRLIDIALERNTD 77

Query: 75  ILQATERINAAKENILSVRADLFPSSYASIS------HRFIPNLKTNSTGQLDSDWKIDL 128
           +  A       ++  +  R +L P+  AS +                S G   + +++DL
Sbjct: 78  LRTAALNAEIYRKQYMIARNNLLPTVNASGTGSRQGSLSGGSVSSQYSVGLGATSYELDL 137

Query: 129 FGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKN 187
           FG+ R   E++L    +  A  + A L +IS +  +Y + R+ +E +++A ++L   +  
Sbjct: 138 FGRVRSTSEAALQGYFNVAANRNAAHLTLISTVAKAYFNERYAEESMALAQRVLQTREAT 197

Query: 188 IELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHY 247
            +LS L+   G  S + L + EA I+S ++D  +  K+     ++++ L+  P  E L  
Sbjct: 198 YKLSQLRHKAGVISAVDLRQQEALIESAKADYASAVKNREQARNSLAMLINQPLPEDLPV 257

Query: 248 MQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNG 307
               S  F+      +  G+ +D++ NRPDIR  E  L  + A IG A++  +P +SL G
Sbjct: 258 GLPLSKQFK---MTKLPAGLSSDVLLNRPDIRAAEHALKQANANIGAARAAFFPRISLTG 314

Query: 308 SIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLN 364
           S+          F      W+F P + LPIFD G  K+N+  A+   Q Q + ++  V +
Sbjct: 315 SVGTASGELSGLFKSGTGIWAFAPSITLPIFDWGTNKANLDVAKLRQQAQIVAYEAAVQS 374

Query: 365 AIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKV 424
           A K+V NAL +  +  K    L      +  S+ L  + Y+ G  + LD+LD ER++   
Sbjct: 375 AFKDVSNALVAREQLDKSYAALSKQSRAYNDSLRLINLRYKHGVSNALDLLDAERSSYGA 434

Query: 425 EVDLSIAKRQLAKSYVDLYIAIGSG 449
           E  L   +    ++  DLY A+G G
Sbjct: 435 ETALLANQLTRLENLADLYKALGGG 459


>gi|73538313|ref|YP_298680.1| RND efflux system, outer membrane lipoprotein, NodT [Ralstonia
           eutropha JMP134]
 gi|72121650|gb|AAZ63836.1| RND efflux system, outer membrane lipoprotein, NodT [Ralstonia
           eutropha JMP134]
          Length = 512

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 121/483 (25%), Positives = 231/483 (47%), Gaps = 51/483 (10%)

Query: 17  GCTVGPEYTKPHMPLLPTQF----SIGNSKNLINID-TLKWWESFNDTSLNKLVKIALQQ 71
           GC VGP++ +P  P  P  F    S   S   ++ +  ++WW   ND  LN L    +  
Sbjct: 23  GCAVGPDFERP-TPSAPDVFHRIQSAQASSKAVDAEFNVEWWTLLNDPLLNNLESRLVDA 81

Query: 72  NLTILQATERINAAKENILSVRADLFPSSYASISH---RFIPN-----LKTNSTGQ---- 119
           NL +  A+ R+  ++     V A   P    + S+   R  PN     L  + TG     
Sbjct: 82  NLDVAAASARLRQSRSTQQVVGAAQLPRLDGAASYYRERGSPNGIVSLLGVSPTGSPPQP 141

Query: 120 ---------------------------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDI 151
                                       D+ W+ID++G+ RR +E++ A  ++++   + 
Sbjct: 142 ASGSSPLGVAPVPGSSGSPPFDLYQFGFDASWEIDIWGRVRRSVEAAGALTEASFEDRNA 201

Query: 152 AKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAE 211
             L+  ++L   Y++ R  +  + I  Q L++ +    L+ ++  +G T+ L +    A+
Sbjct: 202 ILLSARAELARDYVELRDLQSLLEITKQNLEIARDTARLTQVRAREGVTTDLDVANAAAQ 261

Query: 212 IKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADL 271
           + SIES +PTLE      ++ I  LL          + ++     P L   + +G P+++
Sbjct: 262 VASIESLMPTLEARLEAAINAIGLLLAEEPGALRQELAERREV--PELPERVPVGFPSEI 319

Query: 272 IRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALT--HDNSFPGYNT-HWSFGP 328
           ++ RPDIR  E +L  + A IG+AK+D YP +SLNGS        +S   + +  +  GP
Sbjct: 320 VQRRPDIRRAEAQLHAATASIGMAKADFYPRISLNGSAGFQSLQLSSLADWASRQFVVGP 379

Query: 329 KLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQH 388
            +  PIF+ G++K  +   E+  QE  I ++ TVL+A +EV++AL + + +++   +L  
Sbjct: 380 SITFPIFEGGRLKGTLHLREAQQQEAAIAYKRTVLDAWREVDDALVAYDAEQRRRDRLVT 439

Query: 389 AVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGS 448
            V  ++++++++   Y+ G    LD+L+++R   + + +L  ++   A + + L   +G 
Sbjct: 440 VVSENQRALAIAQRRYKAGAVDYLDVLNVQRQLLRSQSNLEQSRATAATNLITLCKVLGG 499

Query: 449 GYN 451
           G+ 
Sbjct: 500 GWE 502


>gi|187921263|ref|YP_001890295.1| NodT family RND efflux system outer membrane lipoprotein
           [Burkholderia phytofirmans PsJN]
 gi|187719701|gb|ACD20924.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia phytofirmans PsJN]
          Length = 508

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 121/457 (26%), Positives = 221/457 (48%), Gaps = 27/457 (5%)

Query: 17  GC-TVGPEYTKPHMPLLPTQFS----IGNSKNLINIDTLK--WWESFNDTSLNKLVKIAL 69
           GC  VGP Y+ P   L+    +     G   +L    ++   WW+ ++D  LN LV  AL
Sbjct: 24  GCMNVGPNYSLPQQALVNAPLANAPIEGADTSLTTRQSVPPVWWKLYDDPVLNGLVDQAL 83

Query: 70  QQNLTILQATERINAAKENILSVRA-DLFPSSYASISHRF------------IPNLKTNS 116
           Q N  +  A   +  ++E +   +A   F    +++  R             +P +    
Sbjct: 84  QSNTDLRVAAANLARSREALGVAQAQGGFSGKSSAVIERAQESAEQYLLTEKLPVVNEGD 143

Query: 117 TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERIS 175
            G +   ++IDLFG+ RR +E++ A+ +S  A  D+A++ V++ ++ SY++     E + 
Sbjct: 144 IG-ISISYEIDLFGKLRRGVEAAQADTESVQAAADLARITVVADVVRSYVEQCSAAEELR 202

Query: 176 IAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIST 235
           IA Q L L K+ +++S      G  ++  + + + ++ ++ +DIP      ++  + ++ 
Sbjct: 203 IAQQSLALQKQRVDVSRRLRDAGRGNQPDVTRGQTQVDTLSADIPRYMARRKIAQYRLAA 262

Query: 236 LLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIA 295
           LL    ++    +   + +  P L  PI IG  A L++ RPD+R  E++LA S A+IG+A
Sbjct: 263 LLARAPSDLPPAVL--ACDRLPQLRQPIPIGDGAALLKRRPDVREAERELAASTARIGVA 320

Query: 296 KSDLYPSLSLNGSIALTH--DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQE 353
              LYP++S+  S  LT   ++        W FGP +    F     +  +R A++S+Q 
Sbjct: 321 TGALYPTVSIGASAGLTGVLEDLGTSPTARWGFGPLISWQ-FPTNGARGRVREAQASSQV 379

Query: 354 QYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLD 413
               +   VL A++E E  L + + D      L+ AV+   +S   +   YR GR S + 
Sbjct: 380 ALAKFDGVVLTALRETETNLATYSSDYARADALRAAVKSASESADETHRLYRAGRESFIS 439

Query: 414 ILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            LD  R     +   + A+ Q+A   V+L++A+G G+
Sbjct: 440 DLDATRTLTSTKSQAAAAEGQVAIDQVNLFLALGGGW 476


>gi|255015609|ref|ZP_05287735.1| outer membrane efflux protein oprM precursor [Bacteroides sp.
           2_1_7]
 gi|262384502|ref|ZP_06077636.1| outer membrane efflux protein oprM [Bacteroides sp. 2_1_33B]
 gi|298375022|ref|ZP_06984979.1| outer membrane efflux protein OprM [Bacteroides sp. 3_1_19]
 gi|262293795|gb|EEY81729.1| outer membrane efflux protein oprM [Bacteroides sp. 2_1_33B]
 gi|298267522|gb|EFI09178.1| outer membrane efflux protein OprM [Bacteroides sp. 3_1_19]
          Length = 468

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 105/417 (25%), Positives = 217/417 (52%), Gaps = 20/417 (4%)

Query: 52  WWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS-----------S 100
           WW +F D  L+ L+++A++QN ++  A +RI  AK N+ S +    P+           S
Sbjct: 55  WWRNFKDPLLDSLIEVAVKQNYSVQMAMDRIAMAKANLRSAQGSYSPTLGLSAGWTRQQS 114

Query: 101 YASISHRFIPNLKTN-STGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVIS 158
             +I+   +P   T  S+  +D +W++D+FG  R  +++   N  ++  + + A +++ +
Sbjct: 115 SGNINQ--VPKAITQYSSATVDMNWEVDVFGSIRNRVKAEKENFAASKEEYNAAMVSLCA 172

Query: 159 KLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESD 218
           ++  SYI+ R  ++ + +A Q     +  ++++  ++  G  SKL + + ++   S ++ 
Sbjct: 173 QVASSYINMRELQQEVKVAQQNCRSQQTVVQITQKRYETGLVSKLDVAQAQSVYYSTKAS 232

Query: 219 IPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDI 278
           +P LE       ++++ LLG   ++    M+  ++   P    P+ +G+PA+L+  RPD+
Sbjct: 233 LPMLEAGIIQYANSLAILLGLYPSDLQKIMETDAS--LPEYIEPVGVGLPANLLLRRPDV 290

Query: 279 RYQEKKLADSVAKIGIAKSDLYPSLSLNGSIAL-THD-NSFPGYNT-HWSFGPKLYLPIF 335
           R  E+++    A +G +KSD +P + + GSI   +HD +    +N+  +   P L    F
Sbjct: 291 RAAERQVNALAASLGASKSDWWPKVFVKGSIGFASHDFDKLANHNSLTYEIAPTLTWNFF 350

Query: 336 DKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKK 395
              +     R A++   E    + +TVL +++EV+NA++S     K +  L+  V   K+
Sbjct: 351 QGTQKIQATRLAKAQLDESIRQFNQTVLTSVQEVDNAMSSYKNSIKQIVALREVVNQGKQ 410

Query: 396 SMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           ++ LS+  Y+QG     ++LD +R+    +  L+ A+     + + LY ++G G+NP
Sbjct: 411 TLDLSLDLYKQGLTPFQNVLDAQRSLLTYQNQLTQAQGSSLLNLIQLYQSLGGGWNP 467


>gi|17548890|ref|NP_522230.1| outer membrane CHANEL lipoprotein [Ralstonia solanacearum GMI1000]
 gi|17431140|emb|CAD17820.1| probable outer membrane chanel lipoprotein [Ralstonia solanacearum
           GMI1000]
          Length = 522

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 123/485 (25%), Positives = 221/485 (45%), Gaps = 43/485 (8%)

Query: 4   LRAIFSLFIVLLAGCTVGPEYTKPHMPLL--PTQFSIGNSKNLINIDTLKWWESFNDTSL 61
            RA+ +L  + LA C VGP+Y  P +  +  P  +      +   +   +WWE F+D +L
Sbjct: 17  CRAVPTLLALALAACAVGPDYRAPRLAGVEAPAGWHATLPHHGSRMMLARWWEQFHDPAL 76

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPS---------------------- 99
            +L++ A   + T+ QA  R+  A+ ++ S RA LFP                       
Sbjct: 77  TQLIEQADADSPTLAQAVGRVREARASVSSSRAALFPQLKGSGSAVRQGGFGGSQVLGGA 136

Query: 100 -----SYASISHRFIPNLKTNSTGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAK 153
                S  S+S        T      D  W++DLFG +RR +E + A LD++ A    A+
Sbjct: 137 AGTGVSATSVSPTLGLGTFTTLAATSDVSWELDLFGGKRRSLEGADARLDASLADWHDAR 196

Query: 154 LNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIK 213
           + + +++  +Y+  R  +  ++I    L   ++ ++L+  KF  G  +   L + +A + 
Sbjct: 197 VTLSAEVASTYLQQRECEALVAIGETTLASRQETLQLTERKFGAGFVAPADLAQAQATVA 256

Query: 214 SIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQ--PNLYIPINIGIPADL 271
              + + +        +  + TL+G         +   +      P+  +P    +PA +
Sbjct: 257 DATNALESQRAQCAQGLDRLVTLIGLDHAALAALLASGTGRMPAPPDAAVPD---VPAQV 313

Query: 272 IRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSF--PGYN---THWSF 326
           +  RPD+   E+ +A + A IG+A +   PSL+L GSI +   N+F   G +     WSF
Sbjct: 314 LSQRPDVSSAERAVALASADIGVAVASRLPSLTLAGSIGI---NTFRISGQSLTSKSWSF 370

Query: 327 GPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKL 386
           GP + LPIFD G   + +  A +   +    ++  V  A +EVE+AL  ++   + +   
Sbjct: 371 GPSVSLPIFDGGSGAARVETARARYDQALAGYRAKVRQAAQEVEDALVRLDAAGRRLDAA 430

Query: 387 QHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAI 446
             A   + K +  +   YR G  SLL + D+ R T      L+  + + A+++V LY A+
Sbjct: 431 AVADAQYAKVLQAASARYRLGAGSLLQLEDVRRTTLSASQSLAAVRLERAQAWVALYKAV 490

Query: 447 GSGYN 451
           G G+ 
Sbjct: 491 GGGWR 495


>gi|171315901|ref|ZP_02905130.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia ambifaria MEX-5]
 gi|171098904|gb|EDT43694.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia ambifaria MEX-5]
          Length = 492

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 124/467 (26%), Positives = 228/467 (48%), Gaps = 49/467 (10%)

Query: 18  C-TVGPEYTKPHM-----PLLPTQFSIGN----SKNLINIDTLKWWESFNDTSLNKLVKI 67
           C +VGP+Y  P       PL        N    S+N +  +   WW+ ++D  L+ LV+ 
Sbjct: 22  CKSVGPDYKLPQQAYVNAPLANHALDDANDALVSRNAVPGN---WWQLYDDPVLDALVRS 78

Query: 68  ALQQNLTILQATERINAAKENILSVRADL--------FPSSYASISHRF----------- 108
           AL+ N  +     R+ AA  N+   RA L        F  S  +   R            
Sbjct: 79  ALKSNTDL-----RVAAA--NLARSRAALEVANEQGGFSGSAEAAVQRAQESAEQYLLEN 131

Query: 109 -IPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYID 166
            +P +   + G +   +++DLFG+ RR +E++ A+ ++  A  D+A++ V++ ++ +Y++
Sbjct: 132 KLPVVNEGTVG-ISVSYELDLFGKLRRGVEAARADSEAVQAAADLARITVVADVVRAYVE 190

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
           +    + ++IA Q L L ++ ++LS      G  ++  + +   +++++ +DIP  E   
Sbjct: 191 SCSAGDELAIAKQSLALQQQRVKLSQRLRDAGRGNQTDVTRGVTQVRTLSADIPRFEGRR 250

Query: 227 RMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLA 286
           ++  + ++ LL     +    + +      P L  PI IG  A L+R RPD+R  E++LA
Sbjct: 251 KIAQYQLAALLARSPADLPKAVAECER--LPKLRQPIPIGDGAALLRRRPDVREAERQLA 308

Query: 287 DSVAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSN 343
            + A+IG+A + LYPS+S+    GS+ +  D  F      WSFGP +       G+ ++ 
Sbjct: 309 AATAQIGVATAALYPSISIGASAGSVGVAAD-LFSSTTNRWSFGPLISWSFPVNGQ-RAR 366

Query: 344 IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
           +R AE++       +   VLNA++E +++L +   D +    L+ A E  + S   +   
Sbjct: 367 VREAEAATGGALAHFDGVVLNALRETQSSLATYAADVQRTDALRTAYESARNSADETHRL 426

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           Y  GR S +  LD  R    V   ++ A+ Q+A   V L++A+G G+
Sbjct: 427 YAAGRESFISDLDATRTLTSVRAQVAAAEGQVAADQVKLFLALGGGW 473


>gi|261392066|emb|CAX49559.1| outer-membrane lipoprotein MtrE [Neisseria meningitidis 8013]
          Length = 467

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 125/448 (27%), Positives = 221/448 (49%), Gaps = 20/448 (4%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F    + + I    L W + F D  L KL+ IAL++N +
Sbjct: 18  LSACTMIPQYEQPKVEVAET-FKNDTADSGIRAVDLGWHDYFADPRLQKLIDIALERNTS 76

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSDWKI-------- 126
           +  A       ++  +  R +L P+  A+ +     +L   S G + S +K+        
Sbjct: 77  LRTAVLNSEIYRKQYMIERNNLLPTLAANANDSRQGSL---SGGNVSSSYKVGLGAASYE 133

Query: 127 -DLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLY 184
            DLFG+ R   E++L    ++ A  D A L++I+ +  +Y + R+ +E +S+A ++L   
Sbjct: 134 LDLFGRVRSSSEAALQGYFASTANRDAAHLSLIATVAKAYFNERYAEEAMSLAQRVLKTR 193

Query: 185 KKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEF 244
           ++  +LS L++  G  S ++L + EA I+S ++D     +S     + ++TL+  P  + 
Sbjct: 194 EETYKLSELRYKAGVISAVALRQQEALIESAKADYAHAARSREQARNALATLINQPIPDD 253

Query: 245 LHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLS 304
           L         F       +  G+ ++++ +RPDIR  E  L  + A IG A++  +PS+ 
Sbjct: 254 LPAGLPLDKQF---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAFFPSIR 310

Query: 305 LNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQET 361
           L GS+          F      WSF P + LPIF  G  K+N+  A+   Q Q + ++  
Sbjct: 311 LTGSVGTGSAELGGLFKSGTGVWSFAPSITLPIFTWGTNKANLDVAKLRQQAQIVAYESA 370

Query: 362 VLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERAT 421
           V +A ++V NALT+  +  K    L       K+++ L  + Y+ G    LD+LD ER++
Sbjct: 371 VQSAFQDVANALTAREQLDKAYAALSKQSRASKEALRLVGLRYKHGVSGALDLLDAERSS 430

Query: 422 AKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
              E     A+   A++  DLY A+G G
Sbjct: 431 YAAEGAALSAQLTRAENLADLYKALGGG 458


>gi|163748954|ref|ZP_02156205.1| Outer membrane efflux protein [Shewanella benthica KT99]
 gi|161331330|gb|EDQ02218.1| Outer membrane efflux protein [Shewanella benthica KT99]
          Length = 482

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 124/454 (27%), Positives = 222/454 (48%), Gaps = 21/454 (4%)

Query: 13  VLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL-INIDTLKWWESFNDTSLNKLVKIALQQ 71
           +LL+GC +GP+Y +P + + P Q+    +++  +NI    W E + D  L  L++ AL +
Sbjct: 24  ILLSGCAMGPDYQQPDLKI-PGQYHHDLAQDSGLNIGMTPWREFYLDPDLQVLIEHALSK 82

Query: 72  NLTILQATERINAAKENILSVRADLFPS-SYASISHRFIPN--LKTNSTGQLDSD----- 123
           NL +     R+ AA+  I    A  +P     +   R I +    TN + + + D     
Sbjct: 83  NLDLETVRSRLIAARSRITVTDAAFYPVLGMNANGERSIDSGITSTNPSHENEFDLVGTV 142

Query: 124 -WKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQIL 181
            W++D++G  RR  E+  A+  SA   +++A +++IS +   Y +    ++R  I+   +
Sbjct: 143 SWELDIWGANRRRSEAEYAHFLSAQESLNLAVISLISDVASRYYEWLDIEQRYQISLNTV 202

Query: 182 DLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG--- 238
           +L KK   L+ L+   G  S L + + E E +S    +P L+   +   + +  LLG   
Sbjct: 203 ELRKKERNLARLRKENGVISGLEVRQAEVEYQSARVTLPDLDFERQEKANQVRILLGEFS 262

Query: 239 YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSD 298
           YP         K      P+L+    +G+P+ ++  RPD++  E+ L  + A +G+AK+ 
Sbjct: 263 YPLAVKTETDIKAEGKLFPDLFA---VGVPSQMLSQRPDVKAAEQGLIAANANVGVAKTA 319

Query: 299 LYPSLSLNGSIAL-THDNS--FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQY 355
            +PS ++ GS    + D S  F      WS    +  PIF+ G I +    A+  +++  
Sbjct: 320 FFPSFTITGSYGRESADLSSIFDSQGVTWSLLGGITAPIFNAGSIAAQYDIAQEESKQAL 379

Query: 356 ITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDIL 415
           + ++ TVL A  EV +A+ S    +  +   Q  V    +   L+M+ YR G  S LD++
Sbjct: 380 LAYRSTVLRAYFEVNDAMNSFRRSELAIEAQQELVAASTEYNRLAMLRYRNGVSSSLDLM 439

Query: 416 DIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           D +R+    ++ LS+ KR    S + LY A+G G
Sbjct: 440 DAQRSLFGAQLSLSLVKRDRLLSMITLYRALGGG 473


>gi|301309122|ref|ZP_07215066.1| outer membrane efflux protein OprM [Bacteroides sp. 20_3]
 gi|300832804|gb|EFK63430.1| outer membrane efflux protein OprM [Bacteroides sp. 20_3]
          Length = 468

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 104/417 (24%), Positives = 217/417 (52%), Gaps = 20/417 (4%)

Query: 52  WWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS-----------S 100
           WW +F D  L+ L+++A++QN ++  A +RI  AK N+ S +    P+           S
Sbjct: 55  WWRNFKDPLLDSLIEVAVKQNYSVQMAMDRIAMAKANLRSAQGSYSPTLGLSAGWTRQQS 114

Query: 101 YASISHRFIPNLKTN-STGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVIS 158
             +I+   +P   T  S+  +D +W++D+FG  R  +++   N  ++  + + A +++ +
Sbjct: 115 SGNINQ--VPKAITQYSSATVDMNWEVDVFGSIRNRVKAEKENFAASKEEYNAAMVSLCA 172

Query: 159 KLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESD 218
           ++  SYI+ R  ++ + +A Q     +  ++++  ++  G  SKL + + ++   S ++ 
Sbjct: 173 QVASSYINMRELQQEVKVAQQNCRSQQTVVQITQKRYETGLVSKLDVAQAQSVYYSTKAS 232

Query: 219 IPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDI 278
           +P LE       ++++ LLG   ++    M+  ++   P    P+ +G+PA+L+  RPD+
Sbjct: 233 LPMLEAGIIQYANSLAILLGLYPSDLQKIMETDAS--LPEYIEPVGVGLPANLLLRRPDV 290

Query: 279 RYQEKKLADSVAKIGIAKSDLYPSLSLNGSIAL-THD-NSFPGYNT-HWSFGPKLYLPIF 335
           R  E+++    A +G +KSD +P + + GS+   +HD +    +N+  +   P L    F
Sbjct: 291 RAAERQVNALAASLGASKSDWWPKVFVKGSVGFASHDFDKLANHNSLTYEIAPTLTWNFF 350

Query: 336 DKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKK 395
              +     R A++   E    + +TVL +++EV+NA++S     K +  L+  V   K+
Sbjct: 351 QGTQKIQATRLAKAQLDESIRQFNQTVLTSVQEVDNAMSSYKNSIKQIVALREVVNQGKQ 410

Query: 396 SMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           ++ LS+  Y+QG     ++LD +R+    +  L+ A+     + + LY ++G G+NP
Sbjct: 411 TLDLSLDLYKQGLTPFQNVLDAQRSLLTYQNQLTQAQGSSLLNLIQLYQSLGGGWNP 467


>gi|237746058|ref|ZP_04576538.1| outer membrane protein oprM [Oxalobacter formigenes HOxBLS]
 gi|229377409|gb|EEO27500.1| outer membrane protein oprM [Oxalobacter formigenes HOxBLS]
          Length = 477

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 117/456 (25%), Positives = 232/456 (50%), Gaps = 29/456 (6%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+GC +GP+Y +P +P+  T   + +S +   ID+ +WWE F D  LN +V+ A+  N  
Sbjct: 16  LSGCMMGPDYRRPDLPVPETYRFVPDSASQQAIDS-RWWEDFGDPVLNGMVEEAIVNNRD 74

Query: 75  ILQATERINAAKENILSVRADLFP-------SSYASISHR------FIPNLKTNSTGQLD 121
           +  A      A   I+  R+DLFP       +    +S R       +PN ++     L 
Sbjct: 75  LRAALANAEKAAAAIMMARSDLFPQISLNARTGRERLSERDAEPVIGVPNPQSAREASLG 134

Query: 122 SDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI 180
           + W+IDL+G+ RR  ES+ A+  S       A L+V+S ++  YI+     E++ IA   
Sbjct: 135 ATWEIDLWGRIRRLTESAEADAKSVEQARRAALLSVVSSVVTQYINLLALDEQLKIAQNT 194

Query: 181 LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP 240
            D Y +++ +  L+F  G TS++++ +  ++ ++ +S IP + ++     + ++ L+G  
Sbjct: 195 SDNYAESLRIIELQFQYGVTSRMTVAQAASQYETAQSQIPQIRQNITQTENALNILMGKN 254

Query: 241 ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLY 300
               +  +    N  +P + +P +  +P++L+  RPD+   E+ L  + A IG  ++  +
Sbjct: 255 PGPVMRGLSL--NRLKPPV-VPAD--LPSNLLLRRPDVLEAEQDLVSANAMIGATRAMYF 309

Query: 301 PSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYIT 357
           P++SL G+   + +   N + G    WSF   + +P+F  G I S +++AE+  +     
Sbjct: 310 PTISLTGAFGSSSESLKNLWKGDAKTWSFAGVVSMPVFQGGSIYSQVKQAEAEQRAALAR 369

Query: 358 WQETVLNAIKEVENALT---SINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDI 414
           ++ TV +A  +V+NAL+    +NE      +L + +  + +   L+ + Y +G  +   +
Sbjct: 370 YEGTVQSAFADVDNALSMRMRVNEQLDREIRLVNQLSDYSR---LAKLQYDEGYSAYSVV 426

Query: 415 LDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           L  +++    ++ L+  K     S V++Y ++G G+
Sbjct: 427 LQADQSLFPRQLTLAQLKASSLTSVVNVYKSLGGGW 462


>gi|209518429|ref|ZP_03267252.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. H160]
 gi|209501150|gb|EEA01183.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. H160]
          Length = 490

 Score =  171 bits (433), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 121/471 (25%), Positives = 222/471 (47%), Gaps = 35/471 (7%)

Query: 12  IVLLAGCTVGPEY----TKPHMPLLPTQFSIGNSKNLINIDTL--KWWESFNDTSLNKLV 65
           I LL+ CTVGP+Y               F    +K ++       +WW +  D  LN L+
Sbjct: 20  ISLLSACTVGPDYRGAPAVAPEAASAATFVRTPAKGIVTSGPAPSQWWLALGDPQLNALI 79

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFP--SSYASISHRFIPNLKTNS------- 116
             A   N  +  A  R+ A++  +   RA   P  S+ A+      P+L   S       
Sbjct: 80  TAAFTHNPDLQAAQARLRASRAQLQQQRAAELPKLSADAAAVRLRQPSLSGLSSSSSQSS 139

Query: 117 ----------TGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
                     T   D+ W+IDLFG  RR IE++ A  ++  A +  A++++ +++  +YI
Sbjct: 140 SSGRGPLQLYTAGFDASWEIDLFGGTRRAIEAASAQSEAVDADLADAQVSLAAEVAQAYI 199

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
             R  ++R++IA +  DL ++ + L+  +   G  + + + +L  +++S  S +  L   
Sbjct: 200 GLRDQQQRLAIAQRTADLQQQMLTLTEQRRAGGTAADVDVERLVTQVESTRSTLTPLAAQ 259

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
             +++  ++ L G         + +      P +   +++  PA ++  RPDIR  E++L
Sbjct: 260 VEISLDQLAVLTGRAPGALDAELAEM--GALPTMPTSLSVVDPATMLAQRPDIRAAERRL 317

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGY-----NTHWSFGPKLYLPIFDKGKI 340
           A S A+IG   +D +P L+L G ++ T  +  PG+     N  W   P L   +FD G+ 
Sbjct: 318 ASSNAQIGEHIADFFPKLTLYGDLSFTAGD--PGHLFRKANASWLGAPYLSWNVFDFGRT 375

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           +  +R AE+S  E    +++TVL A+++  + L+     ++ +  LQ        S  L+
Sbjct: 376 QGAVRGAEASRDEAIANYEKTVLAALQDANDGLSRFGYQREHLATLQKVQASAVHSADLT 435

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
              YR G  SL+D+LD +R     + D+   + +L K +V L  ++G G++
Sbjct: 436 RQRYRAGTTSLIDLLDTQRTEFAAQQDVVAGQAELLKDFVSLQKSLGLGWH 486


>gi|300022444|ref|YP_003755055.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Hyphomicrobium denitrificans ATCC 51888]
 gi|299524265|gb|ADJ22734.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Hyphomicrobium denitrificans ATCC 51888]
          Length = 510

 Score =  171 bits (432), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 126/481 (26%), Positives = 228/481 (47%), Gaps = 35/481 (7%)

Query: 4   LRAIFSLFIVLLAGCTVGPEYTKPHM--PLLPTQFSIGNSKNLINIDT------LKWWES 55
           L+ + +     L+GC +GP+Y  P +  P + T  SI +     +ID       ++WW  
Sbjct: 7   LKFLLTTLAGALSGCALGPDYLLPRIGAPGMFTTSSIADQGAARSIDQSSSPEIVRWWTL 66

Query: 56  FNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRA---DLFPSSYA--------SI 104
             D  L  L++ A+  N  I  A   I AA+ N ++VR     LF ++ A        S 
Sbjct: 67  LKDPQLGSLIERAIAANPDIEIAANHIRAARANEVAVRGLALPLFEANAAAARGTGTNST 126

Query: 105 SHRFIP--NLKTNSTG--------QLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAK 153
             R     N  TN+ G          D+ W++D FG+ RR  E++  + D A  Q     
Sbjct: 127 KGRVAGPLNAATNTAGLKEITHVAGFDAGWELDFFGKDRRAYEAAQYSTDVAIEQRHAVL 186

Query: 154 LNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIK 213
           ++V++++  +YI+ R  + +I  + + +   ++  +L   +F +G T++L       ++ 
Sbjct: 187 VSVVAEVAKAYIETRGVQAKIKASKENVARAQRTYDLMKTRFDRGLTNELDFKLASRQLA 246

Query: 214 SIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIR 273
           ++++ +  L          I+ LLG  +      ++  S N  P     +  G+P D+IR
Sbjct: 247 TLKAQLAPLSAVEYAGCARIAVLLGTYSGGICQELK--SVNRIPATPDHLKTGLPVDVIR 304

Query: 274 NRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPG---YNTHWSFGPKL 330
            RPD+R  E++LA   A+IG+A +DL+P L +     L             + +S GP +
Sbjct: 305 RRPDVRAAERQLAVETARIGVAVADLFPRLQITAGGGLQGQGLGVVPVVTKSIYSVGPSV 364

Query: 331 YLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAV 390
           Y P+ D G + S +   +  A  QY+T++  ++++I+E+  AL+      + +  L  AV
Sbjct: 365 YWPLLDFGTLDSLVHIQQLQADAQYLTYKRVIISSIEEINVALSRYRAAMETLQSLAKAV 424

Query: 391 ELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +  K ++ LS   Y +G    L +LD ER   ++E+    AK   A ++V +Y A+G G+
Sbjct: 425 KESKGAVDLSTARYDRGVTDSLYVLDAERQDDELELQYLQAKADAAIAFVAVYKALGGGW 484

Query: 451 N 451
            
Sbjct: 485 E 485


>gi|261251644|ref|ZP_05944218.1| putative outer membrane protein [Vibrio orientalis CIP 102891]
 gi|260938517|gb|EEX94505.1| putative outer membrane protein [Vibrio orientalis CIP 102891]
          Length = 549

 Score =  171 bits (432), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 135/488 (27%), Positives = 254/488 (52%), Gaps = 49/488 (10%)

Query: 6   AIFSLFIVLLAGCTV-GPEYTKPHMPLLPTQFSIGNSKNLINIDTLK---WWESFNDTSL 61
           AI SL  + L+ CTV GP++T P    LP+ +S+  + +       K   WW+ FND +L
Sbjct: 11  AILSL--LGLSACTVVGPDFTLPEQRPLPSDWSVEQTDSDSQKSQQKLHLWWQQFNDPTL 68

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADL-FPSSYA---SISHRFIPNLKTNST 117
           N+LV++A QQNL +  A  RI  A+ ++L +   L +P   A   +++  ++ +   N+ 
Sbjct: 69  NQLVEMASQQNLDLEAAGLRIVQAR-SLLGISTGLQYPQVQAVSGNLTRAYVNDQGVNNA 127

Query: 118 G-QLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERIS 175
           G   D+ W++D++G+  R IES+ A+  ++ A      + + S++  +YI+ R F+ER+ 
Sbjct: 128 GLSFDAGWEMDVWGKYARGIESAEASYYASVASYHDIMVTITSEVARNYINYRTFQERLL 187

Query: 176 IAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIST 235
           ++ + +++ ++ + ++ ++F  G  ++L + + + ++ + ++ +P+LE + + +   +S 
Sbjct: 188 LSRRNIEIQQRVVNITQVQFDSGNVTELDVQQAKNQLFNTKAAMPSLEIAMKQSRMALSM 247

Query: 236 LLGYPATE---------FLHYM-----QKQSNNFQPNL-------YIP----INIGIPAD 270
           LLG   +E         F   M     Q +S+N +P L        +P    ++  + A+
Sbjct: 248 LLGVLPSEIEALLSSERFNQQMADYEAQFKSSNRKPALSGNNDRSIVPHPPMLDKQVDAN 307

Query: 271 LIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSF---- 326
           L+  RPD+   E +     AKIG+A++ LYP+ SL GSI +  D++ P  N+ +SF    
Sbjct: 308 LVMRRPDLLVSEMQARAQSAKIGVAETALYPNFSLFGSIGI--DSTVPDGNS-FSFSDSL 364

Query: 327 ----GPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKI 382
               GP     IF  G++K+NIR  ++  QE    + + VL A+ EV NAL + +   K 
Sbjct: 365 TMAIGPTFQWNIFQYGRVKNNIRFEDARFQETLTNYNKKVLQAVNEVTNALDAYDLYLKQ 424

Query: 383 VTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDL 442
            +    +V    ++ ++SM  Y  G+ S   +L       + E   +  K  +A   + L
Sbjct: 425 QSLRLQSVNSSIRAYNISMTQYENGQISFQRLLSSVEKMTRAEDSYASIKGNVANQVIAL 484

Query: 443 YIAIGSGY 450
           Y A+G G+
Sbjct: 485 YKALGGGW 492


>gi|187734619|ref|YP_001876731.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Akkermansia muciniphila ATCC BAA-835]
 gi|187424671|gb|ACD03950.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Akkermansia muciniphila ATCC BAA-835]
          Length = 457

 Score =  171 bits (432), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 126/451 (27%), Positives = 221/451 (49%), Gaps = 14/451 (3%)

Query: 10  LFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIAL 69
           L    L  C VGP++  P   L P  +      +  + D   WW  F D  LN+LV  +L
Sbjct: 11  LAACFLGSCMVGPDFRTPTNDL-PATWEANRPPHSSDKDLRSWWNIFGDPQLNRLVSTSL 69

Query: 70  QQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK-TNSTGQ-----LDSD 123
             N  +  A  RI  A+E +   +A L PS+ AS      P+    +ST Q       + 
Sbjct: 70  NNNPDMKVALLRIREAREKLRVSQASLLPSADASAGWSLSPDRGFRSSTSQNFSLGASTS 129

Query: 124 WKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILD 182
           W++DLFG  RR IE+S A+L S  A     +  +++ +  +Y D     E++ IA + L+
Sbjct: 130 WELDLFGGNRRSIEASRASLMSTEASAGAVRTALLADVATAYFDWITACEQLRIAREQLE 189

Query: 183 LYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPAT 242
           + +  + ++  ++      +L + +  + + S ES IP LE     + + ++ LLG   +
Sbjct: 190 IQRSTLTIAEKRYKTEFAPRLDVEQATSTVASTESRIPQLEAQVASSKNQLAVLLGTYNS 249

Query: 243 EFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPS 302
                + K S  F+    +P+  G+P++L+R RPD+   E  L  +VA +G+A +DLYP 
Sbjct: 250 RVELTLPKASV-FEKTPTVPV--GLPSELLRRRPDVIAAEADLHAAVANVGVAVADLYPR 306

Query: 303 LSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQ 359
            SL GS++    +    F   N  WS G  L  P+F  G +++ +R  +++A++   T++
Sbjct: 307 FSLTGSLSSRGGDFGQLFRENNNAWSLGGNLLQPLFRGGALRATVRAQKAAAEQAAETYR 366

Query: 360 ETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIER 419
           +T++ A+ EVE+AL +       +  L      ++++  LS   Y  G    L+++  +R
Sbjct: 367 KTLITAVSEVEDALIAYGSYTSQMQYLHKENNANREAFQLSRTLYINGETDFLNVITAQR 426

Query: 420 ATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +    E  L   K+ + K+ V L  A+G G+
Sbjct: 427 SWLSSEESLVTMKQNIRKAVVQLARALGGGW 457


>gi|167624092|ref|YP_001674386.1| RND efflux system outer membrane lipoprotein [Shewanella
           halifaxensis HAW-EB4]
 gi|167354114|gb|ABZ76727.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Shewanella halifaxensis HAW-EB4]
          Length = 512

 Score =  171 bits (432), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 124/455 (27%), Positives = 214/455 (47%), Gaps = 21/455 (4%)

Query: 12  IVLLAGCTVGPEYTKPHMPLLPTQFSIG-NSKNLINIDTLKWWESFNDTSLNKLVKIALQ 70
           I+LL+GC +GP+Y +P + + P QF       +  N+    W E + D  L  L++ AL 
Sbjct: 37  ILLLSGCAMGPDYQRPDLEI-PEQFHHELQQTDEQNVGLKHWREFYLDPELQVLIEHALD 95

Query: 71  QNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSD------- 123
           QNL +     R+ AA+  +    A LFP      +     +    ST  +  D       
Sbjct: 96  QNLDLEGVRSRLLAARAGVTVTDAALFPVVGLDANGERALDSALTSTDPVKEDTFYVAGT 155

Query: 124 --WKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI 180
             W++DL+G  RR  E+  AN  S+   +++A +++IS +   Y +    ++R  I+   
Sbjct: 156 VSWELDLWGANRRRSEAEFANFISSQEALNLATISLISDVASRYYEWLDIEQRYQISLNT 215

Query: 181 LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG-- 238
           ++L KK  +L+ L+   G  S L + + E E +S    +P L+       + +  LLG  
Sbjct: 216 VELRKKERDLARLRKQNGVISGLQVRQAEVEYQSARVTLPDLDYERSEKANQLRILLGEF 275

Query: 239 -YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKS 297
            YP         K      P+ +    +G+P+ ++  RPD++  E+ L  + A +G+AK+
Sbjct: 276 KYPLIPKTEAQLKAEGALFPDSFA---VGVPSQMLSQRPDVKSAEQALVAANANVGVAKT 332

Query: 298 DLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQ 354
             +P  +++GS         + F      WS    +  PIF+ GKI +    A+  A++ 
Sbjct: 333 AFFPKFTISGSYGSESESLSDIFDSQGITWSLLGGITAPIFNAGKITAQYDIAQEDAKQA 392

Query: 355 YITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDI 414
            ++++ TVL A  EV +A+ S    +  +   Q  V    +   L+ + YR G  S LD+
Sbjct: 393 MLSYRSTVLGAYFEVNDAMNSFRRSELAIDAQQELVVASTEYTRLATLRYRNGVSSSLDL 452

Query: 415 LDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           +D +R+    E+ LS  KR    S + LY A+G G
Sbjct: 453 MDAQRSLFSAELTLSQVKRDQLLSMITLYRALGGG 487


>gi|300698004|ref|YP_003748665.1| RND efflux transporter outer membrane lipoprotein [Ralstonia
           solanacearum CFBP2957]
 gi|299074728|emb|CBJ54286.1| RND efflux transporter, outer membrane lipoprotein [Ralstonia
           solanacearum CFBP2957]
          Length = 507

 Score =  171 bits (432), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 125/470 (26%), Positives = 220/470 (46%), Gaps = 60/470 (12%)

Query: 17  GCTVGPEYTKPHMPLLPT-QFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTI 75
            C + P Y  P   +    Q  + +  ++ ++  + WW  FND ++ +L++ A   + T+
Sbjct: 38  ACALQPPYQAPQTAIATRWQAELPHGASVASL--VDWWSRFNDPAVAELIRRAEADSPTL 95

Query: 76  LQATERINAAKENILSVRADLFPS-----------SYASISHRFIPNLKTNSTGQLDSDW 124
            +A  +IN+A+  ++S  AD +P+           S  +     + +L T  +G LD+ W
Sbjct: 96  AKAVAQINSARATLVSNGADAWPALTGSASVTRAKSATATGDTAVSSLSTTRSGALDASW 155

Query: 125 KIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLY 184
           +IDLFG+ R      A+  SA AQ++            + ID  H   R+S+A ++ D Y
Sbjct: 156 EIDLFGKVR------ASRQSAQAQLE------------ARIDDWH-DARVSLAAEVADDY 196

Query: 185 KKNIELSHLK--FTQGATSKLSLVKLE----------------AEIKSIESDIPTLEKSF 226
            +      L   + Q A S+    K                  A+  +  ++    ++S 
Sbjct: 197 VQYRACRQLAKAYAQSAASRAQTAKATRAAVAAGMSAASDGYLADGSTASANATATQQSV 256

Query: 227 RMN--VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGI---PADLIRNRPDIRYQ 281
                V ++  L G         + +      P+L  P    +   PADL+R RPD+   
Sbjct: 257 ACETLVKSLVALTGTDEPTLRGIIDRPGA---PDLPQPDTFSVTSVPADLVRQRPDLASA 313

Query: 282 EKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIK 341
           E++L+ + A I  A++D +PSLSL+GSIA++   S     + WSFGP L LP+FD G+ K
Sbjct: 314 ERELSAAYASIAKARADRFPSLSLSGSIAVSA-TSLVAPMSSWSFGPSLSLPLFDAGQRK 372

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           + +  A++S   Q  T++  V  A+KEVE AL  ++   +     + A E +++ +    
Sbjct: 373 AAVDSAQASYDAQLATYRSAVRTAVKEVEQALVDLDGAARRSDDARQAAEQYRRYVGAIE 432

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            N+R G  +LL + +  R+    E+ L   +R   + +V LY A+G G+ 
Sbjct: 433 TNWRAGLDTLLTLEEARRSATTAEITLIELQRDRVRDWVSLYKALGGGWQ 482


>gi|237724772|ref|ZP_04555253.1| outer membrane protein oprM [Bacteroides sp. D4]
 gi|229436967|gb|EEO47044.1| outer membrane protein oprM [Bacteroides dorei 5_1_36/D4]
          Length = 457

 Score =  171 bits (432), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 123/456 (26%), Positives = 226/456 (49%), Gaps = 29/456 (6%)

Query: 12  IVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQ 71
           + LL  C +G  YT+P + L P Q      ++ ++I  ++WWE + DT+L  L++  L  
Sbjct: 14  MTLLTSCQLGKHYTRPDLHL-PQQLDTLQQQDTLSIADMQWWEIYTDTTLQSLIEKTLDN 72

Query: 72  NLTILQATERIN--AAKENILSVRADLFP------------SSYASISHRFIPNLKTNST 117
           N  +  A  R+   AA + I    A+LFP            S+Y   +++  P L     
Sbjct: 73  NKDMKIAAARVKELAAMKRI--DFANLFPQLNGGAYAQKEGSNYGGNNYKNDPEL----G 126

Query: 118 GQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISI 176
           G+L   W++DL+G  R   + S+A    +       K++++S++  +Y +       ++I
Sbjct: 127 GKLTVTWELDLWGNLRWAKDKSIAQFLGSIEAQRALKMSIVSEVAQAYFELVALDNELNI 186

Query: 177 AHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL 236
             Q L   K+ + L+ L+F  G TS+ S  + + E     + +P LE+   +  ++I+ L
Sbjct: 187 VRQTLYARKEGVRLAKLRFEGGLTSETSYQQAQVEYARTATLVPELERKISLKENDIAFL 246

Query: 237 LGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
            G    E+ H +Q+     +  L   + +G+P+ L+  RPD+R  E+KL  + A +GIA 
Sbjct: 247 AG----EYPHRIQRSILPEEVKLPETLPVGLPSTLLERRPDVREAEQKLIAANASVGIAY 302

Query: 297 SDLYPSLSLNGSIALTHD--NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQ 354
           ++++P LSL     +  +  + F     H+  G  L  P+F  GK ++ ++  +++ +++
Sbjct: 303 TNMFPRLSLTAQYGVESEEFSDFFKSPIHYISG-NLLTPLFAMGKYRATLQAKKAAYEQE 361

Query: 355 YITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDI 414
             +++++VL A KE  NA+   N+ K I           K +M L+ + Y  G    LD+
Sbjct: 362 CYSYEKSVLTAFKEARNAIVDFNKIKDIYESRLQLERSSKATMELAQLQYINGVIGYLDV 421

Query: 415 LDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           LD +R+    ++ LS A R    + V LY A+G G+
Sbjct: 422 LDAQRSYFDAQIGLSNAIRDKQITLVKLYKALGGGW 457


>gi|207725051|ref|YP_002255448.1| outer membrane lipoprotein [Ralstonia solanacearum MolK2]
 gi|206590281|emb|CAQ37242.1| outer membrane lipoprotein [Ralstonia solanacearum MolK2]
          Length = 494

 Score =  171 bits (432), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 127/469 (27%), Positives = 216/469 (46%), Gaps = 58/469 (12%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTIL 76
            C + P Y  P   +  TQ+             + WW  FND ++ +L++ A   + T+ 
Sbjct: 25  ACALQPPYQAPQTAIA-TQWQAELPHGASVTGLVDWWSRFNDPAVAELIRRAEADSPTLA 83

Query: 77  QATERINAAKENILSVRADLFPSSYASIS-----------HRFIPNLKTNSTGQLDSDWK 125
           +A  +IN+A+  ++S  AD +P+   S S              + +L T  +G LD+ W+
Sbjct: 84  KAVAQINSARATLVSNGADAWPALTGSASVTRAKSATASGDTAVSSLSTTRSGALDASWE 143

Query: 126 IDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYK 185
           IDLFG+ R      A+  SA AQ++            + ID  H   R+S+A ++ D Y 
Sbjct: 144 IDLFGKVR------ASRQSAQAQLE------------ARIDDWH-DARVSLAAEVADDYV 184

Query: 186 KNIELSHLK--FTQGATSKLSLVKLE----------------AEIKSIESDIPTLEKSFR 227
           +      L   + Q A S+    K                  AE  +  ++    E+S  
Sbjct: 185 QYRACRQLAKAYAQSAASRAQTAKATRAAVAAGMTAASDGYLAEGSTASANATATEQSVA 244

Query: 228 MN--VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGI---PADLIRNRPDIRYQE 282
               V ++  L G         + +      P+L  P    +   PADL+R RPD+   E
Sbjct: 245 CETLVKSLVALTGTDEPTLRGIIDRPGA---PDLPRPDTFSVTSVPADLVRQRPDLASAE 301

Query: 283 KKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
           ++L+ + A I  A+++ +PSLSL+GSIA++   S     + WSFGP L LP+FD G+ K+
Sbjct: 302 RELSAAYASIAKARANRFPSLSLSGSIAVSA-TSLVAPMSSWSFGPSLSLPLFDAGQRKA 360

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            +  A++S   Q  T++  V  A+KEVE AL  ++   +     + A E +++ +     
Sbjct: 361 AVDSAQASYDAQLATYRSAVRTAVKEVEQALVDLDGAARRSDDARQAAEQYRRYVGAIET 420

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           N+R G  +LL + +  R+    E+ L   +R   + ++ LY A+G G+ 
Sbjct: 421 NWRAGLDTLLTLEEARRSATTAEITLIELQRDRVRDWISLYKALGGGWQ 469


>gi|299069838|emb|CBJ41119.1| RND efflux transporter, outer membrane lipoprotein [Ralstonia
           solanacearum CMR15]
          Length = 503

 Score =  171 bits (432), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 116/463 (25%), Positives = 224/463 (48%), Gaps = 38/463 (8%)

Query: 13  VLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQN 72
           ++L+ C + P Y  P   +  TQ+             + WW  FND ++ +L++ A   +
Sbjct: 34  LVLSACALQPPYQAPQTAIA-TQWQAERPHGASVASLVDWWSRFNDPAVAELIRRAEADS 92

Query: 73  LTILQATERINAAKENILSVRADLFPS-----------SYASISHRFIPNLKTNSTGQLD 121
            ++ +A  +IN+A+  ++S  AD +PS           S  +     I +L T  +G LD
Sbjct: 93  PSLAKAVAQINSARATLVSNGADAWPSLTGSASVTRAKSATATGDTTISSLSTTRSGGLD 152

Query: 122 SDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI 180
           + W+IDLFG+ R   +S+ A L++       A++++ +++   Y+  R  ++  +   Q 
Sbjct: 153 ASWEIDLFGKVRASRQSAQAQLEARIDDWHDARVSLAAEVADDYVQYRACRQLATAYAQA 212

Query: 181 LDLYKKNIELSHLK------------FTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
                +  + +                 +G+T+  +    E  + S E+ + +L      
Sbjct: 213 AASRAQTAKSTRAAVAAGMTAASDGYLAEGSTASANATATEQSV-SCETLVKSLVALTGT 271

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
           +   +  ++  P    L          QP+ +   ++  PADL+R RPD+   E+ LA  
Sbjct: 272 DEPTLRGIIDRPGAPDLP---------QPDTFSVTSV--PADLVRQRPDLASAERDLAAD 320

Query: 289 VAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
            A I  A+++ +PSLSL+GSIA++   +     + WSFGP L +P+FD G+ K+ +  A+
Sbjct: 321 YASIAKARANRFPSLSLSGSIAISA-TTLAAPMSSWSFGPSLSVPLFDAGQRKAAVDSAQ 379

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           ++   Q  T++ +V  A+KEVE AL +++   +     + A E +++ +S    N+R G 
Sbjct: 380 ATYDAQLATYRSSVRTAVKEVEQALVALDGAARRSDDARQAAEQYRRYVSAIETNWRAGL 439

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            +LL + +  R++   E+ L   +R   + ++ LY A+G G+ 
Sbjct: 440 DTLLTLEEARRSSTTAEITLIELQRDRVRDWITLYKALGGGWQ 482


>gi|229587708|ref|YP_002869827.1| putative ABC transporter lipoprotein [Pseudomonas fluorescens
           SBW25]
 gi|229359574|emb|CAY46416.1| putative ABC transport system, lipoprotein [Pseudomonas fluorescens
           SBW25]
          Length = 481

 Score =  171 bits (432), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 123/475 (25%), Positives = 236/475 (49%), Gaps = 39/475 (8%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPT------QFSIGNSKNLINIDTLKWWESFNDT 59
           A  +L ++ L+ CTVGP++ KP    LP       Q     S+ + +    +WW+ F+D 
Sbjct: 5   AWLTLSLISLSACTVGPDFHKPQS--LPVSQWNEPQGRQATSRAVSDPLQERWWDVFHDA 62

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQ 119
            L+ L + AL  NL +  A+ R+  ++       A+ +P+  A+  +     L+  ++G+
Sbjct: 63  QLSALTRRALTDNLDLKLASSRLQQSRAVRQVTTAERYPNLSANADY-----LRQRNSGK 117

Query: 120 LDSD--------------------WKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVIS 158
             SD                    W++D +G+ +R  E++ A L  A        L+V++
Sbjct: 118 GLSDPSGNNGRSAFNQWDMGFSASWELDFWGRVKRETEAADATLQVAEDDRRAVLLSVLA 177

Query: 159 KLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESD 218
           +    YI  R  +   ++  Q LD+ + +++LS L+   G  + L + +  A++ +IE+ 
Sbjct: 178 ETAQDYIQLRGVQNTRAVTEQNLDVARHSLKLSQLRLADGVATDLDVAEAAAQVAAIEAR 237

Query: 219 IPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDI 278
           +P L++     ++ +S L+G P  + LH  Q   +   P     + IG+P++L   RPDI
Sbjct: 238 LPDLQQRQDQLINALSLLMGEP-PQALH-AQLSKDAAVPQTQRQVAIGLPSELAERRPDI 295

Query: 279 RYQEKKLADSVAKIGIAKSDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIF 335
           R  E +L  + A IG+AK D YP ++L+GS+   A+   +     +  ++FGP+  LP+F
Sbjct: 296 RQAEARLHAATASIGVAKGDFYPRITLSGSLGSQAMQLSDLGSWGSRAFAFGPQFSLPLF 355

Query: 336 DKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKK 395
           + G+++  +   E+  QE  + +Q+TVL A  E+++ LT  N  +     L  AV  ++ 
Sbjct: 356 NGGRLQGMLNLREAQQQEAALAYQQTVLRAWHEIDDQLTRYNASQLRRDSLAEAVRQNQI 415

Query: 396 SMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           ++S +   Y +G    +++L ++ A    +     +   ++ + V LY A+G G+
Sbjct: 416 ALSTAQQQYVEGVVDFVNVLTVQSALLATQEQWVESSTGVSLAMVGLYKALGGGW 470


>gi|295689163|ref|YP_003592856.1| NodT family RND efflux system outer membrane lipoprotein
           [Caulobacter segnis ATCC 21756]
 gi|295431066|gb|ADG10238.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Caulobacter segnis ATCC 21756]
          Length = 466

 Score =  171 bits (432), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 124/465 (26%), Positives = 216/465 (46%), Gaps = 27/465 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSI-----GNSKNLINIDTLKWWES 55
           M+ L A+  +F +L++ C  GP Y +P  P +   +       G+S  L     L WW  
Sbjct: 1   MDRLLAVAPVFALLVSACAAGPNYNRPP-PAVAAAWQAPVPHGGDSGKL-----LAWWSG 54

Query: 56  FNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHR-------- 107
           F+D  L  L   A + + ++ QA   I+ A+  + + RA   P+   S S          
Sbjct: 55  FDDPILTSLQASAEKTSPSLDQAIANIDKARATLTTQRAAALPNLTGSTSRTKSRQESAA 114

Query: 108 FIPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYID 166
               +   S   LD+ W+IDLFG+ RR++E++ A +++       A++++ +++   Y+ 
Sbjct: 115 GGATISKVSQAALDASWEIDLFGKARRNVEAARARIEARTDDWHEARISLAAEVADDYVQ 174

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
            R  ++   +  Q  +  + +  L  L    G +        +A   S  S         
Sbjct: 175 LRGCEQLAEVLRQATESQETSARLIRLNADAGFSPASDAALADASAASTRSSFTDQRGQC 234

Query: 227 RMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLA 286
            + V ++++L G         MQ  +        + +   +PADL+R RPD+   E++LA
Sbjct: 235 DLLVKSLASLTGLEEPALRTLMQPSAGVLPAPRKLDVT-SVPADLVRQRPDVASSERELA 293

Query: 287 DSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
            + A+IG A +DLYPSL+L+GSI+ +      G    WSFGP L LPIFD G+  +++R 
Sbjct: 294 ATSAEIGAAVADLYPSLTLSGSISTSA-----GLQ-QWSFGPSLSLPIFDGGQRLASVRS 347

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
           A +S   Q   +++ V +A+ +VE AL  +N  ++     + A   ++ S   +   YR 
Sbjct: 348 ARASYAYQLAAYRQAVRDAVLDVEQALVQLNVARQQQGDAETAARGYQASFKATDQLYRA 407

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           G   LLD     R     E  L   +    + ++ LY A+G G++
Sbjct: 408 GASDLLDRESARRNALDAEQSLINVRLTEIRQWIALYKALGGGWD 452


>gi|312958232|ref|ZP_07772754.1| RND efflux system [Pseudomonas fluorescens WH6]
 gi|311287498|gb|EFQ66057.1| RND efflux system [Pseudomonas fluorescens WH6]
          Length = 481

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 121/469 (25%), Positives = 235/469 (50%), Gaps = 27/469 (5%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFS-----IGNSKNLINIDTLKWWESFNDTS 60
           A  +L ++ L  CTVGP++ +P  P + TQ+S       +S+ + +    +WW+ F+D  
Sbjct: 5   AWLTLSLISLNACTVGPDFQRPQTPQV-TQWSEPQGRQADSRAVSDPLQERWWDVFHDEQ 63

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK---TNST 117
           L+ L + AL  NL +  A+ R+  ++       A+ +P   A+ +++   N     ++ +
Sbjct: 64  LSALTRRALTDNLDLKLASSRLEQSRAVRQVTTAERYPEVNATGAYQRKRNSGKGLSDPS 123

Query: 118 GQ------------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSY 164
           G+              + W++D +G+ +R  E++ A L  A        L+V+++    Y
Sbjct: 124 GENGRAAFNQWDMGFSAAWELDFWGRVKRETEAADATLQVAENDRRAVLLSVLAETAQDY 183

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           I  R  +   ++  Q LD+ + ++ LS L+   G  + L + +  A++ +IE+ +P L++
Sbjct: 184 IQLRGVQNTRAVTEQNLDVARHSLRLSQLRLADGVATDLDVAEAAAQVAAIEARLPDLQQ 243

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
                ++ +S L+G P  + LH  Q   +   P     + IG+P+ L   RPDIR  E +
Sbjct: 244 RQDQLINALSLLMGEP-PQALH-AQLSKDAAVPQAPRQVAIGLPSQLAERRPDIRQAEAR 301

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIA--LTHDNSFPGYNTH-WSFGPKLYLPIFDKGKIK 341
           L  + A IG+AK D YP ++L+G++         F  + +  ++FGP+L LP+F+ G++K
Sbjct: 302 LHAATASIGVAKGDFYPRITLSGNLGSQAMQLADFGSWGSRAFAFGPQLSLPLFNGGRLK 361

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
             +   E+  QE  + +Q TVL A  E+++ LT  N  +     L  AV  ++ ++  + 
Sbjct: 362 GMLNLREAQQQEAALAYQHTVLRAWHEIDDQLTRYNASQLRRDSLAEAVRQNQIALVTAQ 421

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             Y +G    +++L ++ A    +     +   ++ + V LY A+G G+
Sbjct: 422 HQYVEGVADFVNVLTVQSALLATQEQWVESSTGVSLAMVGLYKALGGGW 470


>gi|331014325|gb|EGH94381.1| outer membrane efflux protein [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 490

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 128/481 (26%), Positives = 229/481 (47%), Gaps = 41/481 (8%)

Query: 1   MNILRAI-FSLFIVLLAGCTVGPEYTKPHMPLLPTQF-SIGNSKNLINIDTLK---WWES 55
           + +LR +   L I LL+ C VGP+Y KP     P QF +    +     D +    WWE 
Sbjct: 12  LELLRPLGLGLCIALLSACAVGPDYQKPSSAT-PAQFKAAAGWRAATPSDAMAKGAWWEV 70

Query: 56  FNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS---------------- 99
           + D  LN LV      N T+ Q   +   A+  + S R   FP+                
Sbjct: 71  YGDAQLNTLVARLNTSNQTVAQYDAQYRQAQALVRSSRGAFFPTLDLTTGKTRSGQGAGT 130

Query: 100 SYASISHRFIPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVIS 158
           S +  S+     ++ +   QL   W+ D++G+ RR +E+  AN  ++ A +   +L++ S
Sbjct: 131 SSSGTSNTSASGIRNSYNAQLGVSWEADVWGKLRRVLEADTANAQASLADLAAMRLSLQS 190

Query: 159 KLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESD 218
           +L+ +Y+  R   E+  +    +D Y++++ L+  ++  G     ++ + + ++KS ++D
Sbjct: 191 ELVQNYMQLRVIDEQKRLLESTVDAYQRSLTLTRNQYRAGIAGTDAVAQAQTQLKSTQAD 250

Query: 219 IPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP----INIGIPADLIRN 274
           +  L        + I+ L+G    +F         N  P   IP    I  G+P+ L+  
Sbjct: 251 LIDLVWQRAQFENAIAVLMGVAPADF---------NLPPTTTIPQLPQIPPGVPSQLLER 301

Query: 275 RPDIRYQEKKLADSVAKIGIAKSDLYP--SLSLNGSI-ALTHDNSFPGYNTHWSFGPKLY 331
           RPDI   E+ +  + A IG+AK+  YP  +LS++G   + T  N     N  WS GP+L 
Sbjct: 302 RPDIAAAERSVMGANANIGVAKAAYYPDFTLSMSGGYNSSTFANWISLPNRFWSVGPQLA 361

Query: 332 LPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVE 391
           L +FD G+  + + R E+   +    +++TVLN  +EVEN L  +   ++     Q A+ 
Sbjct: 362 LTLFDGGRRSAEVDRTEALYDQTVAQYRQTVLNGFQEVENYLIQLKVYEEEAAVRQEALV 421

Query: 392 LHKKSMSLSMINYRQGRYSLLDILDIE-RATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             + S+ L+   Y+ G    LD+++++  A +     L++ + +L  S V L  A+G G+
Sbjct: 422 AARDSLRLTNNQYKAGLIGYLDVVNVQATALSNERTVLNVLQSRLIAS-VQLIAALGGGW 480

Query: 451 N 451
           N
Sbjct: 481 N 481


>gi|270262706|ref|ZP_06190977.1| hypothetical protein SOD_c03280 [Serratia odorifera 4Rx13]
 gi|270043390|gb|EFA16483.1| hypothetical protein SOD_c03280 [Serratia odorifera 4Rx13]
          Length = 485

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 134/468 (28%), Positives = 232/468 (49%), Gaps = 34/468 (7%)

Query: 14  LLAGCTVGPEYTKPHMPL---LPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQ 70
           LLAGC VGP+Y +P  PL      Q ++ +           WWE F+D  L+ LV  AL 
Sbjct: 15  LLAGCAVGPDYHRPDAPLSDRYQAQSAVQHRSAARPASFAVWWEGFDDPLLSDLVSSALA 74

Query: 71  QNLTILQATERINAAKENILSVRADLFPS---------SYASISHRFIPNLKT----NST 117
           QNL + QA+ R+  A+  + +  A L PS         +Y S+       L +    N  
Sbjct: 75  QNLDLAQASARMAQARAALGAATAALLPSGNISGQATRAYQSVETPLGQVLSSTPDYNRY 134

Query: 118 G-----QLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
           G      L++ W+ID+FG  RR  +++LA+  ++ A V   +L V ++    YI  R  +
Sbjct: 135 GNAYEADLNASWEIDIFGGLRRGRQAALADYQASEAGVAATRLAVAAQTADIYITLRGLQ 194

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
            R++IA++ +   ++ +E   L  ++G  ++  + + E  +  +++ +P L+      ++
Sbjct: 195 TRLAIANKQVSTQQELLEKVQLLHSKGLAAEYQVRQTEGALAQVQATVPILQTGLDAAMN 254

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
            +  +LG P     H  Q  +    P      + G PADL+R RPDI   E+ LA S A+
Sbjct: 255 ALDVMLGTPPGT--HRAQLTTPGAIPQAPQLTSTGTPADLLRRRPDIIVAERHLAASSAR 312

Query: 292 IGIAKSDLYPSLSLNG----SIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
           IG+A S+ YP  SL+     + A+   N F    +  +    L   +FD G+I + I +A
Sbjct: 313 IGVAVSEYYPKFSLSALLGSATAVASGNLFSSGASQSAGVLGLRWRLFDFGRINAQIDQA 372

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTS-INEDKK--IVTKLQHAVELHKKSMSLSMINY 404
           +    E    ++ +VL A ++VENA ++ IN + +  I+T  + A+   ++S   S + Y
Sbjct: 373 KGQEAEALAAYRLSVLRATEDVENAFSALINRETQAAILTGGETALASARQS---SFVAY 429

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           RQG  SL+D+L  +    +     + A+ + A++ V  + A+G G+ P
Sbjct: 430 RQGTASLIDVLRNDETLLQASDARAQAQTESARAAVAAFRALGGGWQP 477


>gi|91778779|ref|YP_553987.1| major facilitator superfamily efflux pump outer membrane
           lipoprotein [Burkholderia xenovorans LB400]
 gi|91691439|gb|ABE34637.1| MFS efflux pump, outer membrane lipoprotein, NodT family
           [Burkholderia xenovorans LB400]
          Length = 547

 Score =  170 bits (431), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 126/509 (24%), Positives = 239/509 (46%), Gaps = 76/509 (14%)

Query: 13  VLLAGCTVGPEYTKPHMPLLPTQF----------SIGNSKNLINIDTL------KWWESF 56
           +LLA C VGP++  P   + P Q+          +  ++ N+ ++ TL      +WW +F
Sbjct: 28  MLLAACAVGPDFHAPKADV-PDQWRDPQRSAAIATGASAANVASVPTLDTDPDPRWWRNF 86

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHR--------F 108
           ND +L+ L+  A + NL + +A  RI  A+  + S  +   P+  A+ S++        F
Sbjct: 87  NDPTLDALIGRAARGNLDLQEAVLRIVEARTQVQSAASQGLPNVRATGSYQREQLGVKGF 146

Query: 109 I--------------PNLKTNS---------------------------TGQLDSDWKID 127
           +              PN   N+                               D+ W++D
Sbjct: 147 LESDGVYGKVDQLGAPNSPVNAIAPGAGATLQNGANNLLNQLTAPVNLWQAGFDASWELD 206

Query: 128 LFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKK 186
           LFG+ RR +E++ A  ++A    + A L++ +++  +Y+  R  +   +I   ++D  ++
Sbjct: 207 LFGRVRRSVEAANAQTEAAVESRNDALLSLEAEVAQTYMQLRGAQALHAITASLVDEQRE 266

Query: 187 NIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLH 246
            + L+  +   G TS+L +    A++   ++ +P  E+     ++ ++ L+G        
Sbjct: 267 IVTLTQSQAKVGLTSELDVKSATAQLAQTQAQLPQYEQQIAQALNGLAYLVGEAPGAL-- 324

Query: 247 YMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLN 306
            ++  +    P +   + +G+P+ L R RPDIR  E  L  + A +G+A +  YP +SL 
Sbjct: 325 EVELAAPAAVPPVPPVVPVGLPSTLARRRPDIRRAEASLHSATANVGVAVAQFYPDVSLT 384

Query: 307 GSIALTHDNSFPGYNTHWS-----FGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQET 361
           G +     N+     + WS     FGP + LPIF  G + SN+R +++   E  + +++T
Sbjct: 385 GQVGTRATNA--SDLSRWSHLFYSFGPSISLPIFQGGALVSNLRLSKAQEAEAALDYRKT 442

Query: 362 VLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERAT 421
           VL A+++V+NALT    D+     L  +V   + +  L+  +YR+G  S +++LD ER  
Sbjct: 443 VLMALRDVDNALTVYRTDQARRDSLGESVAAEQAAFDLARDSYRKGITSFINVLDAERQL 502

Query: 422 AKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           A+     +    Q++   V LY A+G G+
Sbjct: 503 AQARQQYAQGTMQVSTDLVSLYKALGGGW 531


>gi|325204671|gb|ADZ00125.1| multiple transferable resistance system protein MtrE [Neisseria
           meningitidis M01-240355]
          Length = 467

 Score =  170 bits (431), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 126/449 (28%), Positives = 222/449 (49%), Gaps = 22/449 (4%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F    + + I    L W + F D  L KL+ IAL++N +
Sbjct: 18  LSACTMIPQYEQPKVEVAET-FKNDTADSGIRAVDLGWHDYFADPRLQKLIDIALERNTS 76

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSDWKI-------- 126
           +  A       ++  +  R +L P+  A+ +     +L   S G + S +K+        
Sbjct: 77  LRTAVLNSEIYRKQYMIERNNLLPTLAANANDSRQGSL---SGGNVSSSYKVGLGAASYE 133

Query: 127 -DLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLY 184
            DLFG+ R   E++L    ++ A  D A L++I+ +  +Y + R+ +E +S+A ++L   
Sbjct: 134 LDLFGRVRSSSEAALQGYFASTANRDAAHLSLIATVAKAYFNERYAEEAMSLAQRVLKTR 193

Query: 185 KKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEF 244
           ++  +LS L++  G  S ++L + EA I+S ++D     +S     + ++TL+  P  + 
Sbjct: 194 EETYKLSELRYKAGVISAVALRQQEALIESAKADYAHAARSREQARNALATLINQPIPDD 253

Query: 245 LHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLS 304
           L         F       +  G+ ++++ +RPDIR  E  L  + A IG A++  +PS+ 
Sbjct: 254 LPAGLPLDKQF---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAFFPSIR 310

Query: 305 LNGSIALTHDNSFPGY----NTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQE 360
           L GS+  TH     G        WSF P + LPIF  G  K+N+  A+   Q Q + ++ 
Sbjct: 311 LTGSVD-THSAELGGLFKSGTGVWSFAPSITLPIFTWGTNKANLDVAKLRQQAQIVAYES 369

Query: 361 TVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERA 420
            V +A ++V NAL +  +  K    L       K+++ L  + Y+ G    LD+LD ER+
Sbjct: 370 AVQSAFQDVANALAAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGALDLLDAERS 429

Query: 421 TAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           +   E     A+   A++  DLY A+G G
Sbjct: 430 SYSAEGAALSAQLTRAENLADLYKALGGG 458


>gi|330965336|gb|EGH65596.1| outer membrane efflux protein [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 490

 Score =  170 bits (431), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 123/472 (26%), Positives = 225/472 (47%), Gaps = 46/472 (9%)

Query: 12  IVLLAGCTVGPEYTKPHMPLLPTQF-SIGNSKNLINIDTLK---WWESFNDTSLNKLVKI 67
           I LL+ C VGP+Y KP     P QF +    +     D +    WWE + D  LN LV+ 
Sbjct: 24  IALLSACAVGPDYQKPSSAA-PEQFKAAAGWRAATPSDAMAKGAWWEVYGDAQLNTLVER 82

Query: 68  ALQQNLTILQATERINAAKENILSVRADLFPS----------------SYASISHRFIPN 111
               N T+ Q   +   A+  + S R   FP+                S +  S+     
Sbjct: 83  LNTSNQTVAQYDAQYRQAQALVRSSRGAFFPTLDLTTGKTRSGQGAGTSSSGTSNTGASG 142

Query: 112 LKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
           ++ +   QL   W+ D++G+ RR +E+  AN  ++ A +   +L++ S+L+ +Y+  R  
Sbjct: 143 IRNSYNAQLGVSWEADVWGKLRRGLEADTANAQASLADLAAMRLSLQSELVQNYMQLRVI 202

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
            E+  +    +D Y++++ L+  ++  G     ++ + + ++KS ++D+  L        
Sbjct: 203 DEQKRLLESTVDAYQRSLTLTRNQYRAGIAGTDAVAQAQTQLKSTQADLIDLVWQRAQFE 262

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIP----INIGIPADLIRNRPDIRYQEKKLA 286
           + I+ L+G    +F         N      IP    I  G+P+ L+  RPDI   E+ + 
Sbjct: 263 NAIAVLMGVAPADF---------NLPATTSIPQLPQIPPGVPSQLLERRPDIAAAERSVM 313

Query: 287 DSVAKIGIAKSDLYP--SLSLNGSIALTHDNSFPGY----NTHWSFGPKLYLPIFDKGKI 340
            + A IG+AK+  YP  +LS++G     + ++F  +    N  WS GP+L L +FD G+ 
Sbjct: 314 GANANIGVAKAAYYPDFTLSMSGGY---NSSTFANWISLPNRFWSVGPQLALTLFDGGRR 370

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
            + + R E+   +    +++TVLN  +EVEN L  +   ++     Q A+   + S+ L+
Sbjct: 371 SAEVDRTEALYDQTVAQYRQTVLNGFQEVENYLIQLKVYEEEAAVRQEALVAARDSLRLT 430

Query: 401 MINYRQGRYSLLDILDIE-RATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
              Y+ G    LD+++++  A +     L++ + +L  S V L  A+G G+N
Sbjct: 431 NNQYKAGLIGYLDVVNVQATALSNERTVLNVLQSRLIAS-VQLIAALGGGWN 481


>gi|256829950|ref|YP_003158678.1| NodT family RND efflux system outer membrane lipoprotein
           [Desulfomicrobium baculatum DSM 4028]
 gi|256579126|gb|ACU90262.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfomicrobium baculatum DSM 4028]
          Length = 479

 Score =  170 bits (431), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 122/455 (26%), Positives = 223/455 (49%), Gaps = 22/455 (4%)

Query: 12  IVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQ 70
           ++LL+GC ++ P Y  P +P+ P  ++  N+++  +   + W + F D SL  L++ AL 
Sbjct: 18  MILLSGCASMAPRYEAPALPVAPI-YAPDNAQDGASASAIGWRDYFIDPSLQNLIQRALD 76

Query: 71  QNLTILQATERINAAKENILSVRADLFPS-SYASISHRFIPNLKTNSTGQL--------- 120
            N  +  A  R+  A+      R++LFP+    +   R       N TG+          
Sbjct: 77  NNRDLRTAVLRVEEARAVHGIQRSELFPTVGIQAGEDRSRTPADLNMTGKTLFASQFQAG 136

Query: 121 --DSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIA 177
              + W++D +G+ R ++ ++L N  +  A    A L +++++  SY     F ERI++A
Sbjct: 137 LGMASWELDFWGRVRSLQDAALENFLATDAARRAAALGLVAQVADSYFRLLEFDERIALA 196

Query: 178 HQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLL 237
           HQ +    ++  +   +   G+TS+ SL +++  +   ++    LE+      H ++ L+
Sbjct: 197 HQTIASRTESFRIFTRRVEVGSTSRFSLTQVQTLLTQAQALGAQLEQEREAQFHALTLLV 256

Query: 238 GYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKS 297
           G  AT  +    +Q    + N  + +  G+P+DL+  RPDI   E +L  + A IG A++
Sbjct: 257 G--AT--IDPPPEQDQPGERNTLVRVRPGLPSDLLFQRPDIVAAEHRLKAANANIGAARA 312

Query: 298 DLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQ 354
             +P ++L GS+        + F   +  W F P + LPIFD G   +N+  AE      
Sbjct: 313 AFFPRIALTGSLGTASAELGDLFAAGSLAWIFSPSISLPIFDGGLRSANLSLAEIRLDMN 372

Query: 355 YITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDI 414
              +++TV  A ++V +AL++ +   + V+  Q A+E   +   LS + Y  G  + L++
Sbjct: 373 VANYEKTVQAAFRDVADALSARHWLARQVSIAQAALETQTERARLSQLRYDNGASAYLEV 432

Query: 415 LDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           LD +R     E  L   +R L  S+V LY A+G G
Sbjct: 433 LDAQRDLLDTEQRLVQMRRALLTSHVSLYAALGGG 467


>gi|304386805|ref|ZP_07369070.1| multiple transferable resistance system protein MtrE [Neisseria
           meningitidis ATCC 13091]
 gi|304339114|gb|EFM05203.1| multiple transferable resistance system protein MtrE [Neisseria
           meningitidis ATCC 13091]
          Length = 483

 Score =  170 bits (431), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 125/448 (27%), Positives = 220/448 (49%), Gaps = 20/448 (4%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F    + + I    L W + F D  L KL+ IAL++N +
Sbjct: 34  LSACTMIPQYEQPKVEVAET-FKNDTADSSIRAVDLGWHDYFADPRLQKLIDIALERNTS 92

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSDWKI-------- 126
           +  A       ++  +  R +L P+  A+ +     +L   S G + S +KI        
Sbjct: 93  LRTAVLNSEIYRKQYMIERNNLLPTLAANANGSRQGSL---SGGNVSSSYKIGLGAASYE 149

Query: 127 -DLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLY 184
            DLFG+ R   E++L    ++ A  D A L++I+ +  +Y + R+ +E +S+A ++L   
Sbjct: 150 LDLFGRVRSSSEAALQGYFASTANRDAAHLSLIATVAKAYFNERYAEEAMSLAQRVLKTR 209

Query: 185 KKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEF 244
           ++  +LS L++  G  S ++L + EA I+S ++D     +S     + ++TL+  P  E 
Sbjct: 210 EETYKLSELRYKAGVISAVALRQQEALIESAKADYAHAARSREQARNALATLINQPIPED 269

Query: 245 LHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLS 304
           L         F       +  G+ ++++ +RPDIR  E  L  + A IG A++  +PS+ 
Sbjct: 270 LPAGLPLDKQF---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAFFPSIR 326

Query: 305 LNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQET 361
           L G++          F      WSF P + LPIF  G  K+N+  A+   Q Q + ++  
Sbjct: 327 LTGTVGTGSAELGGLFKSGTGVWSFAPSITLPIFTWGTNKANLDVAKLRQQAQIVAYEAA 386

Query: 362 VLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERAT 421
           V +A ++V NAL +  +  K    L       K+++ L  + Y+ G    LD+LD ER++
Sbjct: 387 VQSAFQDVANALAAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGALDLLDAERSS 446

Query: 422 AKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
              E     A+   A++  DLY A+G G
Sbjct: 447 YSAEGAALSAQLTRAENLADLYKALGGG 474


>gi|254673966|emb|CBA09750.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Neisseria meningitidis alpha275]
 gi|325130756|gb|EGC53492.1| multiple transferable resistance system protein MtrE [Neisseria
           meningitidis OX99.30304]
          Length = 467

 Score =  170 bits (431), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 126/449 (28%), Positives = 222/449 (49%), Gaps = 22/449 (4%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F    + + I    L W + F D  L KL+ IAL++N +
Sbjct: 18  LSACTMIPQYEQPKVEVAET-FKNDTADSGIRAVDLGWHDYFADPRLQKLIDIALERNTS 76

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSDWKI-------- 126
           +  A       ++  +  R +L P+  A+ +     +L   S G + S +K+        
Sbjct: 77  LRTAVLNSEIYRKQYMIERNNLLPTLAANANDSRQGSL---SGGNVSSSYKVGLGAASYE 133

Query: 127 -DLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLY 184
            DLFG+ R   E++L    ++ A  D A L++I+ +  +Y + R+ +E +S+A ++L   
Sbjct: 134 LDLFGRVRSSSEAALQGYFASTANRDAAHLSLIATVAKAYFNERYAEEAMSLAQRVLKTR 193

Query: 185 KKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEF 244
           ++  +LS L++  G  S ++L + EA I+S ++D     +S     + ++TL+  P  + 
Sbjct: 194 EETYKLSELRYKAGVISAVALRQQEALIESAKADYAHAARSREQARNALATLINQPIPDD 253

Query: 245 LHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLS 304
           L         F       +  G+ ++++ +RPDIR  E  L  + A IG A++  +PS+ 
Sbjct: 254 LPAGLPLDKQF---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAFFPSIR 310

Query: 305 LNGSIALTHDNSFPGY----NTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQE 360
           L GS+  TH     G        WSF P + LPIF  G  K+N+  A+   Q Q + ++ 
Sbjct: 311 LTGSVD-THSAELGGLFKSGTGVWSFAPSITLPIFTWGTNKANLDVAKLRQQAQIVAYEA 369

Query: 361 TVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERA 420
            V +A ++V NAL +  +  K    L       K+++ L  + Y+ G    LD+LD ER+
Sbjct: 370 AVQSAFQDVANALAAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGALDLLDAERS 429

Query: 421 TAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           +   E     A+   A++  DLY A+G G
Sbjct: 430 SYSAEGAALSAQLTRAENLADLYKALGGG 458


>gi|157962015|ref|YP_001502049.1| RND efflux system outer membrane lipoprotein [Shewanella pealeana
           ATCC 700345]
 gi|157847015|gb|ABV87514.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Shewanella pealeana ATCC 700345]
          Length = 518

 Score =  170 bits (431), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 124/455 (27%), Positives = 215/455 (47%), Gaps = 21/455 (4%)

Query: 12  IVLLAGCTVGPEYTKPHMPLLPTQFSIG-NSKNLINIDTLKWWESFNDTSLNKLVKIALQ 70
           I+LL+GC +GP+Y +P + + P QF       +  N+    W + + D  L  L++ AL 
Sbjct: 42  ILLLSGCAMGPDYQRPDLEI-PEQFHHELQQTDEQNVGLKHWRDFYLDPDLQVLIEHALD 100

Query: 71  QNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSD------- 123
           QNL +     R+ AA+  +    A LFP      +     +    ST  +  D       
Sbjct: 101 QNLDLEGVRSRLLAARAGVTVTDAALFPVVGLDANGERALDSALTSTDPVKEDTFYVAGT 160

Query: 124 --WKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI 180
             W++DL+G  RR  E+  AN  S+   +++A +++IS +   Y +    ++R  I+   
Sbjct: 161 VSWELDLWGANRRRSEAEFANFISSQEALNLATISLISDVASRYYEWLDVEQRYQISLNT 220

Query: 181 LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG-- 238
           ++L KK  +L+ L+   G  S L + + E E +S    +P L+       + +  LLG  
Sbjct: 221 VELRKKERDLARLRKQNGVISGLQVRQAEVEYQSARVTLPDLDYERSEKANQLRILLGEF 280

Query: 239 -YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKS 297
            YP         K      P+ +    +GIP+ ++  RPD++  E+ L  + A +G+AK+
Sbjct: 281 TYPLIPKTEAQLKAEGALFPDSFA---VGIPSQMLSQRPDVKSAEQALVAANANVGVAKT 337

Query: 298 DLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQ 354
             +P  +++GS         + F      WS    +  PIF+ GKI +    A+ +A++ 
Sbjct: 338 AFFPKFTISGSYGSESESLSDIFDSQGLTWSLLGGVTAPIFNAGKISAQYDIAQENAKQA 397

Query: 355 YITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDI 414
            ++++ TVL A  EV +A+ S    +  +   Q  V    +   L+ + YR G  S LD+
Sbjct: 398 MLSYKSTVLGAYFEVNDAMNSFRRSELAIDAQQELVVASTEYTRLATLRYRNGVSSSLDL 457

Query: 415 LDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           +D +R+    E+ LS  KR    S + LY A+G G
Sbjct: 458 MDAQRSLFSAELTLSQVKRDRLLSMITLYRALGGG 492


>gi|312960658|ref|ZP_07775164.1| RND efflux transporter, outer membrane protein [Pseudomonas
           fluorescens WH6]
 gi|311285184|gb|EFQ63759.1| RND efflux transporter, outer membrane protein [Pseudomonas
           fluorescens WH6]
          Length = 476

 Score =  170 bits (431), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 126/482 (26%), Positives = 236/482 (48%), Gaps = 47/482 (9%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNS-KNLINIDTLK---WWESF 56
           M +L  +  +F  LL+ C VGP+Y +P + + P QF      +     D+L    WWE +
Sbjct: 1   MKVL--VMVMFGALLSACAVGPDYKRPEV-VEPAQFKEAQGWRQATPSDSLARGAWWELY 57

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH---------- 106
            D  LN LV      N T+ QA  R   A+  + S R   +P+   S             
Sbjct: 58  GDRQLNDLVVRLNNANQTVAQAEARFRQAQALVRSSRGAFYPTVDLSAGKTRASQGTGSS 117

Query: 107 -----RFIPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKL 160
                     ++     QL   W+ D++G+ RR +E++ A+ +++ A +   +L+  S+L
Sbjct: 118 SASLSSSSSGIRDTLNAQLGVSWEADIWGKLRRGLEANEASAEASSADLAAMRLSQQSEL 177

Query: 161 IPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIP 220
           + SY+  R   E+  +    LD Y+++++++  ++  G + K ++ + + ++K+ ++ + 
Sbjct: 178 VQSYLQLRVMDEQTRLLQATLDTYQRSLQMTENQYRAGVSCKDAVAQAQTQLKTTQASLI 237

Query: 221 TLEKSFRMNVHN-ISTLLGYPATEFLHYMQKQSNNFQPNLYIP----INIGIPADLIRNR 275
            L    R  + N I+ L+G     F         N   +  IP    I + +P+ L+  R
Sbjct: 238 DLIWQ-RAQLENAIAVLIGEAPANF---------NLAVSKDIPALPQIPVSLPSQLLERR 287

Query: 276 PDIRYQEKKLADSVAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYL 332
           PDI   E+ +  + A IG+AK+  YP L+L+   G  + T+ +     N  WS GPKL +
Sbjct: 288 PDIASAERSVIAANANIGVAKAAYYPDLTLSLAGGYSSSTYADWISLPNRFWSVGPKLAM 347

Query: 333 PIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSIN--EDKKIVTKLQHAV 390
            +FD G+  + + R  +S  E    +++TVL+  +EVEN +  +   ED+ +V+    A+
Sbjct: 348 TLFDGGQRSAEVDRTVASYDETVAKYRQTVLDGFREVENYMVQLKVLEDEAVVSN--EAL 405

Query: 391 ELHKKSMSLSMINYRQGRYSLLDILDIE-RATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           E  ++S+ L+   Y+ G  + LD++ ++  A +     L++ + +L  S V L  A+G G
Sbjct: 406 EAARESLRLTQNQYKAGLIAYLDVVTVQATALSNERTVLTLLQSRLVAS-VQLIAALGGG 464

Query: 450 YN 451
           ++
Sbjct: 465 WD 466


>gi|257093126|ref|YP_003166767.1| NodT family RND efflux system, outer membrane lipoprotein
           [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
 gi|257045650|gb|ACV34838.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
          Length = 472

 Score =  170 bits (431), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 124/458 (27%), Positives = 227/458 (49%), Gaps = 37/458 (8%)

Query: 16  AGCTVGPEYTKPHMPLLPT-QFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           +GC VGP+Y +P +      + S  ++++L N     WWE F D  LN LV  AL++N  
Sbjct: 15  SGCMVGPDYVRPPVDTPAAWRLSEQDARDLANT---AWWEQFGDPVLNDLVATALRENKD 71

Query: 75  ILQATERINAAKENILSVRADLFP---SSYASISHRFIPNLKTNSTGQ---------LDS 122
           ++ A  R+     N   VR+ LFP   + Y     R I  +   + G          L++
Sbjct: 72  LMIAAARVEQFAGNYGIVRSGLFPQVGAGYEVRRQRDISAVVVGAGGDETYNSYNAVLNA 131

Query: 123 DWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQIL 181
            W+ID++G+ RR  E++ A L ++        L+++  +  +YI+ R    ++ IA    
Sbjct: 132 SWEIDIWGRIRRQTEAARAQLMASEEGRRAVILSLVGSVSGAYINLRDLDRQLDIARATA 191

Query: 182 DLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGY-- 239
               ++ E+  L+F  G  S L L +  ++ +   + IP LEK+     + +S LLG   
Sbjct: 192 KSRGESYEIFKLRFAGGIISVLELSQNRSQYEEALASIPPLEKAIAQQENGLSVLLGRNP 251

Query: 240 ---PATEFLHYMQKQSNNFQPNLYIP-INIGIPADLIRNRPDIRYQEKKLADSVAKIGIA 295
              P  + + +           L +P I  G+P+DL+  RPDIR  E+ L  + A+IG A
Sbjct: 252 GPIPRGKDIDH-----------LALPAIPAGLPSDLLERRPDIRRTEQDLIAANAQIGAA 300

Query: 296 KSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQ 352
           K+  +P++SL G          N F   +  W++G  + +PIF  G I   ++ AE++ Q
Sbjct: 301 KAAYFPTISLTGLFGYASTSLSNLFDSQSKVWNYGAPITMPIFTAGAIAGQVQAAEAAQQ 360

Query: 353 EQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLL 412
           +    +Q+ +  A +EV ++L S +  ++ +   +  VE  ++  + + + Y  G  S +
Sbjct: 361 QALFAYQKAIQEAFREVNDSLVSRDRTREQLKAQRRQVEALQQYAATARLRYDNGYTSYI 420

Query: 413 DILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           ++LD ER+   V++  +  ++   +S ++LY+A+G G+
Sbjct: 421 EVLDAERSLFNVQLQYTQTQQVEFQSMINLYLAMGGGW 458


>gi|325128747|gb|EGC51610.1| multiple transferable resistance system protein MtrE [Neisseria
           meningitidis N1568]
 gi|325205574|gb|ADZ01027.1| multiple transferable resistance system protein MtrE [Neisseria
           meningitidis M04-240196]
          Length = 467

 Score =  170 bits (430), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 124/448 (27%), Positives = 220/448 (49%), Gaps = 20/448 (4%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F    + + I    L W + F D  L KL+ IAL++N +
Sbjct: 18  LSACTMIPQYEQPKVEVAET-FKNDTADSGIRAVDLGWHDYFADPRLQKLIDIALERNTS 76

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSDWKI-------- 126
           +  A       ++  +  R +L P+  A+ +     +L   S G + S +K+        
Sbjct: 77  LRTAALNSEIYRKQYMIERNNLLPTLAANANDSRQGSL---SGGNVSSSYKVGLGAASYE 133

Query: 127 -DLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLY 184
            DLFG+ R   E++L    ++ A  D A L++I+ +  +Y + R+ +E +S+A ++L   
Sbjct: 134 LDLFGRVRSSSEAALQGYFASTANRDAAHLSLIATVAKAYFNERYAEEAMSLAQRVLKTR 193

Query: 185 KKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEF 244
           ++  +LS L++  G  S ++L + EA I+S ++D     +S     + ++TL+  P  E 
Sbjct: 194 EETYKLSELRYKAGVISAVALRQQEALIESAKADYAHAARSREQARNALATLINQPIPED 253

Query: 245 LHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLS 304
           L         F       +  G+ ++++ +RPDIR  E  L  + A IG A++  +PS+ 
Sbjct: 254 LPAGLPLDKQF---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAFFPSIR 310

Query: 305 LNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQET 361
           L G++          F      WSF P + LPIF  G  K+N+  A+   Q Q + ++  
Sbjct: 311 LTGTVGTGSAELGGLFKSGTGVWSFAPSITLPIFTWGTNKANLDVAKLRQQAQIVAYESA 370

Query: 362 VLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERAT 421
           V +A ++V NAL +  +  K    L       K+++ L  + Y+ G    LD+LD ER++
Sbjct: 371 VQSAFQDVANALAAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGALDLLDAERSS 430

Query: 422 AKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
              E     A+   A++  DLY A+G G
Sbjct: 431 YAAEGAALSAQLTRAENLADLYKALGGG 458


>gi|307825958|ref|ZP_07656172.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Methylobacter tundripaludum SV96]
 gi|307732933|gb|EFO03796.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Methylobacter tundripaludum SV96]
          Length = 497

 Score =  170 bits (430), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 120/453 (26%), Positives = 232/453 (51%), Gaps = 29/453 (6%)

Query: 20  VGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQAT 79
           VGP+Y  P         +IG+ +       + WW+ F D  L +LV   ++ N  +  A 
Sbjct: 41  VGPDYKTPATDAGQAFANIGHPEFSEQGVEVVWWKLFEDKGLTELVDQTVRHNRNLQAAR 100

Query: 80  ERINAAKENILSVRADLFPS--SYASISHR-----------FIP-NLKTNSTGQLDSDWK 125
             +  A+   L    +L P+  S+A+ + +           + P  LK  S G  D+ W+
Sbjct: 101 ANLREARALYLDAGLNLAPTVTSHANYTEQKRSVGALNNLTYAPRELKLYSAG-FDAFWE 159

Query: 126 IDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLY 184
           +D FG+ RR++E+S   +D+  A +    +++I+++  +Y + R  ++++++A +     
Sbjct: 160 VDFFGRVRRNVEASSDEVDAQEANLRDLGVSLIAEVARNYFELRGLQQQLAVAKKNAGNQ 219

Query: 185 KKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG-YPATE 243
            + +E++ ++   G  ++L   +  A++ S  S IP L+ +    +H +S L G  P T 
Sbjct: 220 AQTLEITRVRLEGGRGTELDTSRATAQLDSTLSTIPPLDNAIHQAMHRLSVLTGQLPGT- 278

Query: 244 FLHYMQKQSNNFQPNLYIP--INIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYP 301
               + ++ +   P   IP  INIG PA+L+R RPDIR  E+ LA + A+IG+A +DL+P
Sbjct: 279 ----LTEKLSQPAPLPKIPKTINIGRPAELLRRRPDIRIAERGLAAATARIGVATADLFP 334

Query: 302 SLSLNGSIALTHDNSFPGYNT----HWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYIT 357
            ++  G+++L    +  G        +S GPK+     D G++ + I+ A++ A+     
Sbjct: 335 RVTFVGTLSL-EATTLSGIGAVGSDAYSVGPKISWAALDLGRVYARIKAADARAEASLAQ 393

Query: 358 WQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDI 417
           +++TVL+A++E ENAL + N ++     L  A +  +++  L+ + + +G    L +LD 
Sbjct: 394 YEQTVLSALEETENALVNYNRERSRRELLTSAAQASERAHELAHLRFAEGVSDFLTVLDT 453

Query: 418 ERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           E    + +  L+ ++   A +   LY A+G G+
Sbjct: 454 ELRLLQDQDRLAQSQTATATALAALYKALGGGW 486


>gi|224371895|ref|YP_002606061.1| outer membrane protein [Desulfobacterium autotrophicum HRM2]
 gi|223694614|gb|ACN17897.1| outer membrane protein [Desulfobacterium autotrophicum HRM2]
          Length = 499

 Score =  170 bits (430), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 119/451 (26%), Positives = 220/451 (48%), Gaps = 22/451 (4%)

Query: 18  CTVGPEYTKPHMPLLPTQFSIGNSKNLI----NIDTLK-WWESFNDTSLNKLVKIALQQN 72
             VGP+Y  P  P  P  ++    K L     +  TL  WW +FND +L KL++ A+  N
Sbjct: 38  AVVGPDYMVPD-PGAPKGWNTALPKGLTAAPPDARTLAGWWSTFNDPALTKLIERAVAGN 96

Query: 73  LTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQ--------LDSDW 124
           L +     R+  A+      RAD+FP+   S +   +        G          D+ W
Sbjct: 97  LDLGLGRARVREARARRGIARADVFPTMNVSGAAARVHTSSETDLGTANDLYDAGFDAGW 156

Query: 125 KIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDL 183
           ++DLFG  RR +E + A+ +++   +    +++++++  +Y++ R F+ R+S+A      
Sbjct: 157 ELDLFGGVRRSVEVAEASFEASQEGLHDVMVSLLAEVALNYVEVRSFQTRLSLAEANQRA 216

Query: 184 YKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGY-PAT 242
            ++   +   +   G TS L L +    ++   S IP L        + ++ L+G  P +
Sbjct: 217 QEQTYGMVATRSQTGMTSNLDLEQARYNLEETRSQIPLLHAGLEQAKNRLAVLVGQNPGS 276

Query: 243 EFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPS 302
                 ++++    P     + +G+PAD +R RPDIR  E++LA   A +G+A + LYP 
Sbjct: 277 LKDELAERKAIPTPPPT---VAVGVPADALRRRPDIRKAERELAAQTAVVGVATARLYPR 333

Query: 303 LSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQ 359
            +L GSI   AL+  N F   +  +  GP     +FD G+I+ NI    +  ++  + ++
Sbjct: 334 FTLAGSIGLEALSLANLFERESGTFGLGPSFQWNLFDAGRIRQNIEVQNAIQEQALLRYE 393

Query: 360 ETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIER 419
            +VL A+ EVE+ LT   E++     L  A    ++++ ++   YR G     ++L+ +R
Sbjct: 394 ASVLKALAEVEDTLTGYAEEQTRQRSLTAASGAAQRAVEIAQDQYRSGLTDFQNVLNGQR 453

Query: 420 ATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           A   ++  L+ ++  +A   + LY A+G G+
Sbjct: 454 ALLSLQDQLAQSQGAVASDLISLYKALGGGW 484


>gi|297568606|ref|YP_003689950.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfurivibrio alkaliphilus AHT2]
 gi|296924521|gb|ADH85331.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfurivibrio alkaliphilus AHT2]
          Length = 471

 Score =  170 bits (430), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 130/474 (27%), Positives = 244/474 (51%), Gaps = 32/474 (6%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLI--------NIDTLKWWE 54
           + R    LF +LLAGC++GPEY +P +   P ++        I         +   +WW 
Sbjct: 1   MFRYSLMLFAILLAGCSLGPEYHRPEVAA-PVEYRYAEGYEEIWQQGEPADELPKGQWWR 59

Query: 55  SFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS---SYASISHRFIPN 111
            + D +LN+L + A   N  +  A  R++ A+      RADLFP      ++   R   +
Sbjct: 60  IYQDPALNELQERAAANNQQLRAAVARLDQARAVAGLSRADLFPRLDLQPSAQRGRTADD 119

Query: 112 LKTNSTGQ--------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIP 162
           L     GQ        LD  +++D+ G+ RR  E++ A +D++ A+++  +L + S++  
Sbjct: 120 LSPLGEGQTTTTINLPLDLGYELDIRGRLRRLNEAAAAEVDASAAEMESFRLTLHSEVAR 179

Query: 163 SYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTL 222
           +Y          ++  +   L ++N  L   ++  G + KL L + E E+ + E+++  L
Sbjct: 180 TYFTLLTLDRETALLEKTAQLRRQNQRLISSRYQHGLSDKLDLSRAETELAAAEAEVIML 239

Query: 223 EKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP-INIGIPADLIRNRPDIRYQ 281
            +      H ++ LLG PA+ F H    ++  FQ    +P +  G+PA+L++ RPD+   
Sbjct: 240 RQRRSEVEHALALLLGEPASNFAHAA-NEAEEFQ----VPEVKPGLPAELLQRRPDVAAA 294

Query: 282 EKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKG 338
           E++L  + A+IG AK+  +PS+ L G+     +   +     N  W+FGP++ LPIFD G
Sbjct: 295 ERRLMAANARIGAAKAAFFPSIRLTGAAGFGSNELSSLLASGNRFWNFGPQISLPIFDGG 354

Query: 339 KIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMS 398
           + ++ + +A ++ +E    +Q+T+L A++EVE+AL ++    +     Q A+   ++++ 
Sbjct: 355 RNRAQLEQARAAHEEALADYQQTLLQAMQEVEDALATLALLHQQQQAQQRALRHARETVG 414

Query: 399 LSMINYRQGRYSLLDILDIER-ATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           L+   YR G  S L+I++ ER A  +    L  + +QL ++ + L  A+G G++
Sbjct: 415 LAHQRYRAGLVSYLEIIESERSALTQERAALQTSNQQL-QANIALIKALGGGWD 467


>gi|66957908|gb|AAY59070.1| outer membrane channel protein [Pseudomonas sp. M18]
          Length = 480

 Score =  170 bits (430), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 116/471 (24%), Positives = 221/471 (46%), Gaps = 41/471 (8%)

Query: 18  CTVGPEYTKPHMPLLPTQFSIGNSKNLI---------NIDTLKWWESFNDTSLNKLVKIA 68
           CTVGP+Y +P   + P ++   +S              +    WW+ F D  L+ L   A
Sbjct: 11  CTVGPDY-QPPQSVSPQRWGDWHSGPEALRSTRHEGERLRDQAWWKVFGDPVLDDLQARA 69

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPS------------SYASISHRFIPNLKTNS 116
           +Q N  +  A  R   A+     V +   P             S   +++R +   +  +
Sbjct: 70  MQANPELHGAILRFAQARMQRRIVSSAYLPEVTLEGGVSRQKQSLYGMNNRLLEATEPGN 129

Query: 117 TGQL---------------DSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKL 160
              L               D+ W+ DL+G+  R +E++ A +  A A +D   L++ S++
Sbjct: 130 REALEKALGDPFTLYQAGFDASWEPDLWGRVGRSVEAARAEIGMAAAALDDTLLSISSEV 189

Query: 161 IPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIP 220
             SYI+ R  + +I +  + + + ++ + L  ++  +G T +L + + +AE++++   +P
Sbjct: 190 ARSYIEVRTAQRQIRLLEEDIRMLEERLRLVRVRAGEGLTDELYVERQKAELEALRGRLP 249

Query: 221 TLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRY 280
             + S     + I+ LLG         ++ +  N          +G+P++L+R RPDIR 
Sbjct: 250 AWQASETEATNRIAVLLGERPGALARTLEAKPGNVLERALPDFRLGVPSELVRQRPDIRA 309

Query: 281 QEKKLADSVAKIGIAKSDLYPSLSLNGSIALT--HDNSFPGYNTH-WSFGPKLYLPIFDK 337
            E+ L  + A IGIAK+ LYPS++L          D  F  + +  WS GP L LP+FD 
Sbjct: 310 AEQSLHRATADIGIAKAALYPSIALGARFGYESYRDGKFGEWGSRAWSIGPTLDLPLFDA 369

Query: 338 GKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSM 397
           G+ ++ +R  E   QE  +T+Q TVL A +EV++AL+  + + +    ++      +++ 
Sbjct: 370 GRRRTVVRLRELEQQEAAVTFQRTVLGAWQEVDDALSRYHAEYQRNLHMRDKAASSRQAY 429

Query: 398 SLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGS 448
             + + Y QG+   L+ +D +R + + + +L  ++  L    + LY  +G 
Sbjct: 430 EWTQVKYAQGQVDFLEEIDAQRTSMQAQRELIDSEALLRTQLIALYKTLGG 480


>gi|254805463|ref|YP_003083684.1| probable outer membrane lipoprotein [Neisseria meningitidis
           alpha14]
 gi|254669005|emb|CBA07385.1| probable outer membrane lipoprotein [Neisseria meningitidis
           alpha14]
          Length = 467

 Score =  170 bits (430), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 126/449 (28%), Positives = 222/449 (49%), Gaps = 22/449 (4%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F    + + I    L W + F D  L KL+ IAL++N +
Sbjct: 18  LSACTMIPQYEQPKVEVAET-FKNDTADSGIRAVDLGWHDYFADPRLQKLIDIALERNTS 76

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSDWKI-------- 126
           +  A       ++  +  R +L P+  A+ +     +L   S G + S +K+        
Sbjct: 77  LRTAVLNSEIYRKQYMIERNNLLPTLAANANDSRQGSL---SGGNVSSSYKVGLGAASYE 133

Query: 127 -DLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLY 184
            DLFG+ R   E++L    ++ A  D A L++I+ +  +Y + R+ +E +S+A ++L   
Sbjct: 134 LDLFGRVRSSSEAALQGYFASTANRDAAHLSLIATVAKAYFNERYAEEAMSLAQRVLKTR 193

Query: 185 KKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEF 244
           ++  +LS L++  G  S ++L + EA I+S ++D     +S     + ++TL+  P  + 
Sbjct: 194 EETYKLSELRYKAGVISAVALRQQEALIESAKADYAHAARSREQARNALATLINQPIPDD 253

Query: 245 LHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLS 304
           L         F       +  G+ ++++ +RPDIR  E  L  + A IG A++  +PS+ 
Sbjct: 254 LPAGLPLDKQF---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAFFPSIR 310

Query: 305 LNGSIALTHDNSFPGY----NTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQE 360
           L GS+  TH     G        W F P + LPIF  G  K+N+  A+   Q Q + ++ 
Sbjct: 311 LTGSVD-THSAELGGLFKSGTGVWLFAPSITLPIFTWGTNKANLDVAKLRQQAQIVAYES 369

Query: 361 TVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERA 420
            V +A ++V NALT+  +  K    L       K+++ L  + Y+ G    LD+LD ER+
Sbjct: 370 AVQSAFQDVANALTAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGALDLLDAERS 429

Query: 421 TAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           +   E     A+   A++  DLY A+G G
Sbjct: 430 SYSAEGAALSAQLTRAENLADLYKALGGG 458


>gi|325145096|gb|EGC67379.1| multiple transferable resistance system protein MtrE [Neisseria
           meningitidis M01-240013]
          Length = 483

 Score =  170 bits (430), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 124/448 (27%), Positives = 220/448 (49%), Gaps = 20/448 (4%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F    + + I    L W + F D  L KL+ IAL++N +
Sbjct: 34  LSACTMIPQYEQPKVEVAET-FKNDTADSGIRAVDLGWHDYFADPRLQKLIDIALERNTS 92

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSDWKI-------- 126
           +  A       ++  +  R +L P+  A+ +     +L   S G + S +K+        
Sbjct: 93  LRTAALNSEIYRKQYMIERNNLLPTLAANANDSRQGSL---SGGNVSSSYKVGLGAASYE 149

Query: 127 -DLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLY 184
            DLFG+ R   E++L    ++ A  D A L++I+ +  +Y + R+ +E +S+A ++L   
Sbjct: 150 LDLFGRVRSSSEAALQGYFASTANRDAAHLSLIATVAKAYFNERYAEEAMSLAQRVLKTR 209

Query: 185 KKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEF 244
           ++  +LS L++  G  S ++L + EA I+S ++D     +S     + ++TL+  P  E 
Sbjct: 210 EETYKLSELRYKAGVISAVALRQQEALIESAKADYAHAARSREQARNALATLINQPIPED 269

Query: 245 LHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLS 304
           L         F       +  G+ ++++ +RPDIR  E  L  + A IG A++  +PS+ 
Sbjct: 270 LPAGLPLDKQF---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAFFPSIR 326

Query: 305 LNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQET 361
           L G++          F      WSF P + LPIF  G  K+N+  A+   Q Q + ++  
Sbjct: 327 LTGTVGTGSAELGGLFKSGTGVWSFAPSITLPIFTWGTNKANLDVAKLRQQAQIVAYESA 386

Query: 362 VLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERAT 421
           V +A ++V NAL +  +  K    L       K+++ L  + Y+ G    LD+LD ER++
Sbjct: 387 VQSAFQDVANALAAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGALDLLDAERSS 446

Query: 422 AKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
              E     A+   A++  DLY A+G G
Sbjct: 447 YAAEGAALSAQLTRAENLADLYKALGGG 474


>gi|304321871|ref|YP_003855514.1| multidrug efflux system outer membrane subunit [Parvularcula
           bermudensis HTCC2503]
 gi|303300773|gb|ADM10372.1| multidrug efflux system outer membrane subunit [Parvularcula
           bermudensis HTCC2503]
          Length = 452

 Score =  169 bits (429), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 125/452 (27%), Positives = 213/452 (47%), Gaps = 14/452 (3%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
            I    ++ L  C VGP+ T P + L P  +S     +L   D   WW  F D +L+ L+
Sbjct: 6   CILGGALLSLTACAVGPDPTAPTVDL-PATYSAALPADLAGQDEEVWWAGFEDETLSTLM 64

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF---IPNLKTNSTGQLDS 122
              L  NL I  A   ++ A     +VR+DLFP   A  S  +   I     + T  L S
Sbjct: 65  VDVLAGNLDIATALATLSEAAALRGAVRSDLFPRLDAQGSAEYADLISGEGESETTTLLS 124

Query: 123 D---WKIDLFG--QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIA 177
               +++DL G  +RR   ++     + +   +  +L   +  +  YID R    R+++ 
Sbjct: 125 GVLAFEVDLAGGNRRRLEAAAADLEAAGFGVREAQRLATGTAAL-QYIDLRRSGARLALL 183

Query: 178 HQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLL 237
              LDL  + +++   +F  G T  L + +  A++    +D   L+ + +     ++ L 
Sbjct: 184 ETSLDLQARTLDVVQARFDAGLTPALDVDRAAADLARTRADRGILQANRQAAAFTLAVLA 243

Query: 238 GYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKS 297
           G P  E   + Q  +++  P+    I +G PA L+R RPD+   E++L   +A IG  ++
Sbjct: 244 GRP-PERAQFGQS-TDDILPDYRGEITLGAPAMLLRQRPDVAQAEQRLIADLALIGAEQA 301

Query: 298 DLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYIT 357
           DLYPSL L   I+   D  F      ++    + +P+ D G+ ++ +R   + A+     
Sbjct: 302 DLYPSLRLPAQISGDPDTDF--EPLLFTLSAIVDIPLLDAGRRRAEVRAQIARAEASLAE 359

Query: 358 WQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDI 417
           WQ+TVL A+ EVE ALT I   +  +  L  AV+  +++       YR+G  S +D+LD 
Sbjct: 360 WQQTVLVALTEVETALTRIEALRSRLENLDLAVQRSEEAYRQLDALYREGLTSFIDVLDA 419

Query: 418 ERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           +R        +  A+  LA + V L+I +G+G
Sbjct: 420 QRTLIGSREAVVEARADLAVAIVQLHIGMGTG 451


>gi|218768728|ref|YP_002343240.1| putative outer membrane lipoprotein [Neisseria meningitidis Z2491]
 gi|121052736|emb|CAM09079.1| putative outer membrane lipoprotein [Neisseria meningitidis Z2491]
 gi|319410961|emb|CBY91357.1| outer-membrane lipoprotein MtrE [Neisseria meningitidis WUE 2594]
          Length = 467

 Score =  169 bits (429), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 126/449 (28%), Positives = 222/449 (49%), Gaps = 22/449 (4%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F    + + I    L W + F D  L KL+ IAL++N +
Sbjct: 18  LSACTMIPQYEQPKVEVAET-FKNDTADSGIRAVDLGWHDYFADPRLQKLIDIALERNTS 76

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSDWKI-------- 126
           +  A       ++  +  R +L P+  A+ +     +L   S G + S +K+        
Sbjct: 77  LRTAVLNSEIYRKQYMIERNNLLPTLAANANDSRQGSL---SGGNVSSSYKVGLGAASYE 133

Query: 127 -DLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLY 184
            DLFG+ R   E++L    ++ A  D A L++I+ +  +Y + R+ +E +S+A ++L   
Sbjct: 134 LDLFGRVRSSSEAALQGYFASTANRDAAHLSLIATVAKAYFNERYAEEAMSLAQRVLKTR 193

Query: 185 KKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEF 244
           ++  +LS L++  G  S ++L + EA I+S ++D     +S     + ++TL+  P  + 
Sbjct: 194 EETYKLSELRYKAGVISAVALRQQEALIESAKADYAHAARSREQARNALATLINQPIPDD 253

Query: 245 LHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLS 304
           L         F       +  G+ ++++ +RPDIR  E  L  + A IG A++  +PS+ 
Sbjct: 254 LPAGLPLDKQF---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAFFPSIR 310

Query: 305 LNGSIALTHDNSFPGY----NTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQE 360
           L GS+  TH     G        W F P + LPIF  G  K+N+  A+   Q Q + ++ 
Sbjct: 311 LTGSVD-THSAELGGLFKSGTGVWLFAPSITLPIFTWGTNKANLDVAKLRQQAQIVAYEA 369

Query: 361 TVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERA 420
            V +A ++V NALT+  +  K    L       K+++ L  + Y+ G    LD+LD ER+
Sbjct: 370 AVQSAFQDVANALTAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGALDLLDAERS 429

Query: 421 TAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           +   E     A+   A++  DLY A+G G
Sbjct: 430 SYSAEGAALSAQLTRAENLADLYKALGGG 458


>gi|330824183|ref|YP_004387486.1| NodT family RND efflux system outer membrane lipoprotein
           [Alicycliphilus denitrificans K601]
 gi|329309555|gb|AEB83970.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Alicycliphilus denitrificans K601]
          Length = 505

 Score =  169 bits (429), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 126/470 (26%), Positives = 226/470 (48%), Gaps = 45/470 (9%)

Query: 18  CTVGPEYTKPHMPLLP---TQFSIGNSKNLINIDTLK-----WWESFNDTSLNKLVKIAL 69
           C VGP++ KP  P  P   T +  G++   I  +  +     WW +FND +L+ L + A 
Sbjct: 26  CAVGPDFVKP-TPAAPDDWTSWRSGDASLRIPTEATQALPAQWWLAFNDATLDALQQRAF 84

Query: 70  QQNLTILQATERINAAKENILSVRADLFPSSYASISH------------RFI------PN 111
             +  +  A  R   A+    +V A   P   AS S             R I      P+
Sbjct: 85  DASPDLRTAALRFAQARAQRNTVAAQRGPEINASGSATRQRQSQSGAGTRMIGIMGADPS 144

Query: 112 LK-------TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPS 163
           L        T      D+ W++DL+G+ RR +E++ A++    A +D+A+L + S +  +
Sbjct: 145 LTELLAEPFTLYQAGFDASWELDLWGRVRRSVEAADADVGHQAALLDLARLGLTSDVARN 204

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y + R  + +I +  + +   +    L   +   G      L +  AE+ ++++ +P L 
Sbjct: 205 YFELRTAQRQIRLMREDIAALEDRAALLQARVEGGVLDHTDLQRQRAELAALKAQLPPLL 264

Query: 224 KSFRMNVHNISTLLG-YPATEFLHYMQKQSNNFQPNLYIP-INIGIPADLIRNRPDIRYQ 281
                + + I+ LLG  P         ++++       +P + +G+P+++   RPDIR  
Sbjct: 265 AQEAASANQIALLLGERPGALRAELAPREADA---GTSLPDLALGLPSEVALRRPDIRAA 321

Query: 282 EKKLADSVAKIGIAKSDLYPSLSLNGSIA----LTHDNSFPGYNTHWSFGPKLYLPIFDK 337
           E +L  + A IGIA++DLYPS+ L  +      L+ + S  G  T WS GP L LPIFD 
Sbjct: 322 EARLHSATASIGIARADLYPSIRLGATFGYESYLSGEFSDWGSRT-WSVGPSLGLPIFDH 380

Query: 338 GKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSM 397
           G+ K+ ++  E   QE  I +Q+TVL A +E++++L++ + +++   +LQ   +    + 
Sbjct: 381 GRRKATVQLRELQQQEAAINYQQTVLKAWQEIDDSLSAYSAEQRQARELQTRSDAAGDAY 440

Query: 398 SLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIG 447
            L+   Y  G      +LD +R+  +   DL+ ++ +L+  YV +  AIG
Sbjct: 441 QLAQARYDGGVTDFTAVLDAQRSYLQARRDLAASEGRLSTRYVTVNKAIG 490


>gi|254495971|ref|ZP_05108879.1| putative outer membrane transport protein involved in copper
           (silver) tolerance (cusC) [Legionella drancourtii
           LLAP12]
 gi|254354849|gb|EET13476.1| putative outer membrane transport protein involved in copper
           (silver) tolerance (cusC) [Legionella drancourtii
           LLAP12]
          Length = 479

 Score =  169 bits (429), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 121/466 (25%), Positives = 221/466 (47%), Gaps = 28/466 (6%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
            +F    V+L GC+  P+Y +P +P+          +   NI    W   F D +L +L+
Sbjct: 21  CLFYCLSVILFGCSFAPKYIRPPIPVAEEYPRGTGPQKYTNIRQFGWNVFFTDPALKQLI 80

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSS-------YASISHRFIPNLK----T 114
            ++L  N  +  A ER+  A+      +ADLFPS         A +    +PN+     +
Sbjct: 81  ALSLNNNRDLRTAIERMGEARAMYGLQKADLFPSLNANALGLKAGVPGNLLPNMNPFVFS 140

Query: 115 NSTGQLD-SDWKIDLFGQRRHI-----ESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
              G L  S W+ID +G+ R++     E  LA  D+ +A      +++I ++  +Y+   
Sbjct: 141 AYLGALSVSSWEIDFWGRLRNLKDAALEHYLATEDAEHATF----ISLIEQVANTYLTEH 196

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
              E I I  + +   K +  L   +F +G++SK  +V+ E  ++   S++  LE+   +
Sbjct: 197 ELNELIHITLKTIKSRKHSYHLMKRRFEEGSSSKFEVVQAETLLQQANSELTVLERKREL 256

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
           N + ++ L+G      +   Q +     P+    I+ G+P++L+ NRPD+   E +L  +
Sbjct: 257 NWNAMTLLVGTQ----IPINQSRLARVAPSYIKEISPGLPSELLYNRPDVIAAEHRLKAA 312

Query: 289 VAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
            A IG A++  +P ++L G+   T    +N F      W++ P + LPIFD G+  S++ 
Sbjct: 313 NANIGAARAAFFPRITLTGAYGTTSSELNNLFSPGTKIWTYFPNITLPIFDWGRNMSDLG 372

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
            A++        ++ T+  A +EV +AL +     K +     A+   K+   L+   Y+
Sbjct: 373 LAKARQNLAITEYEHTIQVAFREVADALANRTWLAKQIIVQNKALASQKERTHLAWARYK 432

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            G    L++LD ER     E  L   + +L  S ++LY+A+G G+ 
Sbjct: 433 VGSSPYLEVLDAERDKFVAEQSLVQTRYELLASQINLYVALGGGHG 478


>gi|121635350|ref|YP_975595.1| putative outer membrane lipoprotein [Neisseria meningitidis FAM18]
 gi|120867056|emb|CAM10820.1| putative outer membrane lipoprotein [Neisseria meningitidis FAM18]
 gi|325132797|gb|EGC55477.1| multiple transferable resistance system protein MtrE [Neisseria
           meningitidis M6190]
          Length = 483

 Score =  169 bits (429), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 124/448 (27%), Positives = 220/448 (49%), Gaps = 20/448 (4%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F    + + I    L W + F D  L KL+ IAL++N +
Sbjct: 34  LSACTMIPQYEQPKVEVAET-FKNDTADSGIRAVDLGWHDYFADPRLQKLIDIALERNTS 92

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSDWKI-------- 126
           +  A       ++  +  R +L P+  A+ +     +L   S G + S +K+        
Sbjct: 93  LRTAVLNSEIYRKQYMIERNNLLPTLAANANDSRQGSL---SGGNVSSSYKVGLGAASYE 149

Query: 127 -DLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLY 184
            DLFG+ R   E++L    ++ A  D A L++I+ +  +Y + R+ +E +S+A ++L   
Sbjct: 150 LDLFGRVRSSSEAALQGYFASTANRDAAHLSLIATVAKAYFNERYAEEAMSLAQRVLKTR 209

Query: 185 KKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEF 244
           ++  +LS L++  G  S ++L + EA I+S ++D     +S     + ++TL+  P  E 
Sbjct: 210 EETYKLSELRYKAGVISAVALRQQEALIESAKADYAHAARSREQARNALATLINQPIPED 269

Query: 245 LHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLS 304
           L         F       +  G+ ++++ +RPDIR  E  L  + A IG A++  +PS+ 
Sbjct: 270 LPAGLPLDKQF---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAFFPSIR 326

Query: 305 LNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQET 361
           L G++          F      WSF P + LPIF  G  K+N+  A+   Q Q + ++  
Sbjct: 327 LTGTVGTGSAELGGLFKSGTGVWSFAPSITLPIFTWGTNKANLDVAKLRQQAQIVAYESA 386

Query: 362 VLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERAT 421
           V +A ++V NAL +  +  K    L       K+++ L  + Y+ G    LD+LD ER++
Sbjct: 387 VQSAFQDVANALAAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGALDLLDAERSS 446

Query: 422 AKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
              E     A+   A++  DLY A+G G
Sbjct: 447 YSAEGAALSAQLTRAENLADLYKALGGG 474


>gi|325138700|gb|EGC61252.1| multiple transferable resistance system protein MtrE [Neisseria
           meningitidis ES14902]
          Length = 467

 Score =  169 bits (429), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 124/448 (27%), Positives = 220/448 (49%), Gaps = 20/448 (4%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F    + + I    L W + F D  L KL+ IAL++N +
Sbjct: 18  LSACTMIPQYEQPKVEVAET-FKNDTADSGIRAVDLGWHDYFADPRLQKLIDIALERNTS 76

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSDWKI-------- 126
           +  A       ++  +  R +L P+  A+ +     +L   S G + S +K+        
Sbjct: 77  LRTAVLNSEIYRKQYMIERNNLLPTLAANANGSRQGSL---SGGNVSSSYKVGLGAASYE 133

Query: 127 -DLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLY 184
            DLFG+ R   E++L    ++ A  D A L++I+ +  +Y + R+ +E +S+A ++L   
Sbjct: 134 LDLFGRVRSSSEAALQGYFASTANRDAAHLSLIATVAKAYFNERYAEEAMSLAQRVLKTR 193

Query: 185 KKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEF 244
           ++  +LS L++  G  S ++L + EA I+S ++D     +S     + ++TL+  P  E 
Sbjct: 194 EETYKLSELRYKAGVISAVALRQQEALIESAKADYAHAARSREQARNALATLINQPIPED 253

Query: 245 LHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLS 304
           L         F       +  G+ ++++ +RPDIR  E  L  + A IG A++  +PS+ 
Sbjct: 254 LPAGLPLDKQF---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAFFPSIR 310

Query: 305 LNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQET 361
           L G++          F      WSF P + LPIF  G  K+N+  A+   Q Q + ++  
Sbjct: 311 LTGTVGTGSAELGGLFKSGTGVWSFAPSITLPIFTWGTNKANLDVAKLRQQAQIVAYESA 370

Query: 362 VLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERAT 421
           V +A ++V NAL +  +  K    L       K+++ L  + Y+ G    LD+LD ER++
Sbjct: 371 VQSAFQDVANALAAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGALDLLDAERSS 430

Query: 422 AKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
              E     A+   A++  DLY A+G G
Sbjct: 431 YSAEGAALSAQLTRAENLADLYKALGGG 458


>gi|325198807|gb|ADY94263.1| multiple transferable resistance system protein MtrE [Neisseria
           meningitidis G2136]
          Length = 467

 Score =  169 bits (429), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 124/448 (27%), Positives = 220/448 (49%), Gaps = 20/448 (4%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F    + + I    L W + F D  L KL+ IAL++N +
Sbjct: 18  LSACTMIPQYEQPKVEVAET-FKNDTADSGIRAVDLGWHDYFADPRLQKLIDIALERNTS 76

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSDWKI-------- 126
           +  A       ++  +  R +L P+  A+ +     +L   S G + S +K+        
Sbjct: 77  LRTAVLNSEIYRKQYMIERNNLLPTLAANANDSRQGSL---SGGNVSSSYKVGLGAASYE 133

Query: 127 -DLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLY 184
            DLFG+ R   E++L    ++ A  D A L++I+ +  +Y + R+ +E +S+A ++L   
Sbjct: 134 LDLFGRVRSSSEAALQGYFASTANRDAAHLSLIATVAKAYFNERYAEEAMSLAQRVLKTR 193

Query: 185 KKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEF 244
           ++  +LS L++  G  S ++L + EA I+S ++D     +S     + ++TL+  P  E 
Sbjct: 194 EETYKLSELRYKAGVISAVALRQQEALIESAKADYAHAARSREQARNALATLINQPIPED 253

Query: 245 LHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLS 304
           L         F       +  G+ ++++ +RPDIR  E  L  + A IG A++  +PS+ 
Sbjct: 254 LPAGLPLDKQF---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAFFPSIR 310

Query: 305 LNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQET 361
           L G++          F      WSF P + LPIF  G  K+N+  A+   Q Q + ++  
Sbjct: 311 LTGTVGTGSAELGGLFKSGTGVWSFAPSITLPIFTWGTNKANLDVAKLRQQAQIVAYESA 370

Query: 362 VLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERAT 421
           V +A ++V NAL +  +  K    L       K+++ L  + Y+ G    LD+LD ER++
Sbjct: 371 VQSAFQDVANALAAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGALDLLDAERSS 430

Query: 422 AKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
              E     A+   A++  DLY A+G G
Sbjct: 431 YSAEGAALSAQLTRAENLADLYKALGGG 458


>gi|330875077|gb|EGH09226.1| outer membrane efflux protein [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 490

 Score =  169 bits (429), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 123/472 (26%), Positives = 225/472 (47%), Gaps = 46/472 (9%)

Query: 12  IVLLAGCTVGPEYTKPHMPLLPTQF-SIGNSKNLINIDTLK---WWESFNDTSLNKLVKI 67
           I LL+ C VGP+Y KP     P QF +    +     D +    WWE + D  LN LV+ 
Sbjct: 24  ISLLSACAVGPDYQKPSSAA-PEQFKAAAGWRAATPSDAMAKGAWWEVYGDAQLNTLVER 82

Query: 68  ALQQNLTILQATERINAAKENILSVRADLFPS----------------SYASISHRFIPN 111
               N T+ Q   +   A+  + S R   FP+                S +  S+     
Sbjct: 83  LNTSNQTVAQYDAQYRQAQALVRSSRGAFFPTLDLTTGKTRSGQGAGTSSSGTSNTGASG 142

Query: 112 LKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
           ++ +   QL   W+ D++G+ RR +E+  AN  ++ A +   +L++ S+L+ +Y+  R  
Sbjct: 143 IRNSYNAQLGVSWEADVWGKLRRGLEADTANAQASLADLAAMRLSLQSELVQNYMQLRVI 202

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
            E+  +    +D Y++++ L+  ++  G     ++ + + ++KS ++D+  L        
Sbjct: 203 DEQKRLLESTVDAYQRSLTLTRNQYRAGIAGTDAVAQAQTQLKSTQADLIDLVWQRAQFE 262

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIP----INIGIPADLIRNRPDIRYQEKKLA 286
           + I+ L+G    +F         N      IP    I  G+P+ L+  RPDI   E+ + 
Sbjct: 263 NAIAVLMGVAPADF---------NLPATTSIPQLPQIPPGVPSQLLERRPDIAAAERSVM 313

Query: 287 DSVAKIGIAKSDLYP--SLSLNGSIALTHDNSFPGY----NTHWSFGPKLYLPIFDKGKI 340
            + A IG+AK+  YP  +LS++G     + ++F  +    N  WS GP+L L +FD G+ 
Sbjct: 314 GANANIGVAKAAYYPDFTLSMSGGY---NSSTFANWISLPNRFWSVGPQLALTLFDGGRR 370

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
            + + R E+   +    +++TVLN  +EVEN L  +   ++     Q A+   + S+ L+
Sbjct: 371 SAEVDRTEALYDQTVAQYRQTVLNGFQEVENYLIQLKVYEEEAAVRQEALVAARDSLRLT 430

Query: 401 MINYRQGRYSLLDILDIE-RATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
              Y+ G    LD+++++  A +     L++ + +L  S V L  A+G G+N
Sbjct: 431 NNQYKAGLIGYLDVVNVQATALSNERTVLNVLQSRLIAS-VQLIAALGGGWN 481


>gi|307293684|ref|ZP_07573528.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Sphingobium chlorophenolicum L-1]
 gi|306879835|gb|EFN11052.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Sphingobium chlorophenolicum L-1]
          Length = 493

 Score =  169 bits (428), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 126/456 (27%), Positives = 212/456 (46%), Gaps = 48/456 (10%)

Query: 1   MNILRAIFSLFIVL--LAGCTVGPEYTKPHMPLLPTQFSI----GNSKNLINIDTLKWWE 54
           M IL +I ++      L GC VGP Y  P +   P         G +     +D + WW 
Sbjct: 11  MRILSSILTVVATAGWLGGCAVGPSYVAPEVAASPAFMGSLAVEGATGQAAKVDLVNWWR 70

Query: 55  SFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKT 114
           SF+D  L  LV+ AL QNL + QA+ R+  A+  +   +ADL PS    +S +   N ++
Sbjct: 71  SFDDPLLASLVESALAQNLDLQQASARVVQARAALRHAKADLLPSG--QVSGQASENYQS 128

Query: 115 NSTGQ--------------------LDSDWKIDLFGQRRHIESSLANL-DSAYAQVDIAK 153
             T Q                    L + W++DLFG +     +      ++ A    A+
Sbjct: 129 LETPQGRIASALPGFDREAQSYDLNLGASWEVDLFGGKDAARDAARADWQASAAGAAAAR 188

Query: 154 LNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIK 213
           L V ++   +Y+  R  + R+ +A   L + ++ ++L  L++ +G  ++L L + E  + 
Sbjct: 189 LAVAAQTADTYVAIRSLQARLDVARDQLRVQQQLVDLVALQYRKGVAAELQLRQAEGALA 248

Query: 214 SIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPI-------NIG 266
            +++ +P LE++    ++ +  LLG         +Q  S   +    +PI       + G
Sbjct: 249 QVKASVPELEQNLDTAMNALDVLLG---------LQPGSTRSELAAVVPIPNVPAVSDAG 299

Query: 267 IPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTH 323
            PA L+R RPDI   E+ LA S A+IG+A S+ YP  SL+   G+  +     F G  T 
Sbjct: 300 GPAALLRRRPDIIAAERTLAASNARIGVAISEYYPKFSLSGLLGTATMGVGGLFSGNATQ 359

Query: 324 WSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIV 383
            S    L   +FD G+I + I  A     E    ++  VL A ++VENA +++ + +   
Sbjct: 360 ASGVLGLRWRLFDFGRIDAEIAAARGRNAEALAGYRLAVLRASEDVENAFSALVKQQARA 419

Query: 384 TKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIER 419
             L   V    K+ + S+  Y+ G  SLLD+LD ++
Sbjct: 420 RILDQGVSSLTKARASSLAAYKGGVSSLLDVLDADQ 455


>gi|161870560|ref|YP_001599732.1| outer membrane lipoprotein [Neisseria meningitidis 053442]
 gi|161596113|gb|ABX73773.1| outer membrane lipoprotein [Neisseria meningitidis 053442]
          Length = 467

 Score =  169 bits (428), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 124/448 (27%), Positives = 220/448 (49%), Gaps = 20/448 (4%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F    + + I    L W + F D  L KL+ IAL++N +
Sbjct: 18  LSACTMIPQYEQPKVEVAET-FKNDTADSGIRAVDLGWHDYFADPRLQKLIDIALERNTS 76

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSDWKI-------- 126
           +  A       ++  +  R +L P+  A+ +     +L   S G + S +K+        
Sbjct: 77  LRTAVLNSEIYRKQYMIERNNLLPTLAANANDSRQGSL---SGGNVSSSYKVGLGAASYE 133

Query: 127 -DLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLY 184
            DLFG+ R   E++L    ++ A  D A L++I+ +  +Y + R+ +E +S+A ++L   
Sbjct: 134 LDLFGRVRSSSEAALQGYFASTANRDAAHLSLIATVAKAYFNERYAEEAMSLAQRVLKTR 193

Query: 185 KKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEF 244
           ++  +LS L++  G  S ++L + EA I+S ++D     +S     + ++TL+  P  E 
Sbjct: 194 EETYKLSELRYKAGVISAVALRQQEALIESAKADYAHAARSREQARNALATLINQPIPED 253

Query: 245 LHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLS 304
           L         F       +  G+ ++++ +RPDIR  E  L  + A IG A++  +PS+ 
Sbjct: 254 LPAGLPLDKQF---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAFFPSIR 310

Query: 305 LNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQET 361
           L G++          F      WSF P + LPIF  G  K+N+  A+   Q Q + ++  
Sbjct: 311 LTGTVGTGSAELGGLFKSGTGVWSFAPSITLPIFTWGTNKANLDVAKLRQQAQIVAYESA 370

Query: 362 VLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERAT 421
           V +A ++V NAL +  +  K    L       K+++ L  + Y+ G    LD+LD ER++
Sbjct: 371 VQSAFQDVANALAAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGALDLLDAERSS 430

Query: 422 AKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
              E     A+   A++  DLY A+G G
Sbjct: 431 YAAEGAALSAQLTRAENLADLYKALGGG 458


>gi|240014611|ref|ZP_04721524.1| MtrE [Neisseria gonorrhoeae DGI18]
 gi|240017056|ref|ZP_04723596.1| MtrE [Neisseria gonorrhoeae FA6140]
 gi|240113515|ref|ZP_04728005.1| MtrE [Neisseria gonorrhoeae MS11]
 gi|240116132|ref|ZP_04730194.1| MtrE [Neisseria gonorrhoeae PID18]
 gi|240121133|ref|ZP_04734095.1| MtrE [Neisseria gonorrhoeae PID24-1]
 gi|240126161|ref|ZP_04739047.1| MtrE [Neisseria gonorrhoeae SK-92-679]
 gi|240128638|ref|ZP_04741299.1| MtrE [Neisseria gonorrhoeae SK-93-1035]
 gi|254494152|ref|ZP_05107323.1| outer membrane lipoprotein [Neisseria gonorrhoeae 1291]
 gi|260440056|ref|ZP_05793872.1| MtrE [Neisseria gonorrhoeae DGI2]
 gi|268599582|ref|ZP_06133749.1| outer membrane lipoprotein [Neisseria gonorrhoeae MS11]
 gi|268601800|ref|ZP_06135967.1| outer membrane lipoprotein [Neisseria gonorrhoeae PID18]
 gi|268684750|ref|ZP_06151612.1| outer membrane lipoprotein [Neisseria gonorrhoeae SK-92-679]
 gi|268687029|ref|ZP_06153891.1| outer membrane lipoprotein [Neisseria gonorrhoeae SK-93-1035]
 gi|291043344|ref|ZP_06569067.1| tetrahydromethanopterin S-methyltransferase subunit E [Neisseria
           gonorrhoeae DGI2]
 gi|226513192|gb|EEH62537.1| outer membrane lipoprotein [Neisseria gonorrhoeae 1291]
 gi|268583713|gb|EEZ48389.1| outer membrane lipoprotein [Neisseria gonorrhoeae MS11]
 gi|268585931|gb|EEZ50607.1| outer membrane lipoprotein [Neisseria gonorrhoeae PID18]
 gi|268625034|gb|EEZ57434.1| outer membrane lipoprotein [Neisseria gonorrhoeae SK-92-679]
 gi|268627313|gb|EEZ59713.1| outer membrane lipoprotein [Neisseria gonorrhoeae SK-93-1035]
 gi|291012950|gb|EFE04933.1| tetrahydromethanopterin S-methyltransferase subunit E [Neisseria
           gonorrhoeae DGI2]
          Length = 467

 Score =  169 bits (428), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 122/445 (27%), Positives = 219/445 (49%), Gaps = 14/445 (3%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F    S + I    L W + F D  L KL+ IAL++N +
Sbjct: 18  LSACTMIPQYEQPKVEVAET-FQNDTSVSSIRAVDLGWHDYFADPRLQKLIDIALERNTS 76

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST------GQLDSDWKIDL 128
           +  A       ++  +  R +L P+  A+ +     +L   +       G   + +++DL
Sbjct: 77  LRTAVLNSEIYRKQYMIERNNLLPTLAANANGSRQGSLSGGNVSSSYNVGLGAASYELDL 136

Query: 129 FGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKN 187
           FG+ R   E++L    ++ A  D A L++I+ +  +Y + R+ +E +S+A ++L   ++ 
Sbjct: 137 FGRVRSSSEAALQGYFASVANRDAAHLSLIATVAKAYFNERYAEEAMSLAQRVLKTREET 196

Query: 188 IELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHY 247
            +LS L++  G  S ++L + EA I+S ++D     +S     + ++TL+  P  E L  
Sbjct: 197 YKLSELRYKAGVISAVALRQQEALIESAKADYAHAARSREQARNALATLINRPIPEDLPA 256

Query: 248 MQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNG 307
                  F       +  G+ ++++ +RPDIR  E  L  + A IG A++  +PS+ L G
Sbjct: 257 GLPLDKQF---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAFFPSIRLTG 313

Query: 308 SIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLN 364
           S+          F      W+F P + LPIF  G  K+N+  A+   Q Q + ++  V +
Sbjct: 314 SVGTGSVELGGLFKSGTGVWAFAPSITLPIFTWGTNKANLDVAKLRQQAQIVAYESAVQS 373

Query: 365 AIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKV 424
           A ++V NAL +  +  K    L       K+++ L  + Y+ G    LD+LD ER++   
Sbjct: 374 AFQDVANALAAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGALDLLDAERSSYSA 433

Query: 425 EVDLSIAKRQLAKSYVDLYIAIGSG 449
           E     A+   A++  DLY A+G G
Sbjct: 434 EGAALSAQLTRAENLADLYKALGGG 458


>gi|316985725|gb|EFV64670.1| outer membrane protein oprM [Neisseria meningitidis H44/76]
 gi|325140825|gb|EGC63335.1| multiple transferable resistance system protein MtrE [Neisseria
           meningitidis CU385]
          Length = 483

 Score =  169 bits (428), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 124/448 (27%), Positives = 220/448 (49%), Gaps = 20/448 (4%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F    + + I    L W + F D  L KL+ IAL++N +
Sbjct: 34  LSACTMIPQYEQPKVEVAET-FKNDTADSGIRAVDLGWHDYFADPRLQKLIDIALERNTS 92

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSDWKI-------- 126
           +  A       ++  +  R +L P+  A+ +     +L   S G + S +K+        
Sbjct: 93  LRTAVLNSEIYRKQYMIERNNLLPTLAANANDSRQGSL---SGGNVSSSYKVGLGAASYE 149

Query: 127 -DLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLY 184
            DLFG+ R   E++L    ++ A  D A L++I+ +  +Y + R+ +E +S+A ++L   
Sbjct: 150 LDLFGRVRSSSEAALQGYFASTANRDAAHLSLIATVAKAYFNERYAEEAMSLAQRVLKTR 209

Query: 185 KKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEF 244
           ++  +LS L++  G  S ++L + EA I+S ++D     +S     + ++TL+  P  E 
Sbjct: 210 EETYKLSELRYKAGVISAVALRQQEALIESAKADYAHAARSREQARNALATLINQPIPED 269

Query: 245 LHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLS 304
           L         F       +  G+ ++++ +RPDIR  E  L  + A IG A++  +PS+ 
Sbjct: 270 LPAGLPLDKQF---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAFFPSIR 326

Query: 305 LNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQET 361
           L G++          F      WSF P + LPIF  G  K+N+  A+   Q Q + ++  
Sbjct: 327 LTGTVGTGSAELGGLFKSGTGVWSFAPSITLPIFTWGTNKANLDVAKLRQQVQIVAYESA 386

Query: 362 VLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERAT 421
           V +A ++V NAL +  +  K    L       K+++ L  + Y+ G    LD+LD ER++
Sbjct: 387 VQSAFQDVANALAAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGALDLLDAERSS 446

Query: 422 AKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
              E     A+   A++  DLY A+G G
Sbjct: 447 YAAEGAALSAQLTRAENLADLYKALGGG 474


>gi|254670148|emb|CBA05174.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Neisseria meningitidis alpha153]
          Length = 467

 Score =  169 bits (428), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 122/445 (27%), Positives = 219/445 (49%), Gaps = 14/445 (3%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F    + + I    L W + F D  L KL+ IAL++N +
Sbjct: 18  LSACTMIPQYEQPKVEVAET-FKNDTADSGIRAVDLGWHDYFADPRLQKLIDIALERNTS 76

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST------GQLDSDWKIDL 128
           +  A       ++  +  R +L P+  A+ +     +L   +       G   + +++DL
Sbjct: 77  LRTAVLNSEIYRKQYMIERNNLLPTLAANANGSRQGSLSGGNVSSSYNVGLGAASYELDL 136

Query: 129 FGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKN 187
           FG+ R   E++L    ++ A  D A L++I+ +  +Y + R+ +E +S+A ++L   ++ 
Sbjct: 137 FGRVRSSSEAALQGYFASTANRDAAHLSLIATVAKAYFNERYAEEAMSLAQRVLKTREET 196

Query: 188 IELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHY 247
            +LS L++  G  S ++L + EA I+S ++D     +S     + ++TL+  P  E L  
Sbjct: 197 YKLSELRYKAGVISAVALRQQEALIESAKADYAHAARSREQARNALATLINQPIPEDLPA 256

Query: 248 MQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNG 307
                  F       +  G+ ++++ +RPDIR  E  L  + A IG A++  +PS+ L G
Sbjct: 257 GLPLDKQF---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAFFPSIRLTG 313

Query: 308 SIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLN 364
           S+          F      WSF P + LPIF  G  K+N+  A+   Q Q + ++  V +
Sbjct: 314 SVGTRSAELGGLFKSGTGVWSFAPSITLPIFTWGTNKANLDVAKLRQQAQIVAYESAVQS 373

Query: 365 AIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKV 424
           A ++V NAL +  +  K    L       K+++ L  + Y+ G    LD+LD ER++   
Sbjct: 374 AFQDVANALAAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGALDLLDAERSSYAA 433

Query: 425 EVDLSIAKRQLAKSYVDLYIAIGSG 449
           E     A+   A++  DLY A+G G
Sbjct: 434 EGAALSAQLTRAENLADLYKALGGG 458


>gi|330991755|ref|ZP_08315705.1| Outer membrane protein oprM [Gluconacetobacter sp. SXCC-1]
 gi|329761223|gb|EGG77717.1| Outer membrane protein oprM [Gluconacetobacter sp. SXCC-1]
          Length = 538

 Score =  169 bits (428), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 126/500 (25%), Positives = 239/500 (47%), Gaps = 72/500 (14%)

Query: 13  VLLAGCTVGPEYTKPHMPLLPTQFS---------------IGNSKNLINIDTLKWWESFN 57
           V+ AGC VGP + KP  P  P Q+                + +     + DT  WW  F+
Sbjct: 6   VMTAGCAVGPNFHKP-TPWAPKQYGGPARIAPDGTNSPAQVASQTTQDDPDT-AWWTLFH 63

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH----------- 106
           D  L +L +     NL +     R+  ++  +    A+ +P   AS S+           
Sbjct: 64  DAELTRLEQRVATDNLDVRAYAYRMAQSRAELRIAGAERYPGLSASGSYARQQYSTKMLQ 123

Query: 107 RFIPNLKT-----NSTG---------------------QLDSDWKIDLFGQ-RRHIESSL 139
           R + ++++     N+ G                      +D+ W++DL+G+ RR  E++ 
Sbjct: 124 RIVTDVESDPQLANTPGFSQFAPTPGEAKIPLFNQWRDSVDATWELDLWGRVRREYEAAA 183

Query: 140 ANLDSAYAQVDIAKLNVI----SKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKF 195
           AN  +    V+ A+  ++    S++   Y+D R+ +E++ I  +  D+ K  ++L+  ++
Sbjct: 184 ANTQA----VNEARRGMLISRQSEVARDYMDLRNTQEQLRIVMENRDVAKSMLDLNQQRY 239

Query: 196 TQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNF 255
           T+G  S L + +  A+ +S  + IP LE+   + V+ +S L+G P       +   +   
Sbjct: 240 TKGLASNLEVEQARAQYESTLAQIPQLEQQLVLQVNALSLLMGEPPRALSDELLTAAAIP 299

Query: 256 QPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALT--- 312
              +   + +G+P++L R RPDIR  E  L  ++A++G A ++ YP +++N         
Sbjct: 300 --PVPPRVPVGVPSELARRRPDIRRAEASLHAAIAQVGEAVAEFYPRVTINAGFGFESLS 357

Query: 313 -HDNSFPGYNTH-WSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVE 370
             D  F  +N   W+ GP + LP+F  G+++  +   +++ +E  I +Q+TVL A  +V+
Sbjct: 358 FRDLGF--WNAKAWNVGPSITLPLFQGGRLRGQLELRKAAQKEAAINYQKTVLGAWHDVD 415

Query: 371 NALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSI 430
           NALT+  ++++   +L   VE    ++ L+   YR G  + L +LD +R     E DL+ 
Sbjct: 416 NALTAYTDEQRRHDELARRVEASHHALQLAQDQYRNGMVTYLTVLDTQRQYLGAESDLTT 475

Query: 431 AKRQLAKSYVDLYIAIGSGY 450
           +   ++ + V LY A+G G+
Sbjct: 476 STATISGNLVRLYNALGGGW 495


>gi|325142863|gb|EGC65230.1| multiple transferable resistance system protein MtrE [Neisseria
           meningitidis 961-5945]
          Length = 467

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 124/448 (27%), Positives = 220/448 (49%), Gaps = 20/448 (4%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F    + + I    L W + F D  L KL+ IAL++N +
Sbjct: 18  LSACTMIPQYEQPKVEVAET-FKNDTADSGIRAVDLGWHDYFADPRLQKLIDIALERNTS 76

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSDWKI-------- 126
           +  A       ++  +  R +L P+  A+ +     +L   S G + S +K+        
Sbjct: 77  LRTAVLNSEIYRKQYMIERNNLLPTLAANANDSRQGSL---SGGNVSSSYKVGLGAASYE 133

Query: 127 -DLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLY 184
            DLFG+ R   E++L    ++ A  D A L++I+ +  +Y + R+ +E +S+A ++L   
Sbjct: 134 LDLFGRVRSSSEAALQGYFASTANRDAAHLSLIATVAKAYFNERYAEEAMSLAQRVLKTR 193

Query: 185 KKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEF 244
           ++  +LS L++  G  S ++L + EA I+S ++D     +S     + ++TL+  P  + 
Sbjct: 194 EETYKLSELRYKAGVISAVALRQQEALIESAKADYAHAARSREQARNALATLINQPIPDD 253

Query: 245 LHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLS 304
           L         F       +  G+ ++++ +RPDIR  E  L  + A IG A++  +PS+ 
Sbjct: 254 LPAGLPLDKQF---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAFFPSIR 310

Query: 305 LNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQET 361
           L GS+          F      WSF P + LPIF  G  K+N+  A+   Q Q + ++  
Sbjct: 311 LTGSVGTRSAELGGLFKSGTGVWSFAPSITLPIFTWGTNKANLDVAKLRQQAQIVAYESA 370

Query: 362 VLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERAT 421
           V +A ++V NAL +  +  K    L       K+++ L  + Y+ G    LD+LD ER++
Sbjct: 371 VQSAFQDVANALAAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGALDLLDAERSS 430

Query: 422 AKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
              E     A+   A++  DLY A+G G
Sbjct: 431 YAAEGAALSAQLTRAENLADLYKALGGG 458


>gi|229590215|ref|YP_002872334.1| putative outer membrane efflux protein [Pseudomonas fluorescens
           SBW25]
 gi|229362081|emb|CAY48983.1| putative outer membrane efflux protein [Pseudomonas fluorescens
           SBW25]
          Length = 494

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 123/475 (25%), Positives = 231/475 (48%), Gaps = 43/475 (9%)

Query: 7   IFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNS-KNLINIDTLK---WWESFNDTSLN 62
           +  L  VLL+ C +GP+Y +P + + P QF      +     D+L    WWE + D  LN
Sbjct: 24  VMVLCGVLLSACAIGPDYKRPDV-IEPAQFKEAQGWRQATPSDSLARGAWWELYGDRQLN 82

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH---------------R 107
            LV      N T+ QA  R   A+  + S R   +PS   S+                  
Sbjct: 83  DLVLRLNTSNQTVAQAEARFRQAQALVRSSRGAFYPSVDLSVGKTRASQGTGSSSASLSS 142

Query: 108 FIPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYID 166
               ++     QL   W+ D++G+ RR +E++ A+ +++ A +   +L+  S+L+ SY+ 
Sbjct: 143 SSSGIRDTLNAQLGVSWEADIWGKLRRGLEANEASAEASSADLAAMRLSQQSELVQSYLQ 202

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
            R   E+  +    L+ Y+++++++  ++  G + K ++ + + ++K+ ++ +  L    
Sbjct: 203 LRVMDEQTRLLQATLETYQRSLQMTENQYRAGVSGKDAVAQAQTQLKTTQASLIDLIWQR 262

Query: 227 RMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP----INIGIPADLIRNRPDIRYQE 282
               + I+ L+G     F         N   +  IP    I + +P+ L+  RPDI   E
Sbjct: 263 AQLENAIAVLIGEAPANF---------NLAVSKDIPALPQIPVSLPSQLLERRPDIASAE 313

Query: 283 KKLADSVAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGK 339
           + +  + A IG+AK+  YP LSL+   G  + T+ +     N  WS GPKL + +FD G+
Sbjct: 314 RSVIAANANIGVAKAAYYPDLSLSLAGGYSSSTYADWISLPNRFWSVGPKLAMTLFDGGQ 373

Query: 340 IKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSIN--EDKKIVTKLQHAVELHKKSM 397
             + + R  +S  E    +++TVL+  +EVEN +  +   ED+ +V+    A+E  ++S+
Sbjct: 374 RSAEVDRTVASYDETVAKYRQTVLDGFREVENYMVQLKVLEDEAVVSN--EALEAARESL 431

Query: 398 SLSMINYRQGRYSLLDILDIE-RATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            L+   Y  G  + LD++ ++  A +     L++ + +L  S V L  A+G G++
Sbjct: 432 RLTQNQYEAGLIAYLDVVTVQATALSNERTVLTLLQTRLVAS-VQLIAALGGGWD 485


>gi|261364144|ref|ZP_05977027.1| multiple transferable resistance system protein MtrE [Neisseria
           mucosa ATCC 25996]
 gi|288567731|gb|EFC89291.1| multiple transferable resistance system protein MtrE [Neisseria
           mucosa ATCC 25996]
          Length = 472

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 122/447 (27%), Positives = 217/447 (48%), Gaps = 14/447 (3%)

Query: 13  VLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQN 72
           V L+ CT+ P+Y +P + +  T F      + I    L W + F D  L++L+ IAL++N
Sbjct: 17  VALSACTMIPKYEQPQVEVAET-FKYDTFDDGIRAADLGWQDFFADLRLHRLIDIALERN 75

Query: 73  LTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTN------STGQLDSDWKI 126
             +  A       ++  +  R DL PS  AS +   + +L         S G   + +++
Sbjct: 76  TDLRTAALNAEIYRKQYMIARNDLLPSINASGTGTRVGSLSGGVTRSEYSVGLGAAAYEL 135

Query: 127 DLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYK 185
           DLFG+ R + +++L    S  A  D A L +I+ +  ++ +  + +E +++A ++L   +
Sbjct: 136 DLFGRVRSNSQAALQGYFSVAANRDAAHLALIAAVAKAHFNELYAQESMALAQRVLKTRE 195

Query: 186 KNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFL 245
              +LS ++   G  S + L + EA I+S ++D     K+     + ++TL+  P  E L
Sbjct: 196 TTYKLSQMRHKAGVISAVDLRQQEALIESAKADYANAVKNREQARNALATLINQPLPEDL 255

Query: 246 HYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSL 305
                 S  F+      +  G+ ++++ NRPDIR  E  L  + A IG A++  +P++SL
Sbjct: 256 PAALPLSKQFK---ITRLPAGLSSEVLLNRPDIRAAEHSLKQANANIGAARAAFFPTISL 312

Query: 306 NGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETV 362
            GS+          F      WSF P + LPIF+ G  K+N+  A    + Q +T++  V
Sbjct: 313 TGSVGTASGELSGLFKSGTGIWSFAPSITLPIFNWGTNKANLDVATLRKEAQIVTYEAAV 372

Query: 363 LNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATA 422
            +A ++V NA  +  +  K    L      +  S+ L  + Y+ G  + LD+LD ER++ 
Sbjct: 373 QSAFQDVSNAFVAREQLDKSYAALSKQSRAYNDSLRLISLRYKHGVSNALDLLDAERSSY 432

Query: 423 KVEVDLSIAKRQLAKSYVDLYIAIGSG 449
             E  L   +    ++  DLY A+G G
Sbjct: 433 GAETALLANQLTRLENLADLYKALGGG 459


>gi|197294866|ref|YP_002153407.1| outer membrane efflux protein [Burkholderia cenocepacia J2315]
 gi|195944345|emb|CAR56946.1| outer membrane efflux protein [Burkholderia cenocepacia J2315]
          Length = 495

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 125/465 (26%), Positives = 223/465 (47%), Gaps = 45/465 (9%)

Query: 18  C-TVGPEYTKPH-----MPLLPTQFSIGNSKNLINIDTL--KWWESFNDTSLNKLVKIAL 69
           C +VGP+YT P       PL        N   L++ D +   WW+ ++D  L+ LV+ AL
Sbjct: 22  CKSVGPDYTLPQHAYVNAPLANHALDDANGA-LVSRDAVPGNWWQLYDDPVLDGLVRDAL 80

Query: 70  QQNLTILQATERINAAKENILSVRADL--------FPSSYASISHRF------------I 109
           + N  +     R+ AA  N+   RA L        F     +   R             +
Sbjct: 81  KSNTDL-----RVAAA--NLARSRAALVVANEQGGFSGGAEAAVQRAQESAEQYLLENKL 133

Query: 110 PNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
           P +   + G ++  +++DLFG+ RR +E++ A+ ++  A  D+A++ V++ ++ +Y++A 
Sbjct: 134 PVVNEGTVG-INVSYELDLFGKLRRGVEAARADSEAVKAAGDLARITVVADVVRAYVEAC 192

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
              + ++IA Q L L ++ ++LS      G  ++  + +   +++++ +DIP  E   R 
Sbjct: 193 SAGDELAIAKQSLALQQQRVKLSQRLRDAGRGNQTDVTRGVTQVRTLSADIPRFEG--RR 250

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
            V                          P L  PI IG  A L+R RPD+R  E++LA +
Sbjct: 251 KVAQYQLAALLARAPADLPKAAAECERLPKLRQPIPIGDGAALLRRRPDVREAERQLAAA 310

Query: 289 VAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
            A+IG+A + LYPS+S+    GS+ +  D  F      WSFGP +       G+ ++ +R
Sbjct: 311 TARIGVATAALYPSVSIGASAGSVGVAAD-LFSSTTNRWSFGPLISWSFPVNGQ-RARVR 368

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
            AE++       +   VLNA++E +++L +   D +    L+ A E  + S + +   Y 
Sbjct: 369 EAEAATGGALAHFDGVVLNALRETQSSLATYAADVQRTDALRTAYESARNSAAETHRLYA 428

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            GR S +  LD  R    V+  ++ A+ Q+A   V L++A+G G+
Sbjct: 429 AGRESFIADLDATRTLTSVQAQVAAAEGQVAADQVRLFLALGGGW 473


>gi|325134753|gb|EGC57390.1| multiple transferable resistance system protein MtrE [Neisseria
           meningitidis M13399]
          Length = 467

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 123/448 (27%), Positives = 220/448 (49%), Gaps = 20/448 (4%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F    + + I    L W + F D  L KL+ IAL++N +
Sbjct: 18  LSACTMIPQYEQPKVEVAET-FKNDTADSGIRAVDLGWHDYFADPRLQKLIDIALERNTS 76

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSDWKI-------- 126
           +  A       ++  +  R +L P+  A+ +     +L   S G + S +K+        
Sbjct: 77  LRTAALNSEIYRKQYMIERNNLLPTLAANANDSRQGSL---SGGNVSSSYKVGLGAASYE 133

Query: 127 -DLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLY 184
            DLFG+ R   E++L    ++ A  D A L++I+ +  +Y + R+ +E +S+A ++L   
Sbjct: 134 LDLFGRVRSSSEAALQGYFASTANRDAAHLSLIATVAKAYFNERYAEEAMSLAQRVLKTR 193

Query: 185 KKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEF 244
           ++  +LS L++  G  S ++L + EA I+S ++D     +S     + ++TL+  P  + 
Sbjct: 194 EETYKLSELRYKAGVISAVALRQQEALIESAKADYAHAARSREQARNALATLINQPIPDD 253

Query: 245 LHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLS 304
           L         F       +  G+ ++++ +RPDIR  E  L  + A IG A++  +PS+ 
Sbjct: 254 LPAGLPLDKQF---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAFFPSIR 310

Query: 305 LNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQET 361
           L G++          F      WSF P + LPIF  G  K+N+  A+   Q Q + ++  
Sbjct: 311 LTGTVGTGSAELGGLFKSGTGVWSFAPSITLPIFTWGTNKANLDVAKLRQQAQIVAYESA 370

Query: 362 VLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERAT 421
           V +A ++V NAL +  +  K    L       K+++ L  + Y+ G    LD+LD ER++
Sbjct: 371 VQSAFQDVANALAAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGALDLLDAERSS 430

Query: 422 AKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
              E     A+   A++  DLY A+G G
Sbjct: 431 YAAEGAALSAQLTRAENLADLYKALGGG 458


>gi|71734548|ref|YP_275460.1| NodT family outer membrane efflux lipoprotein [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|71555101|gb|AAZ34312.1| outer membrane efflux lipoprotein, NodT family [Pseudomonas
           syringae pv. phaseolicola 1448A]
          Length = 477

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 127/471 (26%), Positives = 219/471 (46%), Gaps = 30/471 (6%)

Query: 4   LRAIFSLFIVLLAGC-TVGPEYTKP-----HMPLLPTQFSIGNSKNLINIDT-LKWWESF 56
           LR     F  +L+ C  VGP+Y  P     + P L  + + G S N ++      WW  +
Sbjct: 5   LRVAALGFTAVLSACQVVGPDYQPPKDGAINRPDLQGELA-GRSVNTVSAPVPAHWWRLY 63

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI------- 109
            D  L++LV+ A+  N  +  A   +  A+       A    ++ A I  + +       
Sbjct: 64  QDARLDELVRQAIASNTDLRIAAANLQRARYQTSEAEAAGGFTNGAKIGAQRVQESGEAF 123

Query: 110 ------PNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIP 162
                 P       G L + ++ DLFG  +R IE++ AN+D+  A VD A++ V++ ++ 
Sbjct: 124 LLTDKVPVANVGDVG-LTTSYQFDLFGTLQRGIEAAQANVDANQAAVDTARITVVADVVR 182

Query: 163 SYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTL 222
           +Y       E + IA + LDL ++++ L+      G   +  + + + + KS+ +++P  
Sbjct: 183 AYTQICAANEELDIARESLDLQQQSVTLNQRLRDAGRGDETQVTRSQTQFKSLRAEMPRY 242

Query: 223 EKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQE 282
           E   +  +  +S LL  P  +    +   S N  P++   + +G  A L++ RPD+R  E
Sbjct: 243 EARRQAAMFRLSMLLAKPVEQLPAGV--SSCNALPHIAQVMPVGDGATLLKRRPDVRQAE 300

Query: 283 KKLADSVAKIGIAKSDLYPSLSLNGSIALT---HDNSFPGYNTHWSFGPKLYLPIFDKGK 339
           + LA S A+IG+A  +LYP +S+  SI  T    +   P  N  W FGP L   I   G 
Sbjct: 301 RHLAMSTAQIGVATGELYPDISIGASIGTTGLIENLGKPAAN-RWGFGPLLNWTIPSNGS 359

Query: 340 IKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSL 399
            ++ I +AE+S Q     +   VLNAI+E +  L            L+ A +  K++   
Sbjct: 360 -RARIHQAEASVQAALARFDGVVLNAIRETQTGLAQYTALLDRRDALKEAEQSAKEAADQ 418

Query: 400 SMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +   Y+ GR S L  L   R    V   ++ A  Q+A   ++L++A+G G+
Sbjct: 419 THRFYQAGRASFLADLQATRTYTDVRAQMAEANTQVAMGQINLFLALGGGW 469


>gi|46446186|ref|YP_007551.1| putative outer membrane protein, componenet of multidrug efflux
           systems [Candidatus Protochlamydia amoebophila UWE25]
 gi|46399827|emb|CAF23276.1| putative outer membrane protein, componenet of multidrug efflux
           systems [Candidatus Protochlamydia amoebophila UWE25]
          Length = 489

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 128/480 (26%), Positives = 234/480 (48%), Gaps = 46/480 (9%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIA 68
           S  ++ L+ C + P Y +P + + P ++     +     +  +WWE+F+D  L KL+  +
Sbjct: 3   SCLLLALSSCVLHPPYQQPCLEI-PKKWRTPFEETSTAAN-FRWWEAFDDPILKKLIFES 60

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPS--------------------SYASISHRF 108
           L+ N  +  A  R    K  +  VR+  FP                     + + +S + 
Sbjct: 61  LENNKDLKLALARTAEFKARLGIVRSQFFPQISGVGLASRQRTPTELSGGKTSSGVSSQG 120

Query: 109 IPNLKTNSTGQL------------DSDWKIDLFGQRRHIESSLANLDSAYAQVDIAK--- 153
            P L    T  +            ++ +++DL+G  R   SS A L     QV   +   
Sbjct: 121 QPGLTPVGTNLIPSPYTNNYRVVAEAAYELDLWG--RVYSSSEAALADLLGQVQARRALV 178

Query: 154 LNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIK 213
           L+++S +  SYI  R F +++ ++ Q +   K++ EL+ L+F  G TS+L + +  AE+ 
Sbjct: 179 LSIVSSVATSYIQMRQFDQQLIVSKQTVTSRKESYELAKLRFEGGLTSELEVKQAAAEVD 238

Query: 214 SIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIR 273
              +++  LE       + IS L+G+   E    +    N +   L +P   G+P++L+ 
Sbjct: 239 EAIAEVFRLEVLIPQQENLISILIGHSPREIERGL--NINEWPTPLAVP--AGLPSELLE 294

Query: 274 NRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKL 330
            RPDI   E+ L  + A+IG A++  +PS+SL    GS +L   + F      W +   L
Sbjct: 295 QRPDIIQAEQGLIAANARIGEARAQYFPSISLTGYFGSESLQLHHLFTSPTRAWQYAANL 354

Query: 331 YLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAV 390
             PIF  GKI S I  A++  +  Y  +Q+TVLNA KEV+NAL +  + ++++   +++V
Sbjct: 355 LQPIFTGGKISSGIDVAKAQKRIAYYNYQQTVLNAFKEVDNALIAHQKSRELLEVQKNSV 414

Query: 391 ELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            + K  + L+ + Y  G+   L++LD ER     +++L+ A+  +  + V++Y  +G G+
Sbjct: 415 VVLKDYLHLAKLQYDNGQTDYLNVLDAERKLFTAQLNLAQAEADVFLTLVNVYKVLGGGW 474


>gi|15677561|ref|NP_274717.1| multidrug efflux pump channel protein [Neisseria meningitidis MC58]
 gi|7226969|gb|AAF42061.1| multidrug efflux pump channel protein [Neisseria meningitidis MC58]
 gi|325199694|gb|ADY95149.1| multiple transferable resistance system protein MtrE [Neisseria
           meningitidis H44/76]
          Length = 467

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 124/448 (27%), Positives = 220/448 (49%), Gaps = 20/448 (4%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F    + + I    L W + F D  L KL+ IAL++N +
Sbjct: 18  LSACTMIPQYEQPKVEVAET-FKNDTADSGIRAVDLGWHDYFADPRLQKLIDIALERNTS 76

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSDWKI-------- 126
           +  A       ++  +  R +L P+  A+ +     +L   S G + S +K+        
Sbjct: 77  LRTAVLNSEIYRKQYMIERNNLLPTLAANANDSRQGSL---SGGNVSSSYKVGLGAASYE 133

Query: 127 -DLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLY 184
            DLFG+ R   E++L    ++ A  D A L++I+ +  +Y + R+ +E +S+A ++L   
Sbjct: 134 LDLFGRVRSSSEAALQGYFASTANRDAAHLSLIATVAKAYFNERYAEEAMSLAQRVLKTR 193

Query: 185 KKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEF 244
           ++  +LS L++  G  S ++L + EA I+S ++D     +S     + ++TL+  P  E 
Sbjct: 194 EETYKLSELRYKAGVISAVALRQQEALIESAKADYAHAARSREQARNALATLINQPIPED 253

Query: 245 LHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLS 304
           L         F       +  G+ ++++ +RPDIR  E  L  + A IG A++  +PS+ 
Sbjct: 254 LPAGLPLDKQF---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAFFPSIR 310

Query: 305 LNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQET 361
           L G++          F      WSF P + LPIF  G  K+N+  A+   Q Q + ++  
Sbjct: 311 LTGTVGTGSAELGGLFKSGTGVWSFAPSITLPIFTWGTNKANLDVAKLRQQVQIVAYESA 370

Query: 362 VLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERAT 421
           V +A ++V NAL +  +  K    L       K+++ L  + Y+ G    LD+LD ER++
Sbjct: 371 VQSAFQDVANALAAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGALDLLDAERSS 430

Query: 422 AKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
              E     A+   A++  DLY A+G G
Sbjct: 431 YAAEGAALSAQLTRAENLADLYKALGGG 458


>gi|330824330|ref|YP_004387633.1| NodT family RND efflux system outer membrane lipoprotein
           [Alicycliphilus denitrificans K601]
 gi|329309702|gb|AEB84117.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Alicycliphilus denitrificans K601]
          Length = 512

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 117/466 (25%), Positives = 228/466 (48%), Gaps = 24/466 (5%)

Query: 7   IFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
           + +L  VLL  C +VGP+Y +P    + + +S+  +    + D  +WW + +D  L++L+
Sbjct: 26  VLALSCVLLTACASVGPDYREPPPVDVGSGWSLPLASESQSADLSQWWSALDDPILDRLM 85

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSSYA--SISHR-----------FIPNL 112
             AL QNL +  A  RI+ A+     V  +  P++ A  S++ R            IP L
Sbjct: 86  ATALAQNLDLRHAAARIDEARALRDRVAGEALPTAAAGASVNRRRQSENGPLPVGSIPGL 145

Query: 113 KTNST---GQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
               T      D+ W+ DLFG +RR +E + A L +  A+    ++ +++++  ++  A 
Sbjct: 146 DATQTIYDAGFDAAWEADLFGAKRRALEGASARLQATEAEAQGIRMRIVAEVARTWFTAV 205

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
             +  +      LD  ++ +EL  L+   G  S   +    A+  ++ + IP ++   R 
Sbjct: 206 GARYELHAQQATLDTLQQTLELVRLRHALGDASAADVEAAYAQWTAVNALIPDIQARQRA 265

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
            + ++  LLG P    L  +        P+    + +G  A+++R RPD+   E++LA S
Sbjct: 266 AILSLGVLLGAPPERELALLD---GPLTPSTLRALPVGERAEMLRRRPDVLAAERRLAAS 322

Query: 289 VAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
            A IG+A ++L+P LS+    G  AL+  + F   ++ +S  P +   +FD G++++ IR
Sbjct: 323 SADIGVATAELFPKLSIGVGGGFQALSTGDWFDASSSRFSILPLISWRLFDGGRVRAEIR 382

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
             E++ ++  + +++ VL A+ + E AL   +     + +   A++  + S   +   Y 
Sbjct: 383 AREAAERQAALAYEQAVLAALGDAERALGDYHGGLDTLERRGMALDAARTSYGHAKARYA 442

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            G  +L+++L  +R+  + E   + A    A   V LY A+G G++
Sbjct: 443 AGDIALVELLAAQRSLHEAETAAARAHTNAAVQLVALYKALGGGWD 488


>gi|217969441|ref|YP_002354675.1| RND efflux system, outer membrane lipoprotein, NodT family [Thauera
           sp. MZ1T]
 gi|217506768|gb|ACK53779.1| RND efflux system, outer membrane lipoprotein, NodT family [Thauera
           sp. MZ1T]
          Length = 512

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 118/465 (25%), Positives = 225/465 (48%), Gaps = 24/465 (5%)

Query: 8   FSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVK 66
            +L  VLL  C TVGP+Y +P    + + +++  +    + D  +WW + +D  L++L+ 
Sbjct: 27  LALSCVLLTACATVGPDYREPPPVDVGSGWTLPLASESQSADLSQWWSALDDPVLDRLMA 86

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFPSSYA--SISHR-----------FIPNLK 113
            AL  NL + QA  RI+ A+     V  +  P++ A  S++ R            IP L 
Sbjct: 87  TALALNLDLRQAAARIDEARALRERVAGEALPTAAAGASVNRRRQSENGPLPVGSIPGLD 146

Query: 114 TNST---GQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
              T      D+ W+ DLFG +RR +E + A L +  A+    ++ +++++  ++  A  
Sbjct: 147 ATQTIYDAGFDAAWEADLFGAKRRALEGASARLRATEAEAQGVRMRIVAEVARTWFTAVG 206

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
            +  +      LD  ++  EL  L+   G  S   +    A+  ++ + IP ++   R  
Sbjct: 207 ARYELHAQRATLDTLQQTFELVRLRHALGDASAADVEAAYAQWTAVNALIPDIQARQRTA 266

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
           V ++  LLG P    L  +        P+    + +G  AD++R RPD+   E++LA S 
Sbjct: 267 VLSLGVLLGAPPERELALLD---GPLTPSTLRALPVGERADMLRRRPDVLAAERRLAASS 323

Query: 290 AKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           A IG+A ++L+P LS+    G  AL+  + F   ++ +S  P +   +FD G++++ IR 
Sbjct: 324 ADIGVATAELFPKLSIGVGGGFQALSTGDWFDASSSRFSILPLISWRLFDGGRVRAEIRA 383

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
            E++ ++  + +++ VL A+ + E AL   +     + +   A++  + +   +   Y  
Sbjct: 384 REAAERQAALAYEQAVLTALGDAERALGDYHGGLDTLERRGMALDAARTTYGHTRTRYAA 443

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           G  +L+++L  +R+  + E   + A    A   V LY A+G G+ 
Sbjct: 444 GDIALVELLAAQRSLHEAETAAARAHTNAAVQLVALYKALGGGWE 488


>gi|194099136|ref|YP_002002221.1| MtrE [Neisseria gonorrhoeae NCCP11945]
 gi|193934426|gb|ACF30250.1| MtrE [Neisseria gonorrhoeae NCCP11945]
          Length = 467

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 121/445 (27%), Positives = 219/445 (49%), Gaps = 14/445 (3%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F    S + +    L W + F D  L KL+ IAL++N +
Sbjct: 18  LSACTMIPQYEQPKVEVAET-FQNDTSVSSVRAVDLGWHDYFADPRLQKLIDIALERNTS 76

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST------GQLDSDWKIDL 128
           +  A       ++  +  R +L P+  A+ +     +L   +       G   + +++DL
Sbjct: 77  LRTAVLNSEIYRKQYMIERNNLLPTLAANANGSRQGSLSGGNVSSSYNVGLGAASYELDL 136

Query: 129 FGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKN 187
           FG+ R   E++L    ++ A  D A L++I+ +  +Y + R+ +E +S+A ++L   ++ 
Sbjct: 137 FGRVRSSSEAALQGYFASVANRDAAHLSLIATVAKAYFNERYAEEAMSLAQRVLKTREET 196

Query: 188 IELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHY 247
            +LS L++  G  S ++L + EA I+S ++D     +S     + ++TL+  P  E L  
Sbjct: 197 YKLSELRYKAGVISAVALRQQEALIESAKADYAHAARSREQARNALATLINRPIPEDLPA 256

Query: 248 MQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNG 307
                  F       +  G+ ++++ +RPDIR  E  L  + A IG A++  +PS+ L G
Sbjct: 257 GLPLDKQF---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAFFPSIRLTG 313

Query: 308 SIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLN 364
           S+          F      W+F P + LPIF  G  K+N+  A+   Q Q + ++  V +
Sbjct: 314 SVGTGSVELGGLFKSGTGVWAFAPSITLPIFTWGTNKANLDVAKLRQQAQIVAYESAVQS 373

Query: 365 AIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKV 424
           A ++V NAL +  +  K    L       K+++ L  + Y+ G    LD+LD ER++   
Sbjct: 374 AFQDVANALAAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGALDLLDAERSSYSA 433

Query: 425 EVDLSIAKRQLAKSYVDLYIAIGSG 449
           E     A+   A++  DLY A+G G
Sbjct: 434 EGAALSAQLTRAENLADLYKALGGG 458


>gi|237800664|ref|ZP_04589125.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. oryzae str. 1_6]
 gi|331023523|gb|EGI03580.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. oryzae str. 1_6]
          Length = 487

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 124/477 (25%), Positives = 229/477 (48%), Gaps = 38/477 (7%)

Query: 2   NILRAI-FSLFIVLLAGCTVGPEYTKPHMPLLPTQF-SIGNSKNLINIDTL---KWWESF 56
            ++R I   L IVLL+ C VGP+Y KP     P  F +    +     D +    WWE +
Sbjct: 13  GLIRPIGLGLCIVLLSACAVGPDYQKPSAAA-PVHFKAAAGWRAATPSDAMVKGAWWEVY 71

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS-------------SYAS 103
            D  LN LV+     N T+ Q   +   A+  + S R   FP+             +  S
Sbjct: 72  GDPQLNALVERLNTSNQTVAQYDAQYRQAQALVRSSRGAFFPTLDLTTGKTRSGQGTGTS 131

Query: 104 ISHRFIPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIP 162
            S   +  ++ +   QL   W+ D++G+ RR +E+  A+  ++ A +   +L++ S+L+ 
Sbjct: 132 NSGNSVSGIRNSYNAQLGVSWEADIWGKLRRGLEADTASAQASLADLAAMRLSLQSELVQ 191

Query: 163 SYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTL 222
           +Y+  R   E+  +    ++ Y++++ L+  ++  G +   ++ + + ++KS ++D+  L
Sbjct: 192 NYLQLRVIDEQKRLLESTVEAYQRSLNLTRNQYRAGISGSDAVAQAQTQLKSTQADLIDL 251

Query: 223 EKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP----INIGIPADLIRNRPDI 278
                   + I+ L+G    EF         +      IP    I  G+P+ L+  RPDI
Sbjct: 252 AWQRAQFENAIAVLMGMAPAEF---------SLAATTSIPQLPQIPPGLPSQLLERRPDI 302

Query: 279 RYQEKKLADSVAKIGIAKSDLYP--SLSLNGSI-ALTHDNSFPGYNTHWSFGPKLYLPIF 335
              E+ +  + A IG+AK+  YP  +LS++G   + T  N     N  WS GP+L + +F
Sbjct: 303 AAAERSVMAANANIGVAKAAYYPDFTLSMSGGYNSSTFANWISLPNRFWSVGPQLAMTLF 362

Query: 336 DKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKK 395
           D G+  + + R+E+   +    +++TVLN  +EVEN L  +   ++     Q A+   + 
Sbjct: 363 DGGRRTAEVDRSEAVYDQTVAQYRQTVLNGFQEVENYLIQLKVYEQEAAVRQEALVSARD 422

Query: 396 SMSLSMINYRQGRYSLLDILDIERATAKVEVD-LSIAKRQLAKSYVDLYIAIGSGYN 451
           S+ L+   Y+ G    LD+++++      E   LS+ + +L  S V L  A+G G++
Sbjct: 423 SLRLTSNQYKAGLIGYLDVVNVQATALSNERSVLSVLQSRLIAS-VQLIAALGGGWD 478


>gi|319763533|ref|YP_004127470.1| rnd efflux system, outer membrane lipoprotein, nodt family
           [Alicycliphilus denitrificans BC]
 gi|317118094|gb|ADV00583.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Alicycliphilus denitrificans BC]
          Length = 549

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 120/465 (25%), Positives = 221/465 (47%), Gaps = 24/465 (5%)

Query: 8   FSLFIVLLAGCT-VGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVK 66
            +L  VLL  C  VGP+Y +P    + + +++  +    + D  +WW + +D  L++L+ 
Sbjct: 27  LALSCVLLTACAAVGPDYREPPPVDIGSGWTLPLASESQSADLARWWSALDDPILDRLMG 86

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFP--SSYASISHRF-----------IPNLK 113
            AL QNL + QA  RI+ A+     V  D  P  S+  S++ R            IP + 
Sbjct: 87  TALAQNLDLRQAAARIDEARALRDRVAGDQMPTVSAGTSVNRRGQSKNGPLPVGSIPGMD 146

Query: 114 TNST---GQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
              T      D+ W+ DLFG +RR +E + A L +   +    ++ +++++  ++  A  
Sbjct: 147 ATQTIYDAGFDAAWEADLFGAKRRALEGASARLQATEVEAQGVRMRIVAEVARTWFTAVG 206

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
               +      LD  ++ +EL  L+   G  S   +    A+  ++ + +P ++   R  
Sbjct: 207 AGYELHAQQATLDTLQQTLELVRLRHALGDASAADVEAAYAQWTAVNALLPDIQARQRAA 266

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
           V  +  LLG P     H +        P     + +G  ADL+R RPD+   E++LA S 
Sbjct: 267 VLGLGVLLGAPPE---HELALLDGPLAPCTLRALPVGERADLLRRRPDVLAAERRLAASS 323

Query: 290 AKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           A IG+A ++L+P LS+    G  AL+  N F   ++ +S  P +   +FD G++++ IR 
Sbjct: 324 ADIGVATAELFPKLSIGVGGGFQALSTGNWFDASSSRFSILPLISWRLFDGGRVRAEIRA 383

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
            E++ Q+  + +++ VL A+ + E AL   +     + +   A++  + S   +   Y  
Sbjct: 384 REAAEQQAALAYEQAVLAALGDAERALGDYHGGLDTLERRAMALDAARTSYGYAKARYAA 443

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           G  +L+++L  +R+  + E   + A    A   V LY A+G G+ 
Sbjct: 444 GDVALVELLAAQRSLHEAETAAARAHTSAAVQLVALYKALGGGWE 488


>gi|295700862|ref|YP_003608755.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. CCGE1002]
 gi|295440075|gb|ADG19244.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. CCGE1002]
          Length = 522

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 125/470 (26%), Positives = 226/470 (48%), Gaps = 44/470 (9%)

Query: 12  IVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL-------INIDTLKWWESFNDTSLNKL 64
           + L A   VGP YT P   L+    + G  +         +N  T+ WW+ ++D  LN L
Sbjct: 27  VALNACINVGPNYTLPKQALVNAPLATGAIEGADPTLTSNLNTPTV-WWKLYDDPVLNSL 85

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS--------HRFI-----PN 111
           V+ AL+ N  +  A   +  ++E +   +A    S  AS++         +F+     P 
Sbjct: 86  VEQALKSNTDLRVAAANLARSREALGVAQAQGGFSGNASVAIQRAQESAEQFLLFEKLPV 145

Query: 112 LKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                 G ++  ++IDLFG+ RR +E++ A+ ++  A  D+A++ V++ ++ SY++    
Sbjct: 146 ANLGDMG-INVSYEIDLFGKLRRGVEAAAADTEAVEAAGDLARITVVADVVRSYVEQCSA 204

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
            E + IA Q L L K+ ++LS      G  ++ ++   + +++++ +DIP      ++  
Sbjct: 205 AEELRIAQQSLALQKQRVDLSRRLRDAGRGNQTAVTSGQTQVETLTADIPRYTARRKIAQ 264

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + ++ LL    ++    +   + +  P ++ PI IG  A L+R RPD+   E++LA + A
Sbjct: 265 YRLAMLLAQAPSQLPPAVL--ACDRLPQIHQPIPIGDGAGLLRRRPDVHEAERQLAAATA 322

Query: 291 KIGIAKSDLYPSLSLNGSIALTHD-NSFPGYNT-HWSFGPKLYLPIFDKGKIKSNIRRAE 348
           +IG+A   LYPS+S+  S   T      P   T  W FGP +    F     +  +R AE
Sbjct: 323 RIGVATGALYPSISIGASAGFTGILEDIPTQPTARWGFGPLISWN-FPANGARQRVREAE 381

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINED--------KKIVTKLQHAVELHKKSMSLS 400
           +S+Q     +   VL A++E E  L +   D          + + +Q A E H+      
Sbjct: 382 ASSQVALAKFDGVVLGALRETETNLATYASDYARAEALRAALKSAVQSADETHRL----- 436

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              YR GR S +  LD  R     +  L+ A+ Q+A   V+L++++G G+
Sbjct: 437 ---YRAGRESFIADLDATRTLTAAKSQLAAAEGQVAVDQVNLFLSLGGGW 483


>gi|117920439|ref|YP_869631.1| outer membrane efflux protein [Shewanella sp. ANA-3]
 gi|117612771|gb|ABK48225.1| outer membrane efflux protein [Shewanella sp. ANA-3]
          Length = 495

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 116/461 (25%), Positives = 232/461 (50%), Gaps = 36/461 (7%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQF-------SIGNSKNLINIDTLKWWESFNDTSLNKLVKI 67
           +AGC +GP+Y +P + +LP Q+       +     N+  +  L W   + D  L  L++ 
Sbjct: 41  VAGCAMGPDYQRPEL-VLPNQYQAQMLSQTTAEQGNVKEVSALSWRHFYQDPVLISLIEH 99

Query: 68  ALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDS----- 122
           AL  NL +  A  R+ AA+  +  V + L+P    S+   +  +L + +T    S     
Sbjct: 100 ALANNLDLQMAQSRLLAARSKMTVVDSALWPE--VSVKAGYERSLDSGATSTNPSPSTTL 157

Query: 123 ------DWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERIS 175
                  W++DL+G  RR  E+++A+  S   ++ +  +++IS +   Y +    ++R S
Sbjct: 158 DLGGAVSWELDLWGANRRASEAAMADYLSEVEKLRLTYVSLISDIASRYYEWLDIEQRYS 217

Query: 176 IAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIST 235
           ++   + L +K ++++ L+   G  S L + + E E++S +  +PTL+   +  ++ +  
Sbjct: 218 VSIDTVGLRQKELDIAKLRHANGVISGLDVRQAEVELQSTKVTLPTLDYERKYKINQLHI 277

Query: 236 LLGYPATEFLHYMQKQSNNFQPNLYIP--INIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
           LLG    E+  Y          N+ +P  +N G+P++L+  RPD++  E+++  + A++G
Sbjct: 278 LLG----EY-DYALPSPQGLPENMGLPYELNTGVPSELLTLRPDVKIAEQQMIAANAEVG 332

Query: 294 IAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESS 350
           IAK+  +P  +++G     +D   + F      WS    +  PIF++GKI +    A  +
Sbjct: 333 IAKAAFFPKFTISGVYGRENDHLKDIFDSNGVTWSLLGGISAPIFNRGKIAAEYDIATEA 392

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
           A++  ++++  VL A  +V +AL ++   ++ +   +  VE       L+ + Y+ G  +
Sbjct: 393 AKQSMLSYRNVVLTAYFDVNDALNNLKRAQEAIKAQKELVESSSAYARLARLRYQNGVAT 452

Query: 411 LLDILDIERATAKVEVDLS--IAKRQLAKSYVDLYIAIGSG 449
            LD++D +R     ++  S  +  +QLAK  + LY A+G G
Sbjct: 453 SLDLMDAQRQLFSAQLAYSEILRDKQLAK--IALYRALGGG 491


>gi|307726430|ref|YP_003909643.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. CCGE1003]
 gi|307586955|gb|ADN60352.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. CCGE1003]
          Length = 503

 Score =  168 bits (426), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 117/458 (25%), Positives = 220/458 (48%), Gaps = 27/458 (5%)

Query: 17  GC-TVGPEYTKP-----HMPLLPTQFSIGNSKNLINIDTLK-WWESFNDTSLNKLVKIAL 69
           GC  VGP Y+ P     + PL        ++      D    WW+ ++D  LN+LV  AL
Sbjct: 27  GCMNVGPNYSLPKDALVNAPLANAPIEGADTALTSRADVPAVWWKLYDDPVLNRLVDEAL 86

Query: 70  QQNLTILQATERINAAKENILSVRADLFPSSYASISHRF-------------IPNLKTNS 116
           Q N  +  A   +  ++E +   +A    S  AS + +              +P +    
Sbjct: 87  QSNTDLRVAAANLARSREALGVAQAQGGFSGKASAAFQRAQESAEQYLLTEKLPVVNEGD 146

Query: 117 TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERIS 175
            G +   ++IDLFG+ RR +E++ A+ ++  A  D+A+  V++ ++ +Y++     E ++
Sbjct: 147 VG-ISVAYEIDLFGKLRRGVEAAQADAEAVQAAGDLARTTVVADVVRAYVEQCSAAEELN 205

Query: 176 IAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIST 235
           IA Q L L ++ +++S      G  ++  + + + ++ ++ +DIP      ++  + ++ 
Sbjct: 206 IAQQSLALQRQRVDVSRRLRDAGRGNQTEVTRGQTQVDTLSADIPRYTARRKIAQYRLAA 265

Query: 236 LLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIA 295
           LL    ++    +   +    P +  PI +G  A L++ RPD+R  E++LA S A+IG+A
Sbjct: 266 LLARAPSDLPPAVL--ACEKLPRIRQPIPVGDGAALLKRRPDVREAERQLAASTARIGVA 323

Query: 296 KSDLYPSLSLNGSIALTH--DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQE 353
              LYP++S+  S  LT   ++        W FGP L    F     +  +R A++S+Q 
Sbjct: 324 TGALYPTVSIGASAGLTGVLEDLGTSPTARWGFGP-LISWTFPANGARGRVREAQASSQV 382

Query: 354 QYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLD 413
               +   VL A++E E +L +   D      L+ A++   +S   +   YR GR S + 
Sbjct: 383 ALARFDGVVLTALRETETSLATYASDYARAESLRAALKSATQSADETHRLYRAGRESFIS 442

Query: 414 ILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            LD  R     +  ++ A+ Q+A   V+L++A+G G+ 
Sbjct: 443 DLDATRTLTSTKAQVAAAEGQVAIDQVNLFLALGGGWE 480


>gi|257487819|ref|ZP_05641860.1| outer membrane efflux protein [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|330985322|gb|EGH83425.1| outer membrane efflux protein [Pseudomonas syringae pv. lachrymans
           str. M301315]
 gi|331008534|gb|EGH88590.1| outer membrane efflux protein [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 489

 Score =  168 bits (426), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 121/472 (25%), Positives = 223/472 (47%), Gaps = 39/472 (8%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNS-KNLINIDTLK---WWESFNDTSLNK 63
             L +VLL+ C VGP+Y  P M   P QF      +     D +    WWE + D  LN 
Sbjct: 20  LGLCVVLLSACAVGPDYQTPSMAA-PAQFKAAEGWRAATPSDAMAKGAWWEVYRDPQLNA 78

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPS---------------SYASISHRF 108
           LV+     N T+ Q   +   A+  + S R    P+               +  + ++  
Sbjct: 79  LVERLNTSNQTVAQYDAQYRQAQALVRSSRGAFLPTLDLTTGKTRSGQGTGTSNTGTNTG 138

Query: 109 IPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
              ++ +   QL   W+ D++G+ RR +E+  A+  ++ A +   +L++ S+L+ +Y+  
Sbjct: 139 ASGIRNSYNAQLGVSWEADVWGKLRRGLEADTASAQASLADLAAMRLSLQSELVQNYLQL 198

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
           R   E+  +    +D Y++++ L+  ++  G +   ++ + + ++KS ++D+  L     
Sbjct: 199 RVIDEQKRLLESTVDTYQRSLTLTQNQYRAGISGSDAVAQAQTQLKSTQADLIDLAWQRA 258

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP----INIGIPADLIRNRPDIRYQEK 283
              + I+ L+G    +F         N   +  IP    I  G+P+ L+  RPDI   E+
Sbjct: 259 QFENAIAVLMGMAPADF---------NLPASTSIPQLPQIPPGLPSQLLERRPDIAAAER 309

Query: 284 KLADSVAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKI 340
            +  + A IG+AK+  YP  +L+   G  + T  N     N  WS GP+L L +FD G+ 
Sbjct: 310 SVMAANANIGVAKAAYYPDFTLSMSGGYSSSTFANWISLPNRFWSVGPQLALTLFDGGRR 369

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
            + + R E+   +    +++TVLN  +EVEN L  +   ++  T  Q A+   + S+ L+
Sbjct: 370 TAEVDRTEAVYDQTVAQYRQTVLNGFQEVENYLVQLKVYEQEATVRQEALVSARDSLRLT 429

Query: 401 MINYRQGRYSLLDILDIERATAKVEVD-LSIAKRQLAKSYVDLYIAIGSGYN 451
              Y+ G    LD+++++      E   L++ + +L  S V L  A+G G+N
Sbjct: 430 NNQYKAGLIGYLDVVNVQATALSNERSVLNVLQSRLIAS-VQLIAALGGGWN 480


>gi|325136642|gb|EGC59242.1| multiple transferable resistance system protein MtrE [Neisseria
           meningitidis M0579]
          Length = 483

 Score =  168 bits (426), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 123/448 (27%), Positives = 220/448 (49%), Gaps = 20/448 (4%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F    + + I    L W + F D  L KL+ IAL++N +
Sbjct: 34  LSACTMIPQYEQPKVEVAET-FKNDTADSGIRAVDLGWHDYFADPRLQKLIDIALERNTS 92

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSDWKI-------- 126
           +  A       ++  +  R +L P+  A+ +     +L   S G + S +K+        
Sbjct: 93  LRTAVLNSEIYRKQYMIERNNLLPTLAANANGSRQGSL---SGGNVSSSYKVGLGAASYE 149

Query: 127 -DLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLY 184
            DLFG+ R   E++L    ++ A  D A L++I+ +  +Y + R+ +E +S+A ++L   
Sbjct: 150 LDLFGRVRSSSEAALQGYFASTANRDAAHLSLIATVAKAYFNERYAEEAMSLAQRVLKTR 209

Query: 185 KKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEF 244
           ++  +LS L++  G  S ++L + EA I+S ++D     +S     + ++TL+  P  + 
Sbjct: 210 EETYKLSELRYKAGVISAVALRQQEALIESAKADYAHAARSREQARNALATLINQPIPDD 269

Query: 245 LHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLS 304
           L         F       +  G+ ++++ +RPDIR  E  L  + A IG A++  +PS+ 
Sbjct: 270 LPAGLPLDKQF---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAFFPSIR 326

Query: 305 LNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQET 361
           L G++          F      WSF P + LPIF  G  K+N+  A+   Q Q + ++  
Sbjct: 327 LTGTVGTGSAELGGLFKSGTGVWSFAPSITLPIFTWGTNKANLDVAKLRQQAQIVAYESA 386

Query: 362 VLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERAT 421
           V +A ++V NAL +  +  K    L       K+++ L  + Y+ G    LD+LD ER++
Sbjct: 387 VQSAFQDVANALAAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGALDLLDAERSS 446

Query: 422 AKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
              E     A+   A++  DLY A+G G
Sbjct: 447 YAAEGAALSAQLTRAENLADLYKALGGG 474


>gi|229590388|ref|YP_002872507.1| outer membrane component of multidrug efflux system [Pseudomonas
           fluorescens SBW25]
 gi|229362254|emb|CAY49156.1| outer membrane component of multidrug efflux system [Pseudomonas
           fluorescens SBW25]
          Length = 471

 Score =  168 bits (426), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 133/467 (28%), Positives = 230/467 (49%), Gaps = 35/467 (7%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK----WWESFNDTSLNKL 64
           SL ++ L+ C VGP+Y K   P      +  ++K     D  K    WW+ F D +LN+L
Sbjct: 9   SLLVLALSACAVGPDY-KTQTPEAANITAAADAKQ---YDHAKFEGIWWQQFEDPTLNQL 64

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPS--SYASISHR--FIPNLKTNSTGQ- 119
           V  +LQ N  +  A  R+ AA+        D  P+  S AS       IP   T      
Sbjct: 65  VTQSLQGNRDLRVAFARLRAARAIRDDASNDAMPTITSRASSDQGKGQIPGQTTRRVKTE 124

Query: 120 -----LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR--HFK 171
                LD  W++DLFG+ +R++E++ A+  +A A +   ++ +I++L+ +Y   R    +
Sbjct: 125 RYDLGLDMAWELDLFGRIQRNLEATDADQQAAEADLYQLQVTLIAELVDAYGQLRGAQLR 184

Query: 172 ERISIAHQILDLYKKNIELSHLKFT---QGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
           ERI+     LD  K   E   +  +    G   +L + + +A + ++E+ +P L+     
Sbjct: 185 ERIA-----LDNLKNQQESRTITVSLRDAGVGDQLDVERADARLAAVEASVPQLQAEQVR 239

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
             + I+TLLG    +    +  +     P +   + IG P  L++ RPDI   E+KLA +
Sbjct: 240 ERNRIATLLGQRPDKLSVDLGPKD---LPAIAKALPIGDPGQLLQRRPDILSAERKLAAA 296

Query: 289 VAKIGIAKSDLYPSLSLNGSIALTHD-NSFPGYNTH--WSFGPKLYLPIFDKGKIKSNIR 345
            A+IG+AK+DL+P +SL+G +  T    S  G +    W+ GP +    FD G +++ +R
Sbjct: 297 TARIGVAKADLFPRVSLSGFLGFTAGRGSQIGSSAANAWALGPSITWAAFDLGSVRARLR 356

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
            A++ A     ++++ VL A++E ENA +   + ++ +  L    E  + +  L+ I YR
Sbjct: 357 GADAEADGALASYEQQVLLALEESENAFSDYGKRQQRLVSLIRQSESSRAAADLAAIRYR 416

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           +G    L +LD +R     E   + A+  L +  V +Y A+G G+ P
Sbjct: 417 EGTVDFLVLLDAQRERLAAEDSQAQAEVDLYRGIVAIYKALGGGWKP 463


>gi|239999435|ref|ZP_04719359.1| hypothetical protein Ngon3_08116 [Neisseria gonorrhoeae 35/02]
 gi|240081308|ref|ZP_04725851.1| hypothetical protein NgonF_08375 [Neisseria gonorrhoeae FA19]
 gi|240123961|ref|ZP_04736917.1| hypothetical protein NgonP_08483 [Neisseria gonorrhoeae PID332]
 gi|268595255|ref|ZP_06129422.1| multidrug efflux pump channel protein [Neisseria gonorrhoeae 35/02]
 gi|268597412|ref|ZP_06131579.1| multidrug efflux pump channel protein [Neisseria gonorrhoeae FA19]
 gi|268682590|ref|ZP_06149452.1| outer membrane lipoprotein [Neisseria gonorrhoeae PID332]
 gi|293398651|ref|ZP_06642829.1| OMF family outer membrane factor [Neisseria gonorrhoeae F62]
 gi|268548644|gb|EEZ44062.1| multidrug efflux pump channel protein [Neisseria gonorrhoeae 35/02]
 gi|268551200|gb|EEZ46219.1| multidrug efflux pump channel protein [Neisseria gonorrhoeae FA19]
 gi|268622874|gb|EEZ55274.1| outer membrane lipoprotein [Neisseria gonorrhoeae PID332]
 gi|291611122|gb|EFF40219.1| OMF family outer membrane factor [Neisseria gonorrhoeae F62]
 gi|317164683|gb|ADV08224.1| hypothetical protein NGTW08_1257 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 467

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 122/445 (27%), Positives = 218/445 (48%), Gaps = 14/445 (3%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F    S + I    L W + F D  L KL+ IAL++N +
Sbjct: 18  LSACTMIPQYEQPKVEVAET-FQNDTSVSSIRAVDLGWHDYFADPRLQKLIDIALERNTS 76

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST------GQLDSDWKIDL 128
           +  A       ++  +  R +L P+  A+ +     +L   +       G   + +++DL
Sbjct: 77  LRTAVLNSEIYRKQYMIERNNLLPTLAANANGSRQGSLSGGNVSSSYNVGLGAASYELDL 136

Query: 129 FGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKN 187
           FG+ R   E++L    ++ A  D A L++I+ +  +Y + R+ +E +S+A ++L   ++ 
Sbjct: 137 FGRVRSSSEAALQGYFASVANRDAAHLSLIATVAKAYFNERYAEEAMSLAQRVLKTREET 196

Query: 188 IELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHY 247
            +LS L++  G  S ++L + EA I+S ++D     +S     + ++TL+  P  E L  
Sbjct: 197 YKLSELRYKAGVISAVALRQQEALIESAKADYAHAARSREQARNALATLINRPIPEDLPA 256

Query: 248 MQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNG 307
                  F       +  G+ ++++ +RPDIR  E  L  + A IG A++  +PS+ L G
Sbjct: 257 GLPLDKQF---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAFFPSIRLTG 313

Query: 308 SIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLN 364
           S+          F      W+F P + LPIF  G  K+N+  A+   Q Q + ++  V +
Sbjct: 314 SVGTGSVELGGLFKSGTGVWAFAPSITLPIFTWGTNKANLDVAKLRQQAQIVAYESAVQS 373

Query: 365 AIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKV 424
           A ++V NAL +  +  K    L       K+++ L  + Y+ G    LD+LD ER +   
Sbjct: 374 AFQDVANALAAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGALDLLDAERISYSA 433

Query: 425 EVDLSIAKRQLAKSYVDLYIAIGSG 449
           E     A+   A++  DLY A+G G
Sbjct: 434 EGAALSAQLTRAENLADLYKALGGG 458


>gi|313667900|ref|YP_004048184.1| outer membrane efflux protein [Neisseria lactamica ST-640]
 gi|313005362|emb|CBN86796.1| outer membrane efflux protein [Neisseria lactamica 020-06]
          Length = 483

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 122/453 (26%), Positives = 216/453 (47%), Gaps = 30/453 (6%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F    + + I    L W + F D  L KL+ IAL++N +
Sbjct: 34  LSACTMIPQYGQPKVEVAET-FKNDTADSGIRAVDLGWHDYFADPRLQKLIDIALERNTS 92

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLD------------- 121
           +  A       ++  +  R +L P+           N   +  G LD             
Sbjct: 93  LRTAVLNSEIYRKQYMIERNNLLPT--------LAANANGSRQGSLDGGNVSSSYNVGLG 144

Query: 122 -SDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQ 179
            + +++DLFG+ R   E++L    ++ A  D A L++I+ +  +Y + R+ +E +S+A +
Sbjct: 145 AASYELDLFGRVRSSSEAALQGYFASTANRDAAHLSLIATVAKAYFNERYAEEAMSLAQR 204

Query: 180 ILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGY 239
           +L   +   +LS L++  G  S ++L + EA I+S ++D     +S     + ++TL+  
Sbjct: 205 VLKTREATYKLSELRYKAGVISAVALRQQEALIESAKADYANAVRSREQARNALATLINQ 264

Query: 240 PATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDL 299
           P  + L         F       +  G+ ++++ +RPDIR  E  L  + A IG A++  
Sbjct: 265 PIPDDLPAGLPLDKQF---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAF 321

Query: 300 YPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYI 356
           +PS+ L GS+          F      WSF P + LPIF  G  K+N+  A+   Q Q +
Sbjct: 322 FPSIRLTGSVGTGSAELGGLFKSGTGVWSFAPSITLPIFTWGTNKANLDAAKLRRQAQIV 381

Query: 357 TWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILD 416
            ++  V +A ++V NAL +  +  K    L       K+++ L  + Y+ G    LD+LD
Sbjct: 382 AYEAAVQSAFQDVANALAAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGALDLLD 441

Query: 417 IERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
            ER++   E     A+   A++  DLY A+G G
Sbjct: 442 AERSSYSAEGAALSAQLTRAENLADLYKALGGG 474


>gi|325923516|ref|ZP_08185166.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [Xanthomonas gardneri ATCC 19865]
 gi|325546013|gb|EGD17217.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [Xanthomonas gardneri ATCC 19865]
          Length = 486

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 135/476 (28%), Positives = 225/476 (47%), Gaps = 42/476 (8%)

Query: 8   FSLFIVL--LAGCT-VGPEYTKP-----HMPLLPTQFS-IGNSKNLINID-TLKWWESFN 57
           F L  VL  L  CT VGP Y  P       P     F   GN +         +WW  + 
Sbjct: 9   FGLAAVLTALTACTTVGPNYAVPDDSAYQRPAANAAFGDTGNDQVHPGAPLPARWWALYQ 68

Query: 58  DTSLNKLVKIALQQNLTILQAT---ERINAAKENILSV------------RADLFPSSYA 102
           D  L+ L++ AL+ N+ +  A     R  A  E  L              RA +  S+ A
Sbjct: 69  DPMLDGLIEQALRDNVELKVAGANLRRAAAVYEQALDAGGFDYEVEAGVSRAQV--SAEA 126

Query: 103 SISHRFIP--NLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISK 159
            +    +P  NL   + G+    ++ DLFG+ +R  E++ AN   A A +D+A++NV ++
Sbjct: 127 FLQEEKLPVFNL---ADGKFGVSYQFDLFGKLQRGAEAAQANTQVAQAAIDLARVNVAAQ 183

Query: 160 LIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDI 219
           +  SY++  H    + +A   L L +++ +++      G  +   L +  A++  +E+ +
Sbjct: 184 VAGSYVEICHANHELHVAEHSLQLQQRSRDITQRLIDAGRGTPPDLARATAQVAMLEAAL 243

Query: 220 PTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIR 279
           P L    +   + ++ LLG    E    +   S    P L  PI IG    L+  RPD+R
Sbjct: 244 PPLHARRQAAGYQLAALLGKTPGEVPAGVD--SCAHAPALQQPIPIGDGRALLARRPDVR 301

Query: 280 YQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTH-WSFGPKLYLPIF 335
             E++LA + A+IG+A ++LYP + L GSI  T    D   P   TH WSFGP +   + 
Sbjct: 302 QAERRLAAATARIGVATAELYPDIRLGGSIGATGLLADFGEPA--THAWSFGPLISWTLP 359

Query: 336 DKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKK 395
             G  ++ IR  E+ A      +  TVL A++EV+  L+   +D   +  L+ A +  + 
Sbjct: 360 SSGA-RARIRATEAGADAALAQFDHTVLQALREVQTTLSRYAQDLDRLHLLEQAQQQAEL 418

Query: 396 SMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           + S +   Y+ GR   L  LD ER  A  ++ L+ A+ Q+++  + L++A+G G+ 
Sbjct: 419 ASSQNRRLYQGGRTPYLSSLDAERTLATADMTLANAQAQVSQDQLQLFLALGGGWE 474


>gi|308389832|gb|ADO32152.1| multidrug efflux pump channel protein [Neisseria meningitidis
           alpha710]
 gi|325201634|gb|ADY97088.1| multiple transferable resistance system protein MtrE [Neisseria
           meningitidis M01-240149]
 gi|325208631|gb|ADZ04083.1| multiple transferable resistance system protein MtrE [Neisseria
           meningitidis NZ-05/33]
          Length = 467

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 123/448 (27%), Positives = 220/448 (49%), Gaps = 20/448 (4%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F    + + I    L W + F D  L KL+ IAL++N +
Sbjct: 18  LSACTMIPQYEQPKVEVAET-FKNDTADSGIRAVDLGWHDYFADPRLQKLIDIALERNTS 76

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDSDWKI-------- 126
           +  A       ++  +  R +L P+  A+ +     +L   S G + S +K+        
Sbjct: 77  LRTAVLNSEIYRKQYMIERNNLLPTLAANANDSRQGSL---SGGNVSSSYKVGLGAASYE 133

Query: 127 -DLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLY 184
            DLFG+ R   E++L    ++ A  D A L++I+ +  +Y + R+ +E +S+A ++L   
Sbjct: 134 LDLFGRVRSSSEAALQGYFASTANRDAAHLSLIATVAKAYFNERYAEEAMSLAQRVLKTR 193

Query: 185 KKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEF 244
           ++  +LS L++  G  S ++L + EA I+S ++D     +S     + ++TL+  P  + 
Sbjct: 194 EETYKLSELRYKAGVISAVALRQQEALIESAKADYAHAARSREQARNALATLINQPIPDD 253

Query: 245 LHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLS 304
           L         F       +  G+ ++++ +RPDIR  E  L  + A IG A++  +PS+ 
Sbjct: 254 LPAGLPLDKQF---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAFFPSIR 310

Query: 305 LNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQET 361
           L G++          F      WSF P + LPIF  G  K+N+  A+   Q Q + ++  
Sbjct: 311 LTGTVGTGSAELGGLFKSGTGVWSFAPSITLPIFTWGTNKANLDVAKLRQQAQIVAYESA 370

Query: 362 VLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERAT 421
           V +A ++V NAL +  +  K    L       K+++ L  + Y+ G    LD+LD ER++
Sbjct: 371 VQSAFQDVANALAAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGALDLLDAERSS 430

Query: 422 AKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
              E     A+   A++  DLY A+G G
Sbjct: 431 YAAEGAALSAQLTRAENLADLYKALGGG 458


>gi|71907785|ref|YP_285372.1| RND efflux system, outer membrane lipoprotein, NodT [Dechloromonas
           aromatica RCB]
 gi|71847406|gb|AAZ46902.1| RND efflux system, outer membrane lipoprotein, NodT [Dechloromonas
           aromatica RCB]
          Length = 475

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 121/459 (26%), Positives = 211/459 (45%), Gaps = 30/459 (6%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINID-----TLKWWESFNDTSLNKLVKIAL 69
           L+GC +GP+Y +P   LLP+ F        + I        +WW  FND +LN LV  AL
Sbjct: 18  LSGCAIGPDYLRPSA-LLPSLFGEAKPAETVAIAPNPAIDPRWWTLFNDATLNDLVDQAL 76

Query: 70  QQNLTILQATERINAAKENILSVRADLFP---SSYASISHRFI----------PNLKTNS 116
             N ++ QA  R+  A+       A  FP    S AS + +            P ++   
Sbjct: 77  SNNASLRQAIARVEQAEAVAREAGASFFPEIDGSAASSNTKASTKTATYVASQPAIRHAR 136

Query: 117 TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERIS 175
           +  L + +++D++G+ RR  E++ A L ++    D  ++ V   +  +Y+  R +  +++
Sbjct: 137 SAGLSTSFELDVWGRVRRANEAAQATLLASQYSRDSIRITVAGLVASNYLALRAYDAQLA 196

Query: 176 IAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIST 235
           +  + L   + +++L   +   G  S L   + E  + + +  I    +   +  H ++ 
Sbjct: 197 LTSETLKSREDSLKLVKTRVDAGLVSPLDGYQAEGALAAAQVQIAEQRRQRALAEHQLAL 256

Query: 236 LLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIA 295
           L G P  +      +Q            +     DLI  RPD+R  E +L  + A IGIA
Sbjct: 257 LTGNPELKLAAGDLRQLPLPPLPPAGLPS-----DLIEGRPDVRQAEAELIATNAGIGIA 311

Query: 296 KSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQ 352
           K+  +P  +L GSI        + F   +  WS G    +PI D G+  + + +A++  Q
Sbjct: 312 KAGYFPKFTLTGSIGSESKILSDLFSAGSGTWSLGLSALMPILDFGRTSARVDQAKALNQ 371

Query: 353 EQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLL 412
           +  I WQ ++  A KEV +AL S+ ED +  T     V+  +K++ +S + Y  G    L
Sbjct: 372 QSLIAWQNSLQTAYKEVRDALVSLREDGEAETAQNIRVDSARKALDVSRLRYEAGHAGYL 431

Query: 413 DILDIERATAKVEVDLSIAKRQLA-KSYVDLYIAIGSGY 450
           ++LD +R T    V   I  RQ    + +DL+ A+G G+
Sbjct: 432 EVLDAQR-THNDAVTTMITMRQARLGAAIDLFKALGGGW 469


>gi|182679452|ref|YP_001833598.1| RND efflux system outer membrane lipoprotein [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182635335|gb|ACB96109.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 533

 Score =  167 bits (424), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 129/491 (26%), Positives = 223/491 (45%), Gaps = 66/491 (13%)

Query: 15  LAGCTVGPEYTKPHM--PLLPTQFSIGNSKNLINIDTLK--WWESFNDTSLNKLVKIALQ 70
           L GC+VGP++  P    P    Q + G+         ++  WW  + D  LNKL  +  +
Sbjct: 27  LGGCSVGPDFQSPAFDAPKSWPQTAAGHGDGRPTPQQIEPDWWLIYRDPVLNKLENMVAE 86

Query: 71  QNLTILQATERINAAKENILSVRADLFPSSYASISH---RFIPN--------LKTNSTGQ 119
            NL I  A  R+  ++       +  FPS  ++ S+   R  PN        L+  + GQ
Sbjct: 87  ANLDIKAAAHRLAQSRAARQVAASSQFPSINSNASYARERASPNGVLGLLGTLEQETPGQ 146

Query: 120 L---------------------------DSDWKIDLFGQ-RRHIESSLANLDSAYAQVDI 151
           +                           D+ W++DL+G  RR +E + A+  +    V  
Sbjct: 147 IANGTQGFGPARLPGLAGQPFNLFQYGIDASWEVDLWGHVRRQVEGADADTAAMADHVRD 206

Query: 152 AKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAE 211
             + + ++    YI  R  + +I +  Q +D+ +  +EL+ ++FT GAT+ L +    A+
Sbjct: 207 VLVTIFAETAHDYIQLRSIQAQIVLTKQNIDIARHGLELTRMRFTNGATTTLDVANASAQ 266

Query: 212 IKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNL----YIP----- 262
           + +IE+ +P LE   R   H I+ L       FL  + ++     P L     IP     
Sbjct: 267 LATIEAYLPALE---REEGHLINAL------SFL--VDEEPRALSPMLGARRQIPMAPPK 315

Query: 263 INIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSI---ALTHDNSFPG 319
           I +G+PA+L   RPDIR   ++L  +VA IG+A ++ YP ++L+GS+   ALT       
Sbjct: 316 IPMGVPAELAERRPDIRMATERLHAAVANIGVAVAEFYPRITLSGSLDIQALTFSGLGTW 375

Query: 320 YNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINED 379
            +  +  GP + +PIF  G+++  +       +E  I ++ TVLNA  E++NAL   +  
Sbjct: 376 ASRQYGLGPTVSIPIFQGGRLRGQLELRNEQQKEAAILYRRTVLNAWHEIDNALIDYHVA 435

Query: 380 KKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSY 439
           +     L  A + ++ +++ S   Y QG    L++L  +      +  L  A    A + 
Sbjct: 436 QARRASLAEATKQNEIALTASQTQYTQGSSDFLNVLTAQNRLLSTKSQLLQASADTAIAV 495

Query: 440 VDLYIAIGSGY 450
             LY A+G G+
Sbjct: 496 AQLYKALGGGW 506


>gi|300693554|ref|YP_003749527.1| rnd efflux transporter, outer membrane lipoprotein [Ralstonia
           solanacearum PSI07]
 gi|299075591|emb|CBJ34884.2| RND efflux transporter, outer membrane lipoprotein [Ralstonia
           solanacearum PSI07]
          Length = 482

 Score =  167 bits (424), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 121/453 (26%), Positives = 208/453 (45%), Gaps = 22/453 (4%)

Query: 15  LAGCTVGPEYTKPH-MPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNL 73
           L  C + P Y  P  +     Q  + +   + N+  + WWE F+D ++ +LV++A   + 
Sbjct: 20  LCACALQPSYQAPQAVAATGWQAELPHGGKVDNL--VGWWEHFDDPAVAELVRMAEAGSP 77

Query: 74  TILQATERINAAKENILSVRADLFPS-----------SYASISHRFIPNLKTNSTGQLDS 122
           T+ +A  RIN A+  + S  A  +PS           S  ++    +  L T  +   D+
Sbjct: 78  TLAKAVARINGARATLASSNAGAWPSLTGSGSVTRAKSAVALGGATVSGLTTTRSASADA 137

Query: 123 DWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQIL 181
            W+IDLFG QR   ESS A LD+       A++++ +++   Y+  R  ++      Q  
Sbjct: 138 SWEIDLFGKQRSARESSQAQLDARIDDWHDARVSLAAEVADDYVQYRACRQLARAYAQSA 197

Query: 182 DLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPA 241
             Y +    +      G +S       +A   S  +       +    V ++  L G   
Sbjct: 198 ASYAQTENATRAAVGAGMSSASDGYLAQASTASARATATQQNVACEELVKSLVALTGADE 257

Query: 242 TEFLHYMQKQSNNFQPNLYIPINI---GIPADLIRNRPDIRYQEKKLADSVAKIGIAKSD 298
                 + +      P L  P       +PADL+R RPD+   E+ LA + A IG A++D
Sbjct: 258 PTLRGVIDR---TGAPELPEPAAFRVTSLPADLVRQRPDLASSERALASTYADIGQARAD 314

Query: 299 LYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITW 358
            +PSLSL+GS+ ++  N      + WSFGP L +P+FD GK ++ +  A++S   Q   +
Sbjct: 315 RFPSLSLSGSLTISATN-LAAPTSSWSFGPSLSVPLFDAGKRRAAVDSAQASYDAQLAAY 373

Query: 359 QETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIE 418
           +  VL A+KEVE AL  ++   +     + A E ++     +  N+R G  +LL +    
Sbjct: 374 RSAVLTAVKEVEVALVDLDGAARRSDDARRAAEQYRLYERAAQANWRAGFDTLLTLEQAR 433

Query: 419 RATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           R+    E+     +R   +S++ LY A+G G+ 
Sbjct: 434 RSLTSAEITHIELQRDRVRSWIALYKALGGGWQ 466


>gi|163801369|ref|ZP_02195268.1| putative outer membrane protein [Vibrio sp. AND4]
 gi|159174858|gb|EDP59658.1| putative outer membrane protein [Vibrio sp. AND4]
          Length = 550

 Score =  167 bits (424), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 133/491 (27%), Positives = 255/491 (51%), Gaps = 53/491 (10%)

Query: 6   AIFSLFIVLLAGCT-VGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK---WWESFNDTSL 61
           ++ +L ++ L+ CT +GP+Y  P    LP+ +S+ NS         K   WW+ FND +L
Sbjct: 9   SLATLSVLGLSACTTLGPDYIHPKQSTLPSNWSVENSAQDTQQSDQKLQQWWQQFNDPTL 68

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADL-FPSSY---ASISHRFIPNLKTNST 117
           N+LVK+A QQNL +  A  RI  A+ ++L +   L +P +     +++  ++ +   N+ 
Sbjct: 69  NQLVKMASQQNLDLEAAGLRIVQAR-SLLGISTGLQYPQAQTVSGNVARAYVNDQGVNNA 127

Query: 118 G-QLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERIS 175
               D+ W++D++G+  R+IES+ A   ++ A      + + +++  +YI+ R F+ERI 
Sbjct: 128 ALSFDAGWEMDIWGKYARNIESAEAGYYASIASYHDIMVTIAAEVARNYINYRTFQERIL 187

Query: 176 IAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIST 235
           ++ + +++ ++ + ++ ++F  G  ++L + + + ++ + ++ +P+LE + + +   ++ 
Sbjct: 188 LSRRNIEIQQRVVNITQVQFDSGNVTELDVQQAKNQLFNTKATLPSLEIAMKQSRTALAL 247

Query: 236 LLGYPATEFLHYMQKQ--------------SNNFQPNL-------YIP----INIGIPAD 270
           LLG    E    +Q +              S+  +P L        +P    ++  I A+
Sbjct: 248 LLGTLPEEMERLLQSEGFAQRMANYESHFKSSGRKPALSGGDERSIVPRPPQLDKKIDAN 307

Query: 271 LIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSF---- 326
           L+  RPD++  E +     AKIGIA++ LYPS SL GSI +  D++ P   + +SF    
Sbjct: 308 LVMRRPDLQVSEMQARAQSAKIGIAETALYPSFSLFGSIGI--DSTVP-EGSSFSFSDSL 364

Query: 327 ----GPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSIN---ED 379
               GP     IF  G++K+NIR  ++  QE    + + VL A+ EV +AL + N   E 
Sbjct: 365 TMVAGPAFSWNIFQYGRVKNNIRFEDARFQETLTNYNKKVLQAVNEVTSALEAYNLYLEQ 424

Query: 380 KKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSY 439
           K +  +LQ +V    ++ ++SM  Y  G+ S   +L+      + E   +  K  +A   
Sbjct: 425 KSL--RLQ-SVNSSIRAFNISMTQYENGQISFERLLNSVEKMTRAEDSYATIKGNVANQV 481

Query: 440 VDLYIAIGSGY 450
           V LY ++G G+
Sbjct: 482 VALYKSLGGGW 492


>gi|189424457|ref|YP_001951634.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Geobacter lovleyi SZ]
 gi|189420716|gb|ACD95114.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Geobacter lovleyi SZ]
          Length = 461

 Score =  167 bits (424), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 124/456 (27%), Positives = 228/456 (50%), Gaps = 24/456 (5%)

Query: 7   IFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVK 66
           +F   ++L+ GC+VGP+Y +P +   P Q+++   K   ++   +WW+ F D  L+ L++
Sbjct: 5   MFVTMLLLVCGCSVGPDYVRPDVKA-PDQWNV-EYKAAADLANTQWWKLFGDKVLDDLIE 62

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK--TNSTGQ----- 119
            A++ NL +  AT +++     + + R+  FP     IS  F P      +ST Q     
Sbjct: 63  TAVRGNLDLKSATAKVDQYLGVLDTTRSQYFPQ----ISAGFNPGATHTGSSTTQSYQAT 118

Query: 120 LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAH 178
           +++ W++DL+G+ RR  E++ A +  + A      + V+S +   YI  R    ++ IA 
Sbjct: 119 VNATWELDLWGKIRRSSEAAQAQIVGSEAGRRAVIMTVVSNVASGYITLRGMDRQLEIAR 178

Query: 179 QILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG 238
                Y ++++L  L+F  G  S+L L + E+  ++    IP+ E   R   + IS LLG
Sbjct: 179 DTEKAYAESLKLFQLRFKYGTISQLELSQAESNYEAARQAIPSYESLVRQQENLISLLLG 238

Query: 239 YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSD 298
                      K  +   P     I  G+P+ L+  RPDI   E+ L  + A+IG+AK+ 
Sbjct: 239 RAPGPIPR--GKTIDELIPP---GIPAGLPSLLLERRPDIIQAEQNLIAANAEIGVAKAA 293

Query: 299 LYPSLSLNGSIALTHDN----SFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQ 354
            +P +SL G++ ++  +      PG    WS G +L  P+F+ G+    +++AE+  Q+ 
Sbjct: 294 YFPKISLTGALGVSSGDISRLFVPGAGI-WSAGAQLAQPLFNFGQTAGQVKQAEAQQQQA 352

Query: 355 YITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDI 414
              +Q+T+L A +EVE+AL    + ++ +   +  V        L+ + +  G  S L +
Sbjct: 353 LYQYQQTILTAFREVEDALIKTTKGREQLEAQRRQVASLSDYDRLARLQFEAGTSSYLQV 412

Query: 415 LDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           LD +R+    ++D +     L  S + +Y A+G G+
Sbjct: 413 LDADRSLFTGKLDKTKTHYDLLVSLISVYKAMGGGW 448


>gi|307296067|ref|ZP_07575898.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Sphingobium chlorophenolicum L-1]
 gi|306878238|gb|EFN09460.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Sphingobium chlorophenolicum L-1]
          Length = 466

 Score =  167 bits (424), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 125/461 (27%), Positives = 218/461 (47%), Gaps = 37/461 (8%)

Query: 16  AGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTI 75
            GC  GP Y +P + L   QF+   S      D   WW  FND  L+++V  AL QNL +
Sbjct: 14  GGCATGPAYHRPDVRL-TEQFAGQTSFQEAKKD---WWREFNDPLLDRIVDRALAQNLDL 69

Query: 76  LQATERINAAKENILSVRADLFP----------------SSYASISHRF-IP-NLKTNST 117
                R+  A+    +  A L P                SS   ++ R  +P N +    
Sbjct: 70  AVVAARVAQARAAAGAAGAALLPTLNGGASAAANRQSTHSSIGGVAQRLGMPRNYEQYDV 129

Query: 118 GQLDSDWKIDLFG----QRRHIESSLA-NLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
           G   + W+IDLFG    +RR   +  A NL    A  + A+L+V+++++ +Y++ R  + 
Sbjct: 130 GA-QASWEIDLFGGLSGERRAARAEYAGNL----ADQEAARLSVVAEVVDAYLNMRGLQA 184

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
           ++++A + + +    ++L   +  QG  ++  L ++  E + +E+ I  L  S    ++ 
Sbjct: 185 QLAVAEKQVGIESSLVDLIRQRVGQGIAAERELNRVLGEQRGVEASIAPLRASIAAQMNR 244

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G  A      +        P   +P     PA+L+R RPDI   E++L  + A+I
Sbjct: 245 LDILMGQQAGTGRAELSVAVAT--PGALLPRGDANPAELLRRRPDIVAAERRLVAANARI 302

Query: 293 GIAKSDLYPSLSLNG---SIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A ++ YP L+L+G    I+L   N F G +   S G  +   +FD G+I +++ +A  
Sbjct: 303 GAAMAEYYPHLTLSGLFDVISLGTGNLFTGGSVQASGGAGIRWRLFDFGRIDADVAQARG 362

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
              E    ++ +VL A ++VE AL  ++E +  + KL+  V     +   +   Y  G  
Sbjct: 363 REAEALARYRSSVLRATEDVETALVQLSEGRVQIDKLEQQVAALTIARDQARHAYENGAV 422

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +LLD+LD ++A       L  A+  +A++ V    A+G GY
Sbjct: 423 ALLDVLDADQAVLNASSRLEQARAGVARASVAAIRALGGGY 463


>gi|148547646|ref|YP_001267748.1| RND efflux system outer membrane lipoprotein [Pseudomonas putida
           F1]
 gi|148511704|gb|ABQ78564.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Pseudomonas putida F1]
          Length = 487

 Score =  167 bits (424), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 129/471 (27%), Positives = 226/471 (47%), Gaps = 45/471 (9%)

Query: 16  AGCTVGPEYTKPHMPLLPTQFSIGN--SKNLINIDTL-KWWESFNDTSLNKLVKIALQQN 72
           AGC VGP+Y +P+ PL     S     +      D L  WW+ F D  L+ LV  A+ QN
Sbjct: 17  AGCMVGPDYKQPNAPLAHHYISSAGLAATPGARADKLDNWWDGFGDPLLSTLVTEAIGQN 76

Query: 73  LTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST--GQ----------- 119
           L + QA  R+  A+  + S  A L PS  AS++ +   + ++  T  GQ           
Sbjct: 77  LELAQAQARVVQARATLGSATAALVPS--ASVNGQAARSRQSIETPLGQVLNSTPGYDRY 134

Query: 120 -------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
                  LD+ W+IDLFG  RR+ E+++A   +  A     +L + ++    YI  R  +
Sbjct: 135 GSSYELNLDASWEIDLFGGLRRNREAAMAQYQAYEAGAVATRLAIAAQTADIYITVRGLQ 194

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
            R++IA       ++ +    L   +G  +   + + E E+  +++ IP L  +    ++
Sbjct: 195 ARLAIAQAQARTQRELLGKVKLLNQKGLAADYEVRQTEGELSQVDATIPGLRANLDAALN 254

Query: 232 NISTLLGY-PATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
            +  +LG  P T   H  Q  + +  P      +IG PA L+R RPD+   E+++  + A
Sbjct: 255 ALDVVLGSSPGT---HRTQMAAPSHIPKAPQLSDIGEPAQLLRRRPDLIAAERRVMSANA 311

Query: 291 KIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A S+ YP+ SL    G+ + +    F G  +  +    L   +FD G+I + I++A
Sbjct: 312 LIGSAISEYYPTFSLGALVGAASTSGGQFFTGGASQSAAFLGLRWRLFDFGRINAEIQQA 371

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSL------SM 401
           +    E    +++ VL A ++VE AL+++      V + Q A  L +   SL      S 
Sbjct: 372 KGREAEALAYYRQAVLGASQDVETALSAL------VNRQQQAQSLGEGEASLAQARQSSF 425

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
             Y++G  SLL++L+ ++   +     ++A+ + A++ +  Y A+G G++P
Sbjct: 426 AAYQKGAASLLNVLNADQQLLRASDSRAVAQTEAARAAIATYRALGGGWSP 476


>gi|223938890|ref|ZP_03630777.1| RND efflux system, outer membrane lipoprotein, NodT family
           [bacterium Ellin514]
 gi|223892443|gb|EEF58917.1| RND efflux system, outer membrane lipoprotein, NodT family
           [bacterium Ellin514]
          Length = 502

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 115/475 (24%), Positives = 227/475 (47%), Gaps = 34/475 (7%)

Query: 7   IFSLF--IVLLAGCTVGPEYTKPHMPLLPTQFSIGN------SKNLINIDTLKWWESFND 58
           +F+L    ++L GC VGP+Y +P    +P  ++         ++   ++    WWE F D
Sbjct: 16  LFALMGATLVLGGCMVGPDYKRPEATRIPATYAGATNHEWKVAEPRAHLPKGNWWEMFGD 75

Query: 59  TSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYAS---ISHRFIPN---- 111
             LN+L   A   N  +  A  R+  A+      R+ LFP+   S      R  PN    
Sbjct: 76  PELNRLEAEAASANQQLKAAFSRLEEARAITDITRSGLFPNVALSGEYTRQRTSPNQPSV 135

Query: 112 LKTNSTGQ----------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKL 160
           L  N+ G+          L+ ++++DL+G+ RR +ES+ A   +    +   +L + +++
Sbjct: 136 LSGNAIGKPSTFNDFLVPLNLNYEVDLWGRVRRSVESARAQESATADDLGTIQLIIQAEV 195

Query: 161 IPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIP 220
              Y+  R      +I    + +++K+++L+  +   G  S L + + E   ++  + +P
Sbjct: 196 AADYVSLRSLDTEYAIVRSTIGVFRKSLDLTLDRRAGGIVSDLDVAQAETVYRTARAQLP 255

Query: 221 TLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRY 280
            +        H ++ L+G PA+ F   + +++    P +  P   G+P++L+  RPDI  
Sbjct: 256 AIALQRAQFQHALAVLIGKPASSFA--IPERALRATPPVIPP---GLPSELLERRPDIAA 310

Query: 281 QEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYN---THWSFGPKLYLPIFDK 337
            E+++A + A IG+AK+  +P++ LNG   L   N+   +N     WS GP L LPIF+ 
Sbjct: 311 TERRMAAANASIGVAKAAFFPTVRLNGMAGLESVNAGTVFNWSSRFWSVGPSLTLPIFEG 370

Query: 338 GKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSM 397
           G +++N+R  +++  E    +++ VL A ++VE+ L++         +   A++   + +
Sbjct: 371 GALRANLRFTKATYDETVADYRQIVLTAFRDVEDNLSAQTLLASEYEEQAGALQSANRQL 430

Query: 398 SLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            ++   Y  G  + L++   +     +E  +   + Q   + V L  A+G G+ P
Sbjct: 431 EIANDRYHGGLVTYLEVATAQNLVLGLERTVVQLRGQQLVTAVALVQALGGGWQP 485


>gi|326385759|ref|ZP_08207388.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209738|gb|EGD60526.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Novosphingobium nitrogenifigens DSM 19370]
          Length = 478

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 123/459 (26%), Positives = 223/459 (48%), Gaps = 30/459 (6%)

Query: 18  CTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL----------KWWESFNDTSLNKLVKI 67
           C VGP+Y   H        +       ++  T           +WW  + D  L++LV+ 
Sbjct: 23  CAVGPDY---HASRPAPAAAAPFRGAALDTGTGPAFAAAPVEERWWSLYKDPMLDRLVED 79

Query: 68  ALQQNLTILQATERINAAKENILSVRADLFPSSYASIS--HRFIPNLKT---------NS 116
           AL  N  +  A  R++ A+  +    A   P++   +S     +P+++T           
Sbjct: 80  ALAANTDLRVAAARVDRARALLRDAHAAQLPTTGIDVSAQRERVPSIQTIPGLPRERWAY 139

Query: 117 TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERIS 175
            G L   +++DLFG+ RR IE++  +  +A A  D  +L VI+  + +Y D     ER+ 
Sbjct: 140 DGGLSLSYEVDLFGRVRRGIEAARGDAQAAQADADAMRLAVIADTVRAYFDVTTSAERVK 199

Query: 176 IAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIST 235
           +A + + L  ++I ++  +   G + +L L+++ A      + IP+L+      +  ++T
Sbjct: 200 VAEETVALLDRSIRITGARVDVGRSDRLDLIRVTALRDQQAATIPSLKADREAALLRLAT 259

Query: 236 LLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIA 295
           L G    E    +  ++    P+L  PI +G  A L+  RPD+R  E++LA   A+IG+A
Sbjct: 260 LTGRAPQELPADVGTRTET--PHLAQPIPVGDGAALLARRPDVRAAERRLAADTARIGVA 317

Query: 296 KSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQ 352
            SDLYP +SL GS   +   +        + W+ GP +     ++  +++ I  A++ A+
Sbjct: 318 VSDLYPRISLGGSGGFSSLGAMDVLGAGASRWAVGPLISWAFPNQAAVRARIGAAKADAK 377

Query: 353 EQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLL 412
               T+  TVL A++E E AL++    ++ V  L  A +  +++  +S+   R+G+   L
Sbjct: 378 ASLATFDGTVLTALEETERALSAYARAEERVETLARARDEAERAARISLARQREGQIDFL 437

Query: 413 DILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            +LD ER  A  E DL  A+R  A + VD++ A+G G+ 
Sbjct: 438 TVLDAERTLAGAEADLVAARRAGAFAQVDVFRALGGGWQ 476


>gi|16126029|ref|NP_420593.1| efflux system protein [Caulobacter crescentus CB15]
 gi|221234800|ref|YP_002517236.1| outer membrane efflux protein [Caulobacter crescentus NA1000]
 gi|13423215|gb|AAK23761.1| efflux system protein [Caulobacter crescentus CB15]
 gi|220963972|gb|ACL95328.1| outer membrane efflux protein [Caulobacter crescentus NA1000]
          Length = 478

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 128/466 (27%), Positives = 216/466 (46%), Gaps = 32/466 (6%)

Query: 13  VLLAGCTVGPEYTKPHMPLLPTQFS--IGNSKNLINIDTLKWWESFNDTSLNKLVKIALQ 70
            LLAGC VGP+Y  P  P            ++         WW  FND  L++LV  AL 
Sbjct: 16  ALLAGCAVGPDYVAPPAPSADAFMGQPAVAARAAAPAPADAWWRGFNDPVLDRLVDRALA 75

Query: 71  QNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST------------- 117
           QNL + QA  R+  A+  + +  A L PS  ASI  + + N  +  T             
Sbjct: 76  QNLDLAQAAARVTQARAGLGAATAALLPS--ASIQAQGVANHASTQTPTGRLLAATPGFD 133

Query: 118 -------GQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                  G L + W++D+FG  RR  E++LA  D+A A V  A+L V ++   +YI  R 
Sbjct: 134 RDGSLYEGNLVAGWELDVFGGTRRDREAALARYDAAKAGVAAARLAVAAQTADTYILVRG 193

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
            +ER+++A   ++   + ++   L++  GA + L L + +  +    + IP LE+     
Sbjct: 194 LQERLAVARGQVETQARLVDTVRLQYDHGAAADLQLQQAQGALAQTRAGIPVLEEGLEAA 253

Query: 230 VHNISTLLGY-PATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
           ++ +  + G  P T     +   +    P L      G PA L+R RPD+   E++L  S
Sbjct: 254 LNAMDVIQGAQPGTYRAELVTTTAIPVAPGL---TEAGGPAGLLRRRPDLVVAEQRLRAS 310

Query: 289 VAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
            A++G A S  +P +SL+G +     +S   F G  T       L   +FD G++ + ++
Sbjct: 311 NAEVGSALSQYFPKVSLSGLVGTATTSSATLFEGSATQAQGVLGLRWRLFDFGRVGAEVK 370

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
            A     E    +Q+ VL A ++VENA  S+ + +     L        K+ + S + Y 
Sbjct: 371 AARGRKAEALAAYQQAVLRASEDVENAFVSLVKREVQARALSGGEASLAKARTASQVAYE 430

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            G  SL+++LD +     V    + A+ + A++ +  + A+G G++
Sbjct: 431 AGAVSLVEVLDADARLLAVRDARAQARTEAARAAIRSFQALGGGWS 476


>gi|227112235|ref|ZP_03825891.1| putative outer membrane efflux lipoprotein [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 505

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 131/486 (26%), Positives = 232/486 (47%), Gaps = 50/486 (10%)

Query: 14  LLAGCTVGPEYTKPHMPLL------------PTQFSIGNS----KNLINIDTLK------ 51
           L+AGC VGP+Y +P  PL               Q S+  S     +L+  ++        
Sbjct: 15  LMAGCAVGPDYHRPDAPLADRYQVQSAAQRSSAQPSVAKSPLAEPSLVEQESAAQVANLA 74

Query: 52  -WWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS---------SY 101
            WWESFND  L++LV  AL QNL + QA+ R++ A+  + +  A L PS         +Y
Sbjct: 75  VWWESFNDPLLSQLVSRALAQNLDLAQASARMSQARAGLGAATAALLPSGNISGQGTRAY 134

Query: 102 ASISH------RFIPNLKTNST---GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDI 151
            SI          +P            L++ W++D+FG  RR  +++LA+  ++ A V  
Sbjct: 135 QSIETPQGQLLNSVPGYSRYGNAYEADLNASWELDVFGGLRRGRQAALADYQASEAGVAA 194

Query: 152 AKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAE 211
             L V ++    YI  R  + R++IA+  +   ++ ++   L  ++G  ++  + + E  
Sbjct: 195 THLAVAAQTADIYITLRGLQTRLAIANSQVKTQQELLDKVQLLHSKGLAAEYQVRQTEGA 254

Query: 212 IKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADL 271
           +  +++ +P L+      ++ +  +LG P     H  Q  ++   P     I  G PADL
Sbjct: 255 LSQVQATVPALQTGIDAAMNALDVMLGTP--PGTHRAQLSTSQAIPQPPALIATGTPADL 312

Query: 272 IRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNG----SIALTHDNSFPGYNTHWSFG 327
           +R RPDI   E+ LA S A+IG+A S+ YP  SL+     + +++  N F    +  +  
Sbjct: 313 LRRRPDIIVAERHLAASNARIGVAISEYYPKFSLSALLGSATSVSSGNLFSNGASQSAGV 372

Query: 328 PKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTS-INEDKKIVTKL 386
             L   +FD G+I + I +A+    E    ++ +VL A ++VENA ++ +N + +  T  
Sbjct: 373 LGLRWRLFDFGRINAQIDQAKGQEAEALAAYRLSVLRATEDVENAFSALVNRETQSATLA 432

Query: 387 QHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAI 446
                L     S S I Y++G  SL+++L  +    +     + A+ + A++ V  + A+
Sbjct: 433 AGETALASARQS-SFIAYQKGTSSLIEVLHADETLLQTSDARAQAQTESARAAVATFKAL 491

Query: 447 GSGYNP 452
           G G+ P
Sbjct: 492 GGGWQP 497


>gi|218259564|ref|ZP_03475264.1| hypothetical protein PRABACTJOHN_00923 [Parabacteroides johnsonii
           DSM 18315]
 gi|218225009|gb|EEC97659.1| hypothetical protein PRABACTJOHN_00923 [Parabacteroides johnsonii
           DSM 18315]
          Length = 456

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 119/461 (25%), Positives = 230/461 (49%), Gaps = 30/461 (6%)

Query: 10  LFIVL-----LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKL 64
           +F+VL     L+ C +G +Y +P + L P +   G   +  +ID++ W   + DT+L +L
Sbjct: 7   VFMVLSLTLALSSCKIGKKYARPELDL-PEEIVAG--ADTASIDSIPWQSLYADTTLQRL 63

Query: 65  VKIALQQNLTILQATERINAAKENILSVR---ADLFPSSYASI---SHRF-----IPNLK 113
           + IAL  N  +  A  +I   KE I + R   A+ FP   A I     R       P   
Sbjct: 64  ITIALDNNKDMKIAAAKI---KEMIATKRITFAEQFPEIGARIYGQKERLNYGGDDPKPD 120

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                +L   W++DL+G  R   E+ +A    +       ++ +++++  +Y +     +
Sbjct: 121 PEYGAKLTLSWELDLWGNLRWANEAGIAAYLQSVEARRALQMTLVAEVAAAYYELCALDQ 180

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
             +I    L   ++ + L+ L+F  G TS+ S  + + E+   E+ +P+LE+  ++  ++
Sbjct: 181 EQAIVRHTLAARREGVRLAKLRFEGGLTSETSYSQAQVELARTETLLPSLEQKIKIKEND 240

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +S LLG  + +    +  +  +    L     +G+P+ L+  RPD+R  E+KL ++ A++
Sbjct: 241 LSFLLGQYSGDVPRGLSLREQHLPATL----PVGLPSSLLERRPDMRQAEQKLREANARV 296

Query: 293 GIAKSDLYPSLSLNGSIALTHD--NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESS 350
           G+A++DL+P +SL G++   ++   +F   +  W     L  P+F  GK K+ ++ A + 
Sbjct: 297 GVAQTDLFPKISLTGNLGFENEELTNFIK-SPAWFLAGDLLQPLFAMGKNKAKLKAARAR 355

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
            +++   +Q++VL A KEV NA+ +I + K++    +  +      + L+ + Y  G  S
Sbjct: 356 YEQEVYNYQKSVLGAFKEVGNAIITIRKAKEVRLSYERLLNAADTYLQLAQLQYINGVTS 415

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            +D+LD +R     ++ L+ A      S V LY A+G G+ 
Sbjct: 416 YMDVLDAQRGLLDAQLSLNKAMLDELLSTVYLYKALGGGWE 456


>gi|213967019|ref|ZP_03395169.1| outer membrane efflux protein [Pseudomonas syringae pv. tomato T1]
 gi|301385204|ref|ZP_07233622.1| outer membrane efflux protein [Pseudomonas syringae pv. tomato
           Max13]
 gi|302062772|ref|ZP_07254313.1| outer membrane efflux protein [Pseudomonas syringae pv. tomato K40]
 gi|302130145|ref|ZP_07256135.1| outer membrane efflux protein [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213928341|gb|EEB61886.1| outer membrane efflux protein [Pseudomonas syringae pv. tomato T1]
          Length = 490

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 121/471 (25%), Positives = 223/471 (47%), Gaps = 44/471 (9%)

Query: 12  IVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK---WWESFNDTSLNKLVKIA 68
           I LL+ C VGP+Y KP         +    +     D +    WWE++ D  LN LV   
Sbjct: 24  IALLSACAVGPDYQKPSSAAPAQFKAAAGWRAATPSDAMAKGAWWEAYGDAQLNTLVARL 83

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPS----------------SYASISHRFIPNL 112
              N T+ Q   +   A+  + S R   FP+                S +  S+     +
Sbjct: 84  NTSNQTVAQYDAQYRQAQALVRSSRGAFFPTLDLTTGKTRSGQGAGTSSSGTSNTSASGI 143

Query: 113 KTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
           + +   QL   W+ D++G+ RR +E+  AN  ++ A +   +L++ S+L+ +Y+  R   
Sbjct: 144 RNSYNAQLGVSWEADVWGKLRRGLEADTANAQASLADLAAMRLSLQSELVQNYMQLRVID 203

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
           E+  +    +D Y++++ L+  ++  G     ++ + + ++KS ++D+  L        +
Sbjct: 204 EQKRLLESTVDAYQRSLTLTRNQYRAGIAGTDAVAQAQTQLKSTQADLIDLVWQRAQFEN 263

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIP----INIGIPADLIRNRPDIRYQEKKLAD 287
            I+ L+G    +F         N  P   IP    I  G+P+ L+  RPDI   E+ +  
Sbjct: 264 AIAVLMGVAPADF---------NLPPTTTIPQLPQIPPGVPSQLLERRPDIAAAERSVMG 314

Query: 288 SVAKIGIAKSDLYP--SLSLNGSIALTHDNSFPGY----NTHWSFGPKLYLPIFDKGKIK 341
           + A IG+AK+  YP  +LS++G     + ++F  +    N  WS GP+L L +FD G+  
Sbjct: 315 ANANIGVAKAAYYPDFTLSMSGGY---NSSTFANWISLPNRFWSVGPQLALTLFDGGRRS 371

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           + + R E+   +    +++TVLN  +EVEN L  +   ++     Q A+   + S+ L+ 
Sbjct: 372 AEVDRTEALYDQTVAQYRQTVLNGFQEVENYLIQLKVYEEEAAVRQEALVAARDSLRLTN 431

Query: 402 INYRQGRYSLLDILDIE-RATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             Y+ G    LD+++++  A +     L++ + +L  S V L  A+G G+N
Sbjct: 432 NQYKAGLIGYLDVVNVQATALSNERTVLNVLQSRLIAS-VQLIAALGGGWN 481


>gi|240118416|ref|ZP_04732478.1| MtrE [Neisseria gonorrhoeae PID1]
 gi|268604132|ref|ZP_06138299.1| outer membrane lipoprotein [Neisseria gonorrhoeae PID1]
 gi|268588263|gb|EEZ52939.1| outer membrane lipoprotein [Neisseria gonorrhoeae PID1]
          Length = 467

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 121/445 (27%), Positives = 218/445 (48%), Gaps = 14/445 (3%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F    S + I    L W + F D  L KL+ IAL++N +
Sbjct: 18  LSACTMIPQYEQPKVEVAET-FQNDTSVSSIRAVDLGWHDYFADPRLQKLIDIALERNTS 76

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST------GQLDSDWKIDL 128
           +  A       ++  +  R +L P+  A+ +     +L   +       G   + +++DL
Sbjct: 77  LRTAVLNSEIYRKQYMIERNNLLPTLAANANGSRQGSLSGGNVSSSYNVGLGAASYELDL 136

Query: 129 FGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKN 187
           FG+ R   E++L    ++ A  D A L++I+ +  +Y + R+ +E +S+A ++L   ++ 
Sbjct: 137 FGRVRSSSEAALQGYFASVANRDAAHLSLIATVAKAYFNERYAEEAMSLAQRVLKTREET 196

Query: 188 IELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHY 247
            +LS L++  G  S ++L + EA I+S ++D     +S     + ++TL+  P  E L  
Sbjct: 197 YKLSELRYKAGVISAVALRQQEALIESAKADYAHAARSREQARNALATLINRPIPEDLPA 256

Query: 248 MQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNG 307
                  F       +  G+ ++++ +RPDIR  E  L  + A IG A++  +PS+ L G
Sbjct: 257 GLPLDKQF---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAFFPSIRLTG 313

Query: 308 SIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLN 364
           S+          F      W+F P + LPIF  G  K+N+  A+   Q Q + ++  V +
Sbjct: 314 SVGTGSVELGGLFKSGTGVWAFAPSITLPIFTWGTNKANLDVAKLRQQAQIVAYESAVQS 373

Query: 365 AIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKV 424
           A ++V NAL +  +  K    L       K+++ L  + Y+ G    LD+LD ER++   
Sbjct: 374 AFQDVANALAAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGALDLLDAERSSYSA 433

Query: 425 EVDLSIAKRQLAKSYVDLYIAIGSG 449
           E     A+   A++  DLY  +G G
Sbjct: 434 EGAALSAQLTRAENLADLYKVLGGG 458


>gi|311108510|ref|YP_003981363.1| efflux transporter outer membrane factor lipoprotein 8
           [Achromobacter xylosoxidans A8]
 gi|310763199|gb|ADP18648.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           protein 8 [Achromobacter xylosoxidans A8]
          Length = 488

 Score =  167 bits (422), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 124/478 (25%), Positives = 234/478 (48%), Gaps = 33/478 (6%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK-----WWESF 56
           +++ A  +  +  LAGC VGP++  P  P LP Q+ + N     ++   +     WW+SF
Sbjct: 5   HLIHATLACTLSALAGCAVGPDFKAPQ-PQLPAQWRMANESAAGSVPVPQEVNRSWWDSF 63

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK--- 113
            D++L  L+  A   NL I  A ER+  ++  +    AD  P   A  S++   N +   
Sbjct: 64  GDSTLTTLIAEATGANLDIRIAHERLLQSRAALRVTEADGLPGIGAGASYKRGQNSEVGL 123

Query: 114 TNSTGQ------------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKL 160
            + +G+            +D+ W++DL+G+ RR +E + A  ++A        L + ++ 
Sbjct: 124 ADPSGRGGKSSFNLWQAGMDASWELDLWGRVRREVEQAGAQSEAALEAQRGVVLAIRAET 183

Query: 161 IPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIP 220
             +YI  R  + ++ +  + L   + N+ L+ L+  +G  ++L + + +A+  +IE+ +P
Sbjct: 184 ARNYILLRGAQNQLDVLRKTLANAEHNLALTRLRQREGVATELDVSQADAQTAAIEARVP 243

Query: 221 TLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRY 280
            L       ++ ++ LL  P       +          L +P+  G+P++L   RPDIR 
Sbjct: 244 PLALRIDQLMNALALLLEQPPGTLQERLAAIGPIPGGPLQVPV--GLPSELAGRRPDIRR 301

Query: 281 QEKKLADSVAKIGIAKSDLYPSLSLNGSIALTH------DNSFPGYNTHWSFGPKLYLPI 334
            +  L  +VA +G+A+ D YP ++L+G++ L        D    G    +  GP L +PI
Sbjct: 302 AQANLHAAVAAVGVAEGDFYPRITLSGNLGLQALQLRDLDTDNAGI---FGVGPALQIPI 358

Query: 335 FDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHK 394
           F  G+++  +R  ES AQE  + +Q+TVLNA  EV+NA+T+    +     L+ A E  +
Sbjct: 359 FQGGRLRGRLRLRESQAQEAALLYQKTVLNAWHEVDNAMTAYQAQQLTRASLERASESAR 418

Query: 395 KSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           +++  +   Y  G    +++L  + A    + +    +  ++   VDLY ++G G+ P
Sbjct: 419 QALLNAQRQYAAGASDFVNVLSAQNAVLASDQERVSTQAAVSLVLVDLYRSLGGGWEP 476


>gi|187478307|ref|YP_786331.1| outer membrane efflux protein [Bordetella avium 197N]
 gi|115422893|emb|CAJ49421.1| outer membrane efflux protein [Bordetella avium 197N]
          Length = 472

 Score =  167 bits (422), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 123/459 (26%), Positives = 216/459 (47%), Gaps = 23/459 (5%)

Query: 8   FSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVK 66
           F+L   LL+GC ++ P+Y +  +P+ P  F+   + +   +  L W   + D  L  L++
Sbjct: 8   FALAAGLLSGCLSLAPKYERGPLPV-PASFAHSTADS-TPVAALAWPSFYTDPQLRSLIE 65

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFPS-----------SYASISHRFIPNLKTN 115
            +L  N  +  A  R+  A+      RAD FP+           + A +S    P + + 
Sbjct: 66  RSLANNRDLRLAVLRVAEARAAFGIQRADQFPTLGLTAEGGRQRTPADLSITGQPMVASQ 125

Query: 116 -STGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
              G   + W++D +G+ R + +++L N  +  A    A L++IS++  +Y+  R   ER
Sbjct: 126 YQVGVGLASWELDFWGRVRDLKDAALENYLATDAARQAATLSLISQVADAYLSLRALDER 185

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
           +++    +     ++ +   +F  GATSKL L ++E   +        LE++       +
Sbjct: 186 LALTRATIASRAASLHIFQRRFEVGATSKLDLTQVETLWQQATVLGAELEQTRAAQAQVL 245

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
             L+G P    L   Q +    +  L   +  G+P+DL+ NRPDI   E  L    A IG
Sbjct: 246 QQLVGEP----LDLPQARGGLNEVTLMHELPPGLPSDLLSNRPDIVAAEHTLKAGNANIG 301

Query: 294 IAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESS 350
            A++  +P ++L G         D  F G +  W F P L LPIFD G+ ++N+  A + 
Sbjct: 302 AARAAFFPRITLTGLFGTASNELDGLFGGGSRAWQFVPNLNLPIFDAGRREANLDLARAR 361

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
            Q+    +++T+  A +EV +AL++ +   + V  L   V+   +   L+ + Y  G   
Sbjct: 362 QQQALAQYEKTIQTAFREVADALSARHWLTEQVDVLAATVQAQAERKRLAQLRYDHGASP 421

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
            L++LD ERA  + +      +R L  S V LY A+G G
Sbjct: 422 FLEVLDAERALLEAQQQWVRTRRALLASQVALYAALGGG 460


>gi|255065770|ref|ZP_05317625.1| multiple transferable resistance system protein MtrE [Neisseria
           sicca ATCC 29256]
 gi|255050088|gb|EET45552.1| multiple transferable resistance system protein MtrE [Neisseria
           sicca ATCC 29256]
          Length = 472

 Score =  167 bits (422), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 122/447 (27%), Positives = 216/447 (48%), Gaps = 14/447 (3%)

Query: 13  VLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQN 72
           V L+ CT+ P+Y +P + +  T F      + I    L W + F D  L++L+ IAL++N
Sbjct: 17  VALSACTMIPKYEQPQVEVAET-FKYDTFDDGIRAADLGWQDFFADPRLHRLIDIALERN 75

Query: 73  LTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTN------STGQLDSDWKI 126
             +  A       ++  +  R DL PS  AS +     +L         S G   + +++
Sbjct: 76  TDLRTAALNAEIYRKQYMIARNDLLPSINASGTGTRTGSLSGGVTRSEYSVGLGAAAYEL 135

Query: 127 DLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYK 185
           DLFG+ R + +++L    S  A  D A L +I+ +  ++ +  + +E +++A ++L   +
Sbjct: 136 DLFGRVRSNSQAALQGYFSVAANRDAAHLALIAAVAKAHFNELYAQESMALAQRVLKTRE 195

Query: 186 KNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFL 245
              +LS ++   G  S + L + EA I+S ++D     K+     + ++TL+  P  E L
Sbjct: 196 ATYKLSQMRHKAGVISAVDLRQQEALIESAKADYANAVKNREQARNALATLINQPLPEDL 255

Query: 246 HYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSL 305
                 S  F+      +  G+ ++++ NRPDIR  E  L  + A IG A++  +P++SL
Sbjct: 256 PAALPLSKQFK---ITRLPAGLSSEVLLNRPDIRAAEHSLKQANANIGAARAAFFPTISL 312

Query: 306 NGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETV 362
            GS+          F      WSF P + LPIF+ G  K+N+  A+   + Q + ++  V
Sbjct: 313 TGSVGTASGELSGLFKSGTGIWSFAPSITLPIFNWGTNKANLDVAKLRKEAQIVAYEAAV 372

Query: 363 LNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATA 422
             A ++V NAL +  +  K    L      +  S+ L  + Y+ G  + LD+LD ER++ 
Sbjct: 373 QAAFQDVSNALVAREQLDKSYAALNKQSRAYNDSLRLINLRYKHGVSNALDLLDAERSSY 432

Query: 423 KVEVDLSIAKRQLAKSYVDLYIAIGSG 449
             E  L   +    ++  DLY A+G G
Sbjct: 433 GAETALLANQLTRLENLADLYKALGGG 459


>gi|21245018|ref|NP_644600.1| outer membrane efflux protein [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|21110745|gb|AAM39136.1| outer membrane efflux protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 486

 Score =  167 bits (422), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 130/481 (27%), Positives = 229/481 (47%), Gaps = 41/481 (8%)

Query: 2   NILR--AIFSLFIVLLAGCTVGPEYTKP-----HMPLLPTQF-SIGNSKNLINID-TLKW 52
            ILR   + +L  +L A  TVGP Y  P       P     F   GN++         +W
Sbjct: 4   TILRPLGVAALLSMLTACSTVGPNYAVPAESAYRRPAANAAFLDTGNAQVQPGAALPARW 63

Query: 53  WESFNDTSLNKLVKIALQQNLTILQAT---ERINAAKENILSV------------RADLF 97
           W  + D  L+ L++ AL+ N+ +  A     R  A  E  +              RA + 
Sbjct: 64  WALYQDPMLDGLIEQALRDNIELKVAGANLRRAAAVYEQAMDAGGFDYEVEAGVSRAQV- 122

Query: 98  PSSYASISHRFIP--NLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKL 154
            S+ A +    +P  NL   + G+    ++ DLFG+ +R  E++ A+   A A +D+A++
Sbjct: 123 -SAEAFLQEEKLPVFNL---ADGKFGVSYQFDLFGKLQRGAEAAHADTQVAQAAIDLARV 178

Query: 155 NVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKS 214
           +V +++  SY++  H    + +A   L L + + +++      G  +   L +  A++  
Sbjct: 179 SVAAQVAGSYVEICHANHELQVAEHSLQLQQHSRQITQRLIAAGRGTPPDLARATAQVAM 238

Query: 215 IESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRN 274
           +E+ +P L    +   + ++ LLG    E    +   S    P L  PI IG    L+  
Sbjct: 239 LEASLPPLRARRQAAGYQLAALLGKTPGEVPAGVD--SCAHAPALQQPIPIGDGRALLAR 296

Query: 275 RPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTH-WSFGPKL 330
           RPD+R  E++LA + A+IG+A ++LYP + L GSI  T    D   P   TH WSFGP +
Sbjct: 297 RPDVRQAERRLAAATARIGVATAELYPDIRLGGSIGATGLLADFGEPA--THAWSFGPLI 354

Query: 331 YLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAV 390
              +   G  ++ +R  E+ A      +  TVL A++EV+  L+   +D   +  L+ A 
Sbjct: 355 SWTLPSSGA-RARVRATEAGADAALAQFDNTVLQALREVQTTLSRYAQDLDRLHLLEQAQ 413

Query: 391 ELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +  + + + +   Y+ GR   L  LD ER  A  ++ L+ A+ Q+++  + L++A+G G+
Sbjct: 414 QQAELASAQNRRLYQGGRTPYLSSLDAERTLATADMTLATAQAQVSQDQIQLFLALGGGW 473

Query: 451 N 451
           +
Sbjct: 474 D 474


>gi|295689433|ref|YP_003593126.1| NodT family RND efflux system outer membrane lipoprotein
           [Caulobacter segnis ATCC 21756]
 gi|295431336|gb|ADG10508.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Caulobacter segnis ATCC 21756]
          Length = 478

 Score =  167 bits (422), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 135/468 (28%), Positives = 224/468 (47%), Gaps = 36/468 (7%)

Query: 13  VLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK----WWESFNDTSLNKLVKIA 68
            LL+GC +GP+Y  P  P       +G       I T      WW  FND  L++LV  A
Sbjct: 16  TLLSGCAIGPDYVAPPAP--KAGAFMGQPAIAARIATPAPAETWWRGFNDPVLDRLVGRA 73

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPSS---------YASI---SHRFI---PNLK 113
           L QNL + QAT R+  A+  + +  A L PS+         +AS    + R +   P   
Sbjct: 74  LAQNLDLAQATARVTQARAGLGAATAALLPSASIQGQAATVHASTQTPTGRLLSATPGFD 133

Query: 114 TNST---GQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
            + +   G L + W++D+FG  RR  E++LA  D+A A V  A+L V ++   +Y+  R 
Sbjct: 134 RDGSSYEGNLVAGWELDVFGGARRDREAALARYDAAEAGVAAARLTVAAQTADTYMLVRG 193

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
            +ER++IA +  +   + +E   L + +GA + L L + +  +    + IP LE      
Sbjct: 194 LQERLAIARRQAETQSRLVETVRLLYERGAAADLQLRQAQGGLAQTLASIPVLETGLEAA 253

Query: 230 VHNISTLLGY-PATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
           ++ +  + G  P T     +   +    P L    + G PA+L+R RPD+   E++L  S
Sbjct: 254 LNAMDVIQGAQPGTYRAELVTPSAIPAAPGL---ADAGGPAELLRRRPDLIVAEQRLRAS 310

Query: 289 VAKIGIAKSDLYPSLSLNGSIA---LTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
            A++G A S  +P LSL+G +     + D  F G  T       L   +FD G++ + ++
Sbjct: 311 NAEVGSALSQYFPKLSLSGLVGTATTSRDTLFEGPATQAQGVLGLRWRLFDFGRVNAEVK 370

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSI--NEDKKIVTKLQHAVELHKKSMSLSMIN 403
            A+    E    +Q+ VL A ++VENA  S+   ED+  V  L        K+ + S   
Sbjct: 371 AAKGRKAEALAAYQQAVLRASEDVENAFVSLVKREDQSRV--LSDGETSLAKARAASQAA 428

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           Y  G  SL+++LD +     V    + AK + A++ +  + A+G G++
Sbjct: 429 YEAGAVSLVEVLDADARLLAVRDARAQAKTEAARAAIRSFQALGGGWS 476


>gi|261399980|ref|ZP_05986105.1| multiple transferable resistance system protein MtrE [Neisseria
           lactamica ATCC 23970]
 gi|269210443|gb|EEZ76898.1| multiple transferable resistance system protein MtrE [Neisseria
           lactamica ATCC 23970]
          Length = 467

 Score =  167 bits (422), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 122/453 (26%), Positives = 216/453 (47%), Gaps = 30/453 (6%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F    + + I    L W + F D  L KL+ IAL++N +
Sbjct: 18  LSACTMIPQYGQPKVEVAET-FKNDTADSGIRAVDLGWHDYFADPRLQKLIDIALERNTS 76

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLD------------- 121
           +  A       ++  +  R +L P+           N   +  G LD             
Sbjct: 77  LRTAVLNSEIYRKQYMIERNNLLPT--------LAANANGSRQGSLDGGNVSSSYNVGLG 128

Query: 122 -SDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQ 179
            + +++DLFG+ R   E++L    ++ A  D A L++I+ +  +Y + R+ +E +S+A +
Sbjct: 129 AASYELDLFGRVRSSSEAALQGYFASTANRDAAHLSLIATVAKAYFNERYAEEAMSLAQR 188

Query: 180 ILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGY 239
           +L   +   +LS L++  G  S ++L + EA I+S ++D     +S     + ++TL+  
Sbjct: 189 VLKTREATYKLSELRYKAGVISAVALRQQEALIESAKADYAHAVRSREQARNALATLINQ 248

Query: 240 PATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDL 299
           P  + L         F       +  G+ ++++ +RPDIR  E  L  + A IG A++  
Sbjct: 249 PIPDDLPAGLPLDKQF---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAF 305

Query: 300 YPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYI 356
           +PS+ L GS+          F      WSF P + LPIF  G  K+N+  A+   Q Q +
Sbjct: 306 FPSIRLTGSVGTGSAELGGLFKSGTGVWSFAPSITLPIFTWGTNKANLDAAKLRQQAQIV 365

Query: 357 TWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILD 416
            ++  V +A ++V NAL +  +  K    L       K+++ L  + Y+ G    LD+LD
Sbjct: 366 AYEAAVQSAFQDVANALAAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGALDLLD 425

Query: 417 IERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
            ER++   E     A+   A++  DLY A+G G
Sbjct: 426 AERSSYSAEGAALSAQLTRAENLADLYKALGGG 458


>gi|212704780|ref|ZP_03312908.1| hypothetical protein DESPIG_02844 [Desulfovibrio piger ATCC 29098]
 gi|212671742|gb|EEB32225.1| hypothetical protein DESPIG_02844 [Desulfovibrio piger ATCC 29098]
          Length = 511

 Score =  167 bits (422), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 117/471 (24%), Positives = 227/471 (48%), Gaps = 30/471 (6%)

Query: 3   ILRAIFSLFIVL-LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
           +L+A  +L + L + GC++ P+Y +P   +     S+    + +N D   WW  FND  L
Sbjct: 4   LLKAGLTLVLCLAVTGCSLAPDYKRPEQDIPKEWRSVDLGPSPLNTD---WWTRFNDPVL 60

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST---- 117
           N LV+ AL+ N  + ++  +I++A   +    + L PS    +S       ++NST    
Sbjct: 61  NALVEEALKNNQDLAESLAKIDSAAAKLGVGTSQLAPS----VSGAGAATSQSNSTKIAN 116

Query: 118 -------------GQLDSDWKIDLFGQRRHIESSLAN-LDSAYAQVDIAKLNVISKLIPS 163
                        GQL + W++D +G+ R+  + L++ L +     +  +L+V S+   S
Sbjct: 117 YNDVADRSYVNYQGQLSASWELDFWGKYRNNYTMLSDVLLNTVVSHEALRLSVASQTAQS 176

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y        +++ A + L   +    +   ++ QG  ++L   +  AE+++  S + +  
Sbjct: 177 YFALLALDMQLATAKRTLRTREDAFGIYTSRYRQGDITELDWQRARAEVETARSQVHSST 236

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPI-NIGIPADLIRNRPDIRYQE 282
            +      +++ LLG    + +  +  +  +       P+   G+P++L+  RPD+R  E
Sbjct: 237 VAVDSAEASLAVLLGRSPRDIMSAVMPRGGDISKLPAPPVLPAGLPSELLERRPDVRAAE 296

Query: 283 KKLADSVAKIGIAKSDLYPSLSLNG---SIALTHDNSFPGYNTHWSFGPKLYLPIFDKGK 339
             +    A IG+A+++ +PS+SL G   +++ +  N F G    WS+G    +P+ D G+
Sbjct: 297 YMIMAYNANIGVARAEFFPSISLTGMLGTLSASVVNLFSGPAGAWSYGVTGSMPLLDFGR 356

Query: 340 IKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSL 399
              N++ AE+  +     +++TV NA K+V  +LTS  E   IV   Q  V+  +++  +
Sbjct: 357 TWYNVKDAEAQKEAAIAVYRKTVQNAFKDVRTSLTSQREADAIVAASQAQVDSLRRAAEI 416

Query: 400 SMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           + + Y  G    L +LD ER     E+ L+ A R    + V + +A+G G+
Sbjct: 417 ARLQYDNGYTDYLTVLDAERQLFSAELSLANALRDRLNAVVSVCMALGGGW 467


>gi|226940349|ref|YP_002795423.1| RND efflux system, outer membrane lipoprotein, NodT family
           precursor [Laribacter hongkongensis HLHK9]
 gi|226715276|gb|ACO74414.1| RND efflux system, outer membrane lipoprotein, NodT family
           precursor [Laribacter hongkongensis HLHK9]
          Length = 467

 Score =  167 bits (422), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 118/450 (26%), Positives = 217/450 (48%), Gaps = 22/450 (4%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGN-SKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTI 75
           GC VGP+Y +P + + P+ F       +   +DT +WW+ F D  L+  V  AL+ N  +
Sbjct: 16  GCAVGPDYRRPAVDV-PSGFRFQQPDASDAALDT-EWWKDFGDPVLDGYVSEALEHNRNL 73

Query: 76  LQATERINAAKENILSVRADLFPS--------SYASISHRFIPNLKTNSTGQL--DSDWK 125
             A   ++AA   +   RA LFP+           S S + +P  + +++ +L   + W+
Sbjct: 74  AIAVANVDAAAAQLTIARASLFPTLDYQASASRGRSSSQQLLPGSQASNSFELLGSTSWQ 133

Query: 126 IDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLY 184
           IDL+G  RR  E++ A L ++       +L+V+S  +  Y+  R   ++++IA +  + Y
Sbjct: 134 IDLWGALRRQTEAAQALLKASEQARRGVRLSVVSSTVQGYLQLRGLDQQLAIARRTANSY 193

Query: 185 KKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEF 244
              ++L  L++  GA ++++L ++ ++ +S  + IP +E S     + +S LLG      
Sbjct: 194 ADTVKLFELQYQYGAIARITLEQVRSQYQSALASIPPIEASIVQTENALSLLLGRNPGPV 253

Query: 245 LHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLS 304
           +                P+   +P+ L+  RPDI   E +L  + AKIG+A++  +P L+
Sbjct: 254 VR-----GKPLAELRLPPVPGALPSSLLTRRPDILEAEARLVSANAKIGVARAQYFPQLT 308

Query: 305 LN---GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQET 361
           LN   GS+A    +        WS    L   +F  G     +R AE+S +    T+ +T
Sbjct: 309 LNAGIGSLATRTGSLLTAGAGIWSVAGALAGSVFSGGATVGAVRSAEASTRAAEQTYLQT 368

Query: 362 VLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERAT 421
           +  A  +VENAL+      + +  L+      ++   L+M+ Y+ G  + L +LD  R  
Sbjct: 369 IQQAFADVENALSGWQTSSQRLKSLEDLQASSREYADLAMLQYQGGIANYLTVLDARRQL 428

Query: 422 AKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
              E+D + A+     + V +Y+A+G  + 
Sbjct: 429 YSAEIDAASARTGYLSNAVAVYLALGGDWG 458


>gi|254248759|ref|ZP_04942079.1| Outer membrane protein [Burkholderia cenocepacia PC184]
 gi|124875260|gb|EAY65250.1| Outer membrane protein [Burkholderia cenocepacia PC184]
          Length = 495

 Score =  167 bits (422), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 123/479 (25%), Positives = 223/479 (46%), Gaps = 46/479 (9%)

Query: 13  VLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL-----KWWESFNDTSLNKLVKI 67
            LLAGCTVGP+Y     P  P   +   +     +DT       WW + ND  L+ L+  
Sbjct: 19  CLLAGCTVGPDYRG--APAAPDASTFVRAPA-TGVDTALPAPSAWWHALNDRQLDALIVA 75

Query: 68  AL---------------------QQNLTILQATERINAA---KENILSVRADLFPSSYAS 103
           AL                     QQ    +  +    AA   +E  +S    L PS+ + 
Sbjct: 76  ALVYNPDLHAAQARLRAARAQLSQQRAAQMPKSSATVAAIRMREPDVSALGSLLPSNGSE 135

Query: 104 ISHRFIPNLKTNSTGQL-----DSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVI 157
            S    P+L  +   QL     D+ W+IDLFG  RR +E++ A  ++  A +   ++++ 
Sbjct: 136 QSGGTSPSLGGSGPLQLYSAGFDATWEIDLFGGTRRAVEAASAQAEAVDADLADTQVSIA 195

Query: 158 SKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIES 217
           +++  +Y+D R  ++R++++ +   L ++ +EL+  +  +G  +   + +L  ++++  +
Sbjct: 196 AEVANAYVDLRDQQQRLALSKRTAQLQQQMLELTQQRRARGVAADADIERLTTQVENTRA 255

Query: 218 DIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPD 277
            +  L+     ++  ++ L G  A   L       +   P L   + IG PA L++ RPD
Sbjct: 256 SLIPLDAQVTESLDRLAILTGR-APGALDAALSTPDAALPTLPASVAIGDPATLLKQRPD 314

Query: 278 IRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGY-----NTHWSFGPKLYL 332
           IR  E++LA S A+IG   +D +P ++L G +  +  +  PG+     N  W   P L  
Sbjct: 315 IRAAERRLASSNAQIGEHVADYFPKVTLLGDLGFSATD--PGHLFRKQNFTWVGAPYLQW 372

Query: 333 PIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVEL 392
            I D G+ +  +R AE+S  E    +Q+ VL A+++   AL      ++ V  L      
Sbjct: 373 NILDFGRTRGAVRAAEASRDEAEANYQKAVLGALQDANTALQRYGHQREHVVALTKVQTS 432

Query: 393 HKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
              S +L    YR G  S++D+LD +R     + ++   + +L K+YV +  ++G G+ 
Sbjct: 433 AVHSRALMDQRYRAGVASMIDLLDTQREALAAQQNVIAGQAELIKNYVSVQKSLGLGWQ 491


>gi|190575811|ref|YP_001973656.1| putative outer membrane efflux protein [Stenotrophomonas
           maltophilia K279a]
 gi|190013733|emb|CAQ47368.1| putative outer membrane efflux protein [Stenotrophomonas
           maltophilia K279a]
          Length = 470

 Score =  167 bits (422), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 120/468 (25%), Positives = 219/468 (46%), Gaps = 27/468 (5%)

Query: 7   IFSLFIVL-----LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
           +F  F+       LA CT+GP++ +P   L     S   + N I+ D   WW  F+D  L
Sbjct: 6   VFRTFVAASLCTALAACTMGPDFVRPQAELPSHWQSEAVAGNAIDQDA-AWWAGFDDPLL 64

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKT---NSTG 118
            +L    L  NL +  A  R+  ++       AD  PS  AS S     N +    + +G
Sbjct: 65  GQLANQVLAANLDLQLAANRVQQSRAARGITAADRLPSVSASASGVRARNSEVGLNDPSG 124

Query: 119 QLDSD------------WKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
               D            W++DL+G+ RR +E++ A +  A       ++ ++++    Y+
Sbjct: 125 NGGRDDYGLFQAGIGLSWELDLWGRVRRQVEAADARVQMAEEDAHAVRIALLAETARDYL 184

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
             R  ++ ++I    L +      L+  +  QG  S L +    A++ S+++ I  L   
Sbjct: 185 QLRATRQLLAITEDNLSIAHDIKRLTEARQRQGVASTLQVSSAAAQVASLQARIAPLRHR 244

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
                + ++ LL  P       +Q    ++ P L   + +G+P++L   RPDIR  E  L
Sbjct: 245 ESQLRNALAFLLAQPPQALDAQLQDARRDW-PALP-AVAVGLPSELAERRPDIRRAEAAL 302

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHD--NSFPGYNTH-WSFGPKLYLPIFDKGKIKS 342
             + A IG+AK+   P ++LNG         +   G+N H +S GP + LPIF  G++K+
Sbjct: 303 HAATAGIGVAKASFLPRITLNGDAGFQAKQLDDLDGWNAHRFSIGPSISLPIFQGGRLKA 362

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
           N+  +    Q+  + ++ TVL A  EV++A+   + +++   +L  AV+  + ++  +  
Sbjct: 363 NLALSRLQQQQSALQFRRTVLQAWHEVDDAMDGYSAEQQRTVQLHVAVDESETALGAARR 422

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            Y+ G   +LD+L  +R     +  L+ ++   A + V+LY A+G G+
Sbjct: 423 QYQAGVVDMLDVLTTQRIALDNQAALANSQATAAIARVELYRALGGGW 470


>gi|91777793|ref|YP_553001.1| efflux ABC transporter outer membrane protein [Burkholderia
           xenovorans LB400]
 gi|91690453|gb|ABE33651.1| ABC efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia xenovorans LB400]
          Length = 470

 Score =  166 bits (421), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 121/456 (26%), Positives = 223/456 (48%), Gaps = 35/456 (7%)

Query: 19  TVGPEYTKPHMPLLPTQFSIGNSKN-LINIDT------LKWWESFNDTSLNKLVKIALQQ 71
           ++ P Y +P +P+ P  ++ G+S +  ++ D       + W   F D  L  L++ AL  
Sbjct: 2   SLAPHYVRPALPV-PDTWATGSSADGTLSADATPAASRIDWRSYFPDAQLQALIEQALTG 60

Query: 72  NLTILQATERINAAKENILSVRADLFPSSYASISH-RF------IPNLKTNS----TGQL 120
           N  +  A +R+  A+      RAD  P+  A  S+ RF      +P    +      G +
Sbjct: 61  NRELRIAVQRVEEARATYGIRRADTLPTISAGGSYVRFRSPGGLLPGGSFDGEAYQVGLM 120

Query: 121 DSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQ 179
           +S+W++D +G+ R++ +++L    ++ A    A ++VI+ +  +Y+  R   ERI++A +
Sbjct: 121 ESNWELDFWGRVRNLKDAALEEFLASDAARRAATISVIANVADNYLLLRELDERIAVARE 180

Query: 180 ILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGY 239
            +    +++ +   +F  GA SKL L + E   +  ++ +  LE+S     H ++ L+G 
Sbjct: 181 TIASRAESLRIFRRRFEVGAISKLDLRQSEILFQQAQTLVAQLEQSRATQAHALAVLVGA 240

Query: 240 PATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDL 299
           PA   L        +  P+L+     G+P+ L+  RPDI   E +L  + A IG A++  
Sbjct: 241 PAP--LQPAPLDDASVCPDLHA----GLPSSLLERRPDIVAAEHRLRAANANIGAARAAF 294

Query: 300 YPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYI 356
           +P ++L G++  T     N F   +  W F P + LPIFD G+ +SN+  A++   E   
Sbjct: 295 FPRITLTGAVGSTSTDLQNLFASGSGAWIFTPNISLPIFDAGRNRSNLELAKAREGEAVA 354

Query: 357 TWQETVLNAIKEVENALTSINEDKKIVTKLQHAVE---LHKKSMSLSMINYRQGRYSLLD 413
            ++ET+ +A ++V +AL++      + T++Q   +      +   L+   Y  G    L+
Sbjct: 355 QYEETIQDAFRDVADALSA---RVWLATQVQAETDTLVAQSERARLARQRYDNGATPFLE 411

Query: 414 ILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           +LD +R        L   +R L  S V LY A+G G
Sbjct: 412 VLDAQRDLLDARQQLIQTRRALLTSRVALYAALGGG 447


>gi|109900424|ref|YP_663679.1| RND efflux system outer membrane lipoprotein [Pseudoalteromonas
           atlantica T6c]
 gi|109702705|gb|ABG42625.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Pseudoalteromonas atlantica T6c]
          Length = 460

 Score =  166 bits (421), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 118/464 (25%), Positives = 219/464 (47%), Gaps = 26/464 (5%)

Query: 2   NILR-AIFSLFIVLLAGCTVGPEYTKPH-MPLLPTQFSIGNSKNLINIDTLKWWESFNDT 59
           N+L+    +  I  L+ C VGP+Y  P+ +  +    +   ++ L N     WW++F D 
Sbjct: 3   NMLKIGTLTGLIFALSACAVGPDYQAPNKVNDIELTGTYEQAEKLTN-----WWQAFGDE 57

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN-------- 111
            LN L+  AL++N T+ QA   +  A       + DL P       +    N        
Sbjct: 58  DLNHLIDEALKENRTLFQAQANVLRAYAIFRDSQNDLLPKGTLDAGYSASKNQTMLESDD 117

Query: 112 ---LKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
              L+  +TG  +  W +DLFG+ RR +E+SLA  + A      A+L +IS++  SY D 
Sbjct: 118 DTILRGYNTG-ANLTWDVDLFGKVRRAVEASLAEAEQADILWHDAQLQIISQVAASYGDY 176

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
           R  + R+ +A Q L   ++   +   ++  G  S+L + ++ A++  +E+ +P +     
Sbjct: 177 RGAQFRLKVAEQNLANLRQTRTIVKARYQAGFASELEMARINAQVFEVEATVPQMRTLLA 236

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
                +S LL     E +   Q +     P L  P+ +    + +R R D+   E+ LA 
Sbjct: 237 RADATLSALLAKKPGELVLNAQPEL----PQLSQPVALVPGENYLRYRADVASSERALAA 292

Query: 288 SVAKIGIAKSDLYPSLSLNGSIALTHDN--SFPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
           S A+IG+A +DLYP++S++G +        +  G    WS  P +     D   +K+ IR
Sbjct: 293 STARIGVATADLYPNVSVSGFLGFLSGPGLTLGGDTKSWSVAPTISWQAADLASVKARIR 352

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
           +A +S       +++ V +A+ +++ +L S N  ++      H  +  +K+M+++   + 
Sbjct: 353 QANASTDIALAQFEQQVFDALADMQFSLQSYNFSRQQEQSTHHQWQASEKAMTIARQRFE 412

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
            G    L++L+ +R   +    L++ ++Q     VD+Y A G G
Sbjct: 413 AGSGEFLELLEAQRDALQSRDQLALLEQQSFNRLVDVYRAFGGG 456


>gi|320324624|gb|EFW80701.1| outer membrane efflux protein [Pseudomonas syringae pv. glycinea
           str. B076]
 gi|320328996|gb|EFW84995.1| outer membrane efflux protein [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330880698|gb|EGH14847.1| outer membrane efflux protein [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 489

 Score =  166 bits (421), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 120/472 (25%), Positives = 222/472 (47%), Gaps = 39/472 (8%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNS-KNLINIDTLK---WWESFNDTSLNK 63
             L +VLL+ C VGP+Y  P M   P QF      +     D +    WWE + D  LN 
Sbjct: 20  LGLCVVLLSACAVGPDYQTPSMAA-PAQFKAAEGWRAATPGDAMAKGAWWEVYRDPQLNS 78

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPS---------------SYASISHRF 108
           LV+     N T+ Q   +   A+  + S R    P+               +  + ++  
Sbjct: 79  LVERLNTSNQTVAQYDAQYRQAQALVRSSRGAFLPTLDLTTGKTRSGQGTGTSNTGTNTG 138

Query: 109 IPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
              ++ +   QL   W+ D++G+ RR +E+  A+  ++ A +   +L++ S+L+ +Y+  
Sbjct: 139 ASGIRNSYNAQLGVSWEADVWGKLRRGLEADTASAQASLADLAAMRLSLQSELVQNYLQL 198

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
           R   E+  +    +D Y++++ L+  ++  G +   ++ + + ++KS ++D+  L     
Sbjct: 199 RVIDEQKRLLESTVDTYQRSLTLTQNQYRAGISGSDAVAQAQTQLKSTQADLIDLAWQRA 258

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP----INIGIPADLIRNRPDIRYQEK 283
              + I+ L+G    +F         N   +  IP    I  G+P+ L+  RPDI   E+
Sbjct: 259 QFENAIAVLMGMAPADF---------NLPASTSIPQLPQIPPGLPSQLLERRPDIAAAER 309

Query: 284 KLADSVAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKI 340
            +  + A IG+AK+  YP  +L+   G  + T  N     N  WS GP+L L +FD G+ 
Sbjct: 310 SVMAANANIGVAKAAYYPDFTLSMSGGYSSSTFANWISLPNRFWSVGPQLALTLFDGGRR 369

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
            + + R E+   +    +++TVLN  +EVEN L  +   ++     Q A+   + S+ L+
Sbjct: 370 TAEVDRTEAVYDQTVAQYRQTVLNGFQEVENYLVQLKVYEQEAAVRQEALVSARDSLRLT 429

Query: 401 MINYRQGRYSLLDILDIERATAKVEVD-LSIAKRQLAKSYVDLYIAIGSGYN 451
              Y+ G    LD+++++      E   L++ + +L  S V L  A+G G+N
Sbjct: 430 NNQYKAGLIGYLDVVNVQATALSNERSVLNVLQSRLIAS-VQLIAALGGGWN 480


>gi|119713716|gb|ABL97766.1| outer membrane RND efflux family transporter [uncultured marine
           bacterium EB0_41B09]
          Length = 489

 Score =  166 bits (421), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 126/465 (27%), Positives = 228/465 (49%), Gaps = 26/465 (5%)

Query: 7   IFSLFIVLLAGC-TVGPEYT-KPHMPLLPTQFSIGNSKNLI-NIDTLK-WWESFNDTSLN 62
           ++ L    + GC  VGP+Y   P M + P  ++   S   +   DT K WW   +D  LN
Sbjct: 17  LYLLVFSAITGCKAVGPDYEGSPEMDV-PENWNNDLSNEFVEQSDTQKQWWTLLDDPILN 75

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFP--SSYASISHRFIPNLKTNSTGQ- 119
            L+  A   NL    A  R+  A+ N   V A  FP   +   +S +   N K+ +TG+ 
Sbjct: 76  DLIDRAAIDNLDAKIALSRVEEARANYGVVEAAKFPQIDAVGDVSRK--SNSKS-ATGEK 132

Query: 120 ---------LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                    LD  W+ID+FG  RR IE++ A LD+         + + +++  +YI  R 
Sbjct: 133 NTDNYTSIGLDLSWEIDIFGYVRRSIEAADAQLDATIENYRDVMVILYAEIARNYIALRT 192

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
            + R+  A + +   ++ + + + +++    S++ +++ E  + + ES +P         
Sbjct: 193 SQLRLQFALENVKSQRETLNIVNARYSAELVSEVDVLQSEQNLAAAESYVPLFYADIDEL 252

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            ++++ LLG         ++   N   P++     + +P +++R RPDIR  E +L    
Sbjct: 253 FNSLAVLLGKNPGSLNQELK--GNKGIPHIPEKTIVMLPREILRQRPDIRKAESRLVQET 310

Query: 290 AKIGIAKSDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           A++GIA ++ YP  +LNG+    A   D+ F   + +WSFGP     +FD G  +S I+ 
Sbjct: 311 AEVGIATAEQYPRFNLNGTFGYDARGSDSQFSSNSRYWSFGPNFRWDLFDAGAEESAIKV 370

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
            ++  ++  + +++TVL A +EVENAL S  E+K+    L+ +V+  KK   +++  Y  
Sbjct: 371 QDAQLEQARVNYEKTVLTAFEEVENALKSYKEEKQRNASLRASVKAAKKVNKITVARYTS 430

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           G     ++ D ER     E +L+ +   L +  + LY A+G G++
Sbjct: 431 GLIDFQEVQDAERVIFFQEDELAKSDGSLVQFIIQLYKAMGGGWD 475


>gi|289625136|ref|ZP_06458090.1| outer membrane efflux protein [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|289648695|ref|ZP_06480038.1| outer membrane efflux protein [Pseudomonas syringae pv. aesculi
           str. 2250]
 gi|330868008|gb|EGH02717.1| outer membrane efflux protein [Pseudomonas syringae pv. aesculi
           str. 0893_23]
          Length = 488

 Score =  166 bits (421), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 120/472 (25%), Positives = 222/472 (47%), Gaps = 39/472 (8%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNS-KNLINIDTLK---WWESFNDTSLNK 63
             L +VLL+ C VGP+Y  P M   P QF      +     D +    WWE + D  LN 
Sbjct: 20  LGLCVVLLSACAVGPDYQTPSMAA-PAQFKAAEGWRAATPGDAMAKGAWWEVYRDPQLNS 78

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPS---------------SYASISHRF 108
           LV+     N T+ Q   +   A+  + S R    P+               +  + ++  
Sbjct: 79  LVERLNTSNQTVAQYDAQYRQAQALVRSSRGAFLPTLDLTTGKTRSGQGTGTSNTGTNTG 138

Query: 109 IPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
              ++ +   QL   W+ D++G+ RR +E+  A+  ++ A +   +L++ S+L+ +Y+  
Sbjct: 139 ASGIRNSYNAQLGVSWEADVWGKLRRGLEADTASAQASLADLAAMRLSLQSELVQNYLQL 198

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
           R   E+  +    +D Y++++ L+  ++  G +   ++ + + ++KS ++D+  L     
Sbjct: 199 RVIDEQKRLLESTVDTYQRSLTLTQNQYRAGISGSDAVAQAQTQLKSTQADLIDLAWQRA 258

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP----INIGIPADLIRNRPDIRYQEK 283
              + I+ L+G    +F         N   +  IP    I  G+P+ L+  RPDI   E+
Sbjct: 259 QFENAIAVLMGMAPADF---------NLPASTSIPQLPQIPPGLPSQLLERRPDIAAAER 309

Query: 284 KLADSVAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKI 340
            +  + A IG+AK+  YP  +L+   G  + T  N     N  WS GP+L L +FD G+ 
Sbjct: 310 SVMAANANIGVAKAAYYPDFTLSMSGGYSSSTFANWISLPNRFWSVGPQLALTLFDGGRR 369

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
            + + R E+   +    +++TVLN  +EVEN L  +   ++     Q A+   + S+ L+
Sbjct: 370 TAEVDRTEAVYDQTVAQYRQTVLNGFQEVENYLVQLKVYEQEAAVRQEALVSARDSLRLT 429

Query: 401 MINYRQGRYSLLDILDIERATAKVEVD-LSIAKRQLAKSYVDLYIAIGSGYN 451
              Y+ G    LD+++++      E   L++ + +L  S V L  A+G G+N
Sbjct: 430 NNQYKAGLIGYLDVVNVQATALSNERSVLNVLQSRLIAS-VQLIAALGGGWN 480


>gi|170691192|ref|ZP_02882358.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia graminis C4D1M]
 gi|170144441|gb|EDT12603.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia graminis C4D1M]
          Length = 513

 Score =  166 bits (421), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 126/473 (26%), Positives = 229/473 (48%), Gaps = 30/473 (6%)

Query: 4   LRAIFSL--FIVLLAGC-TVGPEYTKP-----HMPLLPTQFSIGNSKNLINIDTLK-WWE 54
           LRA F+L     LL GC  VGP Y+ P     + PL        +S    + D    WW+
Sbjct: 14  LRA-FALVPLAALLNGCMNVGPNYSLPKDALVNAPLANAPIEGADSALTSHADVPAVWWK 72

Query: 55  SFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRA-DLFPSSYASISHRF----- 108
            ++D  LN LV  ALQ N  +  A   +  ++E +   +A   F    +++  R      
Sbjct: 73  LYDDPVLNGLVDEALQSNTDLRVAAANLARSREALGVAQAQGGFSGKTSAVFERAQESAE 132

Query: 109 -------IPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKL 160
                  +P +     G +   ++IDLFG+ RR +E++ A+ D+  A  D+A+++V++ +
Sbjct: 133 QYLLTEKLPVVNEGDVG-ISVAYEIDLFGKLRRGVEAAQADADAVQAAGDLARISVVADV 191

Query: 161 IPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIP 220
           + +Y++     E + IA Q L L ++ +++S      G  ++  + + + ++ ++ +DIP
Sbjct: 192 VRAYVEQCSAAEELKIAQQSLALQRQRVDVSRRLRDVGRGNQTEVTRGQTQVDTLSADIP 251

Query: 221 TLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRY 280
                 ++  + ++ LL    ++    +   +    P +  PI +G  A L+R RPD+R 
Sbjct: 252 RYTARRKIAQYRLAALLARAPSDLPPAVL--ACEKLPQIRQPIPVGDGAALLRRRPDVRE 309

Query: 281 QEKKLADSVAKIGIAKSDLYPSLSLNGSIALTH--DNSFPGYNTHWSFGPKLYLPIFDKG 338
            E++LA S A+IG+A   LYP++S+  S  LT   ++        W FGP +    F   
Sbjct: 310 AERQLAASTARIGVATGALYPTVSIGASAGLTGVLEDLGTSPTARWGFGPLISW-TFPAN 368

Query: 339 KIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMS 398
             +  +R A++S+Q     +   VL A++E E +L +   D      LQ A++   +S  
Sbjct: 369 GARGRVREAQASSQVALARFDGVVLTALRETETSLATYASDYARTEALQAALKSAAQSAD 428

Query: 399 LSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            +   YR GR S +  LD  R     +  ++ A+ Q+A   V+L++A+G G+ 
Sbjct: 429 ETHRLYRAGRESFISDLDATRTLTSTKAQVAAAEGQVAIDQVNLFLALGGGWE 481


>gi|59801711|ref|YP_208423.1| hypothetical protein NGO1363 [Neisseria gonorrhoeae FA 1090]
 gi|59718606|gb|AAW90011.1| multidrug efflux pump channel protein [Neisseria gonorrhoeae FA
           1090]
          Length = 467

 Score =  166 bits (421), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 121/445 (27%), Positives = 218/445 (48%), Gaps = 14/445 (3%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           L+ CT+ P+Y +P + +  T F    S + I    L W + F D  L KL+ IAL++N +
Sbjct: 18  LSACTMIPQYEQPKVEVAET-FQNDTSVSSIRAVDLGWHDYFADPRLQKLIDIALERNTS 76

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST------GQLDSDWKIDL 128
           +  A       ++  +  R +L P+  A+ +     +L   +       G   + +++DL
Sbjct: 77  LRTAVLNSEIYRKQYMIERNNLLPTLAANANGSRQGSLSGGNVSSSYNVGLGAASYELDL 136

Query: 129 FGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKN 187
           FG+ R   E++L    ++ A  D A L++I+ +  +Y + R+ ++ +S+A ++L   ++ 
Sbjct: 137 FGRVRSSSEAALQGYFASVANRDAAHLSLIATVAKAYFNERYAEKAMSLAQRVLKTREET 196

Query: 188 IELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHY 247
            +LS L++  G  S ++L + EA I+S ++D     +S     + ++TL+  P  E L  
Sbjct: 197 YKLSELRYKAGVISAVALRQQEALIESAKADYAHAARSREQARNALATLINRPIPEDLPA 256

Query: 248 MQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNG 307
                  F       +  G+ ++++ +RPDIR  E  L  + A IG A++  +PS+ L G
Sbjct: 257 GLPLDKQF---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAFFPSIRLTG 313

Query: 308 SIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLN 364
           S+          F      W+F P + LPIF  G  K+N+  A+   Q Q + ++  V +
Sbjct: 314 SVGTGSVELGGLFKSGTGVWAFAPSITLPIFTWGTNKANLDVAKLRQQAQIVAYESAVQS 373

Query: 365 AIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKV 424
           A ++V NAL +  +  K    L       K+++ L  + Y+ G    LD+LD ER +   
Sbjct: 374 AFQDVANALAAREQLDKAYDALSKQSRASKEALRLVGLRYKHGVSGALDLLDAERISYSA 433

Query: 425 EVDLSIAKRQLAKSYVDLYIAIGSG 449
           E     A+   A++  DLY A+G G
Sbjct: 434 EGAALSAQLTRAENLADLYKALGGG 458


>gi|269214056|ref|ZP_05983494.2| multiple transferable resistance system protein MtrE [Neisseria
           cinerea ATCC 14685]
 gi|269144619|gb|EEZ71037.1| multiple transferable resistance system protein MtrE [Neisseria
           cinerea ATCC 14685]
          Length = 445

 Score =  166 bits (421), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 119/438 (27%), Positives = 215/438 (49%), Gaps = 14/438 (3%)

Query: 22  PEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATER 81
           P+Y +P + +  T F    + + I    L W + F D  L KL+ IAL++N ++  A   
Sbjct: 3   PQYEQPKVEVAET-FKNDTADSGIRAVDLGWHDYFADPRLQKLIDIALERNTSLRTAVLN 61

Query: 82  INAAKENILSVRADLFPSSYASISHRFIPNLKTNST------GQLDSDWKIDLFGQ-RRH 134
               ++  +  R +L P+  A+       +L   +       G   + +++DLFG+ R  
Sbjct: 62  SEIYRKQYMIERNNLLPTLAANAGGSRQGSLSGGNVSSSYNVGLGAASYELDLFGRVRSS 121

Query: 135 IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLK 194
            E++L    ++ A  D A L++I+ +  +Y + R+ +E +S+A ++L   +   +LS L+
Sbjct: 122 SEAALQGYFASVANRDAAHLSLIATVAKAYFNERYAEEAMSLAQRVLKTREATYKLSELR 181

Query: 195 FTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNN 254
           +  G  S ++L + EA I+S ++D     +S     + ++TL+  P  + L         
Sbjct: 182 YKAGVISAVALRQQEALIESAKADYAHAARSREQARNALATLINQPIPDNLPAGLPLDKQ 241

Query: 255 FQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTH- 313
           F       +  G+ ++++ +RPDIR  E  L  + A IG A++  +PS+ L GS+     
Sbjct: 242 F---FVEKLPAGLSSEVLLDRPDIRAAEHALKQANANIGAARAAFFPSIRLTGSVGTGSA 298

Query: 314 --DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVEN 371
                F      WSF P + LPIF  G  K+N+  A+   Q Q + ++  V +A ++V N
Sbjct: 299 ELSGLFKSGTGVWSFAPSITLPIFTWGTNKANLDAAKLRQQAQIVAYESAVQSAFQDVAN 358

Query: 372 ALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIA 431
           ALT+  +  K    L      +K+++ L  + Y+ G    LD+LD ER++   E  +  A
Sbjct: 359 ALTAREQLDKAYAALSKQSRAYKEALRLVGLRYKHGVSGALDLLDAERSSYSAEGAVLSA 418

Query: 432 KRQLAKSYVDLYIAIGSG 449
           +   A++  DLY A+G G
Sbjct: 419 QLTRAENLADLYKALGGG 436


>gi|1707646|emb|CAA67865.1| hypothetical protein [Pseudomonas aeruginosa PAO1]
          Length = 472

 Score =  166 bits (420), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 127/462 (27%), Positives = 227/462 (49%), Gaps = 22/462 (4%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
            +FSL    L+ CTVGP+Y  P         +     +    ++L WW+ F+D +LN+LV
Sbjct: 16  GLFSLLA--LSACTVGPDYRTPDTAAAKIDATASKPYDRSRFESL-WWKQFDDPTLNQLV 72

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFP----SSYASISHRFIPNLKTNSTGQ-- 119
           + +L  N  +  A  R+ AA+     V  D FP     + A I     P +  +      
Sbjct: 73  EQSLSGNRDLRVAFARLRAARALRDDVANDRFPVVTSRASADIGKGQQPGVTEDRVNSER 132

Query: 120 ----LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
               LDS W++DLFG+ RR +ESS A  ++A A +   ++++I++L+ +Y   R  + R 
Sbjct: 133 YDLGLDSAWELDLFGRIRRQLESSDALSEAAEADLQQLQVSLIAELVDAYGQLRGAQLRE 192

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
            IA   L+  K++ +L+      G  ++L +++ +A + +  + +P L+       H I+
Sbjct: 193 KIALSNLENQKESRQLTEQLRDAGVGAELDVLRADARLAATAASVPQLQAEAERARHRIA 252

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
           TLLG    E    +   S    P +   + IG P +L+R RP+IR  E+++A S A +G+
Sbjct: 253 TLLGQRPEELTVDL---SPRDLPAITKALPIGDPGELLRRRPNIRAAERRVAASTADVGV 309

Query: 295 AKSDLYPSLSLNGSIALTHDNSFPGYNTH----WSFGPKLYLPIFDKGKIKSNIRRAESS 350
           A +DL+P+      +   H  +     +     WS GP +    FD G +++ +R A++ 
Sbjct: 310 ATADLFPAGQPQ-RLPRLHRRAGSQIGSSAARAWSVGPSISWAAFDLGSVRARLRGAKAD 368

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
           A     ++++ VL A++E  NA +   + ++ +  L    E  + +   + I YR+G   
Sbjct: 369 ADAALASYEQQVLLALEESANAFSDYGKRQERLVSLVRQSEASRAAAQQAAIRYREGTTD 428

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            L +LD ER     E   + A+ +L +  V +Y ++G G+ P
Sbjct: 429 FLVLLDAEREQLSAEDAQAQAEVELYRGIVAIYRSLGGGWQP 470


>gi|17549675|ref|NP_523015.1| putative outer membrane lipoprotein [Ralstonia solanacearum
           GMI1000]
 gi|17431929|emb|CAD18607.1| putative outer membrane lipoprotein [Ralstonia solanacearum
           GMI1000]
          Length = 490

 Score =  166 bits (420), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 123/469 (26%), Positives = 217/469 (46%), Gaps = 58/469 (12%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTIL 76
            C + P Y  P   +  TQ+             + WW  FND ++ +L++ A   + ++ 
Sbjct: 25  ACALQPPYQAPQTAIA-TQWQAERPHGASVTSLVDWWSRFNDPAVAELIRRAEADSPSLA 83

Query: 77  QATERINAAKENILSVRADLFPS-----------SYASISHRFIPNLKTNSTGQLDSDWK 125
           +A  +IN+A+  ++S  AD +P+           S  +     + +L T  +G LD+ W+
Sbjct: 84  KAVAQINSARATLVSNGADAWPALTGSASVTRAKSATAAGDTTVSSLSTTRSGGLDASWE 143

Query: 126 IDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYK 185
           IDLFG+ R      A+  SA AQ++            + ID  H   R+S+A ++ D Y 
Sbjct: 144 IDLFGKVR------ASRQSAQAQLE------------ARIDDWH-DARVSLAAEVADDYV 184

Query: 186 KNIELSHL---------------KFTQGATSKLSLVKLE---AEIKSIESDIPTLEKSFR 227
           +      L               K T+ A +       +   AE  +  ++    E+S  
Sbjct: 185 QYRACRQLAKAYAQAAASRAQTAKSTRAAVAAGMTAASDGYLAEGSTASANATATEQSVA 244

Query: 228 MN--VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGI---PADLIRNRPDIRYQE 282
               V ++  L G         + +      P+L  P    +   PADL+R RPD+   E
Sbjct: 245 CETLVKSLVALTGTDEPTLRGIIDRPGA---PDLPQPDTFSVTSVPADLVRQRPDLASAE 301

Query: 283 KKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
           + LA   A I  A+++ +PSLSL+GSIA++   +     + WSFGP L +P+FD G+ K+
Sbjct: 302 RDLAADYASIAKARANRFPSLSLSGSIAISA-TTLAAPMSSWSFGPSLSVPLFDAGQRKA 360

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            +  A+++   Q  T++ +V  A+KEVE AL +++   +     + A E +++ +S    
Sbjct: 361 AVDSAQATYDAQLATYRSSVRTAVKEVEQALVALDGAARRSDDARQAAEQYRRYVSAIET 420

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           N+R G  +LL + +  R+    E+ L   +R   + ++ LY A+G G+ 
Sbjct: 421 NWRAGLDTLLTLEEARRSATTAEITLIELQRDRVRDWITLYKALGGGWQ 469


>gi|28869942|ref|NP_792561.1| outer membrane efflux protein [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|28853187|gb|AAO56256.1| outer membrane efflux protein [Pseudomonas syringae pv. tomato str.
           DC3000]
          Length = 490

 Score =  166 bits (420), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 121/471 (25%), Positives = 222/471 (47%), Gaps = 44/471 (9%)

Query: 12  IVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK---WWESFNDTSLNKLVKIA 68
           I LL+ C VGP+Y KP         +    +     D +    WWE + D  LN LV   
Sbjct: 24  IALLSACAVGPDYQKPSSAAPAQFKAAAGWRAATPSDAMAKGAWWEVYGDAQLNTLVARL 83

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPS----------------SYASISHRFIPNL 112
              N T+ Q   +   A+  + S R   FP+                S +  S+     +
Sbjct: 84  NTSNQTVAQYDAQYRQAQALVRSSRGAFFPTLDLTTGKTRSGQGAGTSSSGTSNTSASGI 143

Query: 113 KTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
           + +   QL   W+ D++G+ RR +E+  AN  ++ A +   +L++ S+L+ +Y+  R   
Sbjct: 144 RNSYNAQLGVSWEADVWGKLRRGLEADTANAQASLADLAAMRLSLQSELVQNYMQLRVID 203

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
           E+  +    +D Y++++ L+  ++  G     ++ + + ++KS ++D+  L        +
Sbjct: 204 EQKRLLESTVDAYQRSLTLTRNQYRAGIAGTDAVAQAQTQLKSTQADLIDLVWQRAQFEN 263

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIP----INIGIPADLIRNRPDIRYQEKKLAD 287
            I+ L+G    +F         N  P   IP    I  G+P+ L+  RPDI   E+ +  
Sbjct: 264 AIAVLMGVAPADF---------NLPPTTTIPQLPQIPPGVPSQLLERRPDIAAAERSVMG 314

Query: 288 SVAKIGIAKSDLYP--SLSLNGSIALTHDNSFPGY----NTHWSFGPKLYLPIFDKGKIK 341
           + A IG+AK+  YP  +LS++G     + ++F  +    N  WS GP+L L +FD G+  
Sbjct: 315 ANANIGVAKAAYYPDFTLSMSGGY---NSSTFANWISLPNRFWSVGPQLALTLFDGGRRS 371

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           + + R E+   +    +++TVLN  +EVEN L  +   ++     Q A+   + S+ L+ 
Sbjct: 372 AEVDRTEALYDQTVAQYRQTVLNGFQEVENYLIQLKVYEEEAAVRQEALVAARDSLRLTN 431

Query: 402 INYRQGRYSLLDILDIE-RATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             Y+ G    LD+++++  A +     L++ + +L  S V L  A+G G+N
Sbjct: 432 NQYKAGLIGYLDVVNVQATALSNERTVLNVLQSRLIAS-VQLIAALGGGWN 481


>gi|283779057|ref|YP_003369812.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Pirellula staleyi DSM 6068]
 gi|283437510|gb|ADB15952.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Pirellula staleyi DSM 6068]
          Length = 541

 Score =  166 bits (420), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 124/465 (26%), Positives = 231/465 (49%), Gaps = 37/465 (7%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGNSK----NLINIDTLKWWESFNDTSLNKLVKIALQQN 72
           G  VGP Y KP  P+        N K     +++ D   WW+ FND  L+ +++IA QQN
Sbjct: 35  GFKVGPNYAKPAAPVSNDWIDSYNPKVQRGEMLSAD---WWKVFNDKRLDAVIEIAYQQN 91

Query: 73  LTILQATERINAAKENILSVRADLFPSS------YASISHR----------------FIP 110
           ++I +A  RI  ++    +V  +L+P S      YA +                    + 
Sbjct: 92  ISIREAGFRIAESQAMRSAVAGNLWPQSQQLTGDYARLQRSQQTATFPQGGALPPGLLVT 151

Query: 111 NLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
           N    S G     W++D +G+ RR IE++ ANLD++    D A + +I++   +YID R 
Sbjct: 152 NYDNWSLGGAIG-WELDFWGRYRRSIEAADANLDASIEAYDDALVLLIAETASAYIDYRT 210

Query: 170 FKERISIAHQILDLYKKNIELS-HLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
           F++RI  A   +   K++ ++    K  +   S++   +  A +   E+ +  LE + R 
Sbjct: 211 FEQRIDYALTNIQQQKRSADIRVARKKAEAINSEIDAPQSLANLTRTEAAVHLLELAKRQ 270

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
             + ++ LLG P  + L Y+   S    P +   + + +PA L+R RPD+R  E+ +A  
Sbjct: 271 TQNRLAVLLGMPPHD-LSYILGPSRGV-PKVGDTVTLDVPASLLRRRPDVRRAERLVAAQ 328

Query: 289 VAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
             +IGIA++DLYP++S+NG++ +      N F       S GP     + + G++++ + 
Sbjct: 329 SEQIGIAQTDLYPTISINGALTMEASQFPNLFAPNAWQGSVGPGFRWNVLNYGRLRNLVS 388

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
             ++  +++   +Q+TVL A +E ENA+ S    +    KL+ +V   ++++ +      
Sbjct: 389 VQDAILEQRIAAYQQTVLVANEEAENAIVSFLRYQMQRDKLEESVGYAQEAVRVVNQKED 448

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +G+     + D+E    + + + + ++  +AKS V +Y A+G G+
Sbjct: 449 KGQVDYTQVFDLETLLVQQQDEYATSQGNVAKSMVQIYKAMGGGW 493


>gi|148554076|ref|YP_001261658.1| RND efflux system outer membrane lipoprotein [Sphingomonas
           wittichii RW1]
 gi|148499266|gb|ABQ67520.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Sphingomonas wittichii RW1]
          Length = 473

 Score =  166 bits (420), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 125/474 (26%), Positives = 215/474 (45%), Gaps = 35/474 (7%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL---------KWW 53
           +LR +      LL     GP+Y +P  P        G     I               WW
Sbjct: 1   MLRKLLLAGSALLTVAAAGPDYVRPAAP-------AGAEGPFIKAPAAPVTPAEPDQAWW 53

Query: 54  ESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF--IPN 111
             + D  L++L+  AL  N  +  A   ++ A+  +   RA   P +  S    +  +P 
Sbjct: 54  RLYQDPVLDRLIADALAANTDLRIAVANLDRARALLRESRAGRLPRTDVSAGANYGRLPA 113

Query: 112 LKTNSTGQLDSDW----------KIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKL 160
            +    G    DW          ++DLFG+  R IE++  +  +A A  D  K+ + ++ 
Sbjct: 114 TQ-RPAGAEREDWSFDAGLSVSYEVDLFGRVGRSIEAARGDAQAAEAARDAVKVAIAAET 172

Query: 161 IPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIP 220
             +Y DA    ER+++A + L L  + + L+  +F  G TSKL L +  A  +   + + 
Sbjct: 173 ARAYADASSAVERLAVAERTLGLLDQVVGLTAKRFEAGRTSKLDLSRASALREQQRATLS 232

Query: 221 TLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRY 280
            L       +  ++TL G    +    +  ++   +  L  PI +G    L+  RPDIR 
Sbjct: 233 PLRAQRDAALFRLATLTGRTPVDLPPEVGARALTLR--LDRPIPVGDGRGLLARRPDIRE 290

Query: 281 QEKKLADSVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDK 337
            E+KLA   A+IG+A +DLYP ++L GSI  T     + F G    W  GP L     ++
Sbjct: 291 AERKLAAETARIGVATADLYPRIALGGSIGSTGPSLGDMFGGGPLRWLLGPLLSWNFPNQ 350

Query: 338 GKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSM 397
              ++ I +A++S +     +  TVL A++E E AL++   + +    L+ A    + + 
Sbjct: 351 EAGRAKIAQAKASTRAALAGFDGTVLRALEETETALSAYGHELERSEALREAAAQAQTAA 410

Query: 398 SLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           ++S    R+GR   L +LD ER +A  + DL+ +  ++  + VDL+ A+G G+ 
Sbjct: 411 TISRAQLREGRVDFLTVLDAERTSASADADLAESDARVTNAQVDLFRALGGGWQ 464


>gi|186472339|ref|YP_001859681.1| RND efflux system outer membrane lipoprotein [Burkholderia phymatum
           STM815]
 gi|184194671|gb|ACC72635.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia phymatum STM815]
          Length = 500

 Score =  166 bits (420), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 130/493 (26%), Positives = 238/493 (48%), Gaps = 59/493 (11%)

Query: 3   ILRAIFSLFIV-LLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINI------------DT 49
           + R+I +  I  L AGC VGP+Y +P + ++P  F   NS +  ++            D+
Sbjct: 12  VQRSIVAAAIATLCAGCAVGPDYKRPDV-VVPAAFKEANSSDAGDVWQQAKPDPAASLDS 70

Query: 50  LKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS-SYASISHRF 108
            +WW  F D +L+ L + AL+ N T+ Q      +A+  + S RA LFP+ S+A    R 
Sbjct: 71  -RWWTVFGDGTLDDLCERALKANQTLAQYEAAYRSARAQVASSRASLFPTVSFAGSGTRS 129

Query: 109 IPNLKTNST-----------------GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVD 150
                +N+T                  +L++ W+ DL+G  RR +E S A+  ++ AQ+ 
Sbjct: 130 RTGTGSNTTPISSGSSTSSYASKSVSAELEASWEPDLWGSVRRSVEVSEASAQASDAQLA 189

Query: 151 IAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEA 210
             +L+V++ L   Y   R     ++I  +   +  + + L+  K+ QG +S   +     
Sbjct: 190 GERLSVLATLAVDYFTVRAADADLAILEEERRIDAELLALTEAKYKQGVSSYDDVRTAHN 249

Query: 211 EIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPAD 270
            +++I+  I + + + R   H I+ LLG P   F   +Q       P L     + +P+ 
Sbjct: 250 TLQAIDESIASAQLTRRQYEHAIAVLLGEPPAAFSLPVQADYRFDLPAL----PVALPST 305

Query: 271 LIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNG-----SIALTHDNSFPGYNTHWS 325
           L++ RPD+   E+ +A   AKIG+AK+  +P+++L         +  H  S P     WS
Sbjct: 306 LLQRRPDVVQAERTVAQYNAKIGVAKAGYFPTITLTADGGWSGTSFAHLISLP--TRFWS 363

Query: 326 FGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTK 385
            G  +   +FD G   +++R A ++  ++   +++TVL+A ++VE+ L+++    +I ++
Sbjct: 364 LGLDVAQTVFDAGATSASVRAARANYDQEVAAYRQTVLSAFQDVEDYLSAV----QIASR 419

Query: 386 LQHAV-ELHKKSMSLSMI---NYRQGRYSLLDILDIERATA---KVEVDLSIAKRQLAKS 438
              A  E+ ++S  L+     N+  G  S +D+LD +       K+ +D S    Q A  
Sbjct: 420 QAAASNEVARRSGELAASQQRNFAAGTASRIDMLDTQLTQVEDRKIALDYSSTTLQNA-- 477

Query: 439 YVDLYIAIGSGYN 451
            V L  A+G G++
Sbjct: 478 -VLLVKALGGGWD 489


>gi|186474240|ref|YP_001861582.1| RND efflux system outer membrane lipoprotein [Burkholderia phymatum
           STM815]
 gi|184196572|gb|ACC74536.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia phymatum STM815]
          Length = 493

 Score =  166 bits (420), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 131/483 (27%), Positives = 226/483 (46%), Gaps = 45/483 (9%)

Query: 1   MNILRAIFSLFIVLLA--GCT-VGPEYTKP-----HMPLLPTQFSIGNSKNLINIDTL-- 50
           +N +R  ++   ++ A   CT VGP YT P     + P   T    G  K  +    +  
Sbjct: 7   LNTVRTGWAWLPIMFALNACTTVGPNYTLPDNAAVNAPYANTTID-GADKAPVTQQAVPS 65

Query: 51  KWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADL-FPSSYASISHR-- 107
           KWW  ++D  L++LV  AL  N  +         A  N+   RA L F +     S +  
Sbjct: 66  KWWRLYDDPVLDQLVTQALSSNTDL-------RVAASNLARSRAQLDFANEQGGFSGKTS 118

Query: 108 --------------FIPNLKTNSTGQLD--SDWKIDLFGQ-RRHIESSLANLDSAYAQVD 150
                             L   + G LD    ++IDLFG+ RR +E++ A+ ++  A +D
Sbjct: 119 AAFQRAQESAEQYLLTEKLPVINEGALDLSVSYEIDLFGKLRRGVEAAKADDEAIEAALD 178

Query: 151 IAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEA 210
           +A++ V++ ++ +Y+++    + + IA Q L L K+ ++L+      G  ++  + + + 
Sbjct: 179 LARITVVADVVRAYVESCSASQELEIAQQSLSLQKQRVKLTQRLRDAGRGNQPDVTRGQT 238

Query: 211 EIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPAD 270
           +  ++ +DIP      R   + ++ LL    +         S    P L  PI +G  A 
Sbjct: 239 QADTLAADIPRFVARRRAAQYRLAMLLARAPSALPPAALACSK--LPQLKQPIPVGDGAA 296

Query: 271 LIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFG 327
           L+R RPD+R  E+ LA S A+IG+A + LYPS+S+    GSI +  D   P  N  W+FG
Sbjct: 297 LLRRRPDVRQAERLLAASTARIGVATAALYPSVSIGASAGSIGVAEDLFGPATN-RWAFG 355

Query: 328 PKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQ 387
           P +       G+ ++ +  AE++       +   VLNA++E + +L++   D      L+
Sbjct: 356 PLISWTFPINGQ-RARVHEAEAATSGALAHFDGVVLNALRETQTSLSTYASDTTRADALR 414

Query: 388 HAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIG 447
            A +   +S   +   Y  GR S L  LD  R    V   +S A+ Q+A   V+L++A+G
Sbjct: 415 TAYKSAIQSADETHRLYAAGRESFLSDLDATRTLTSVAAQVSAAEGQVALDQVNLFLALG 474

Query: 448 SGY 450
            G+
Sbjct: 475 GGW 477


>gi|71735550|ref|YP_274834.1| outer membrane efflux protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71556103|gb|AAZ35314.1| outer membrane efflux protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 489

 Score =  166 bits (420), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 120/472 (25%), Positives = 222/472 (47%), Gaps = 39/472 (8%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNS-KNLINIDTLK---WWESFNDTSLNK 63
             L +VLL+ C VGP+Y  P M   P QF      +     D +    WWE + D  LN 
Sbjct: 20  LGLCVVLLSACAVGPDYQTPSMAA-PAQFKAAEGWRAATPGDAMAKGAWWEVYRDPQLNS 78

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPS---------------SYASISHRF 108
           LV+     N T+ Q   +   A+  + S R    P+               +  + ++  
Sbjct: 79  LVERLNTSNQTVAQYDAQYRQAQALVRSSRGAFLPTLDLTTGKTRSGQGTGTSNTGTNTG 138

Query: 109 IPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
              ++ +   QL   W+ D++G+ RR +E+  A+  ++ A +   +L++ S+L+ +Y+  
Sbjct: 139 ASGIRNSYNAQLGVSWEADVWGKLRRGLEADTASAQASLADLAAMRLSLQSELVQNYLQL 198

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
           R   E+  +    +D Y++++ L+  ++  G +   ++ + + ++KS ++D+  L     
Sbjct: 199 RVIDEQKRLLESTVDTYQRSLTLTQNQYRAGISGSDAVAQAQTQLKSTQADLIDLAWQRA 258

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP----INIGIPADLIRNRPDIRYQEK 283
              + I+ L+G    +F         N   +  IP    I  G+P+ L+  RPDI   E+
Sbjct: 259 QFENAIAVLVGMAPADF---------NLPASTSIPQLPQIPPGLPSQLLERRPDIAAAER 309

Query: 284 KLADSVAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKI 340
            +  + A IG+AK+  YP  +L+   G  + T  N     N  WS GP+L L +FD G+ 
Sbjct: 310 SVMAANANIGVAKAAYYPDFTLSMSGGYSSSTFANWISLPNRFWSVGPQLALTLFDGGRR 369

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
            + + R E+   +    +++TVLN  +EVEN L  +   ++     Q A+   + S+ L+
Sbjct: 370 TAEVDRTEAVYDQTVAQYRQTVLNGFQEVENYLVQLKVYEQEAAVRQEALVSARDSLRLT 429

Query: 401 MINYRQGRYSLLDILDIERATAKVEVD-LSIAKRQLAKSYVDLYIAIGSGYN 451
              Y+ G    LD+++++      E   L++ + +L  S V L  A+G G+N
Sbjct: 430 NNQYKAGLIGYLDVVNVQATALSNERSVLNVLQSRLIAS-VQLIAALGGGWN 480


>gi|326385744|ref|ZP_08207373.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209723|gb|EGD60511.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Novosphingobium nitrogenifigens DSM 19370]
          Length = 506

 Score =  166 bits (419), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 123/478 (25%), Positives = 231/478 (48%), Gaps = 49/478 (10%)

Query: 13  VLLAGCTVGPEYTKPHMPLLPTQFSIGNSKN------LINIDTL--KWWESFNDTSLNKL 64
           + L GCTVGP+Y KP   + P  ++  +S +      L +   L   WW+ F+D  L++L
Sbjct: 23  LCLGGCTVGPDYHKP-TAVAPADWTSWHSGSDALRPALADAAPLPPDWWQGFHDPVLDEL 81

Query: 65  VKIA------------------LQQNLTILQATERINAAKENILSVRADLFPSS---YAS 103
            + A                  +Q+++T  Q   +++A+   +   R   F +S   +  
Sbjct: 82  ERRAFAASPDLRTAALHFAQARVQRDVTASQGLPQVDASA-TVQGQRQSEFGASTRLFDE 140

Query: 104 ISH-------RFIPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLN 155
           I         + +    T   G  D+ W+ID +G+ RR +E++ A++    A +D A+L 
Sbjct: 141 IGGANRNALAKLLGEPYTLYKGGFDASWEIDFWGKVRRSVEAANADIAQQGALLDQARLT 200

Query: 156 VISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSI 215
           + S +  +Y   R  +  +++A   +D  ++   +   +   G  +   L +   +++S 
Sbjct: 201 LASDVAQAYFSLRSAQRDLAMARADIDDLRERTRILAERTKGGLANHFDLERQHIDLRSA 260

Query: 216 ESDIPTLEKSFRMNVHNISTLLG-YPAT--EFLHYMQKQSNNFQPNLYIPINIGIPADLI 272
           E+ +P LE      ++ I+ LLG  P +  + LH  + +     P+L     +G+P+ + 
Sbjct: 261 EAQLPALEAQEASQINRIALLLGDRPGSLSDLLHPQESEVAGALPDL----TLGLPSAVA 316

Query: 273 RNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPK 329
             RPDIR  E +L ++ AKIG+A++DLYP++ L G+  L      N F   +  W  GP 
Sbjct: 317 LRRPDIRAAEARLHEATAKIGVARADLYPAIKLGGNFDLESYRASNLFEWGSHSWGIGPS 376

Query: 330 LYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHA 389
           + LP+FD  + +  IR  E   +E  +++++TVL A +E+++AL +   ++    KL   
Sbjct: 377 VDLPLFDGARRRRTIRLRELEQKEAAVSFEQTVLRAWQEIDDALNAYQAERVENAKLAER 436

Query: 390 VELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIG 447
            E  ++++ L+   Y  G  + +D+LD  RA  +   +   +  +L   YV +  AIG
Sbjct: 437 REAARQALDLAQARYAGGIVTWIDVLDARRAYHQARRESWDSDARLGTRYVVVNKAIG 494


>gi|218512212|ref|ZP_03509052.1| nodulation protein (outer membrane efflux protein) [Rhizobium etli
           8C-3]
          Length = 164

 Score =  166 bits (419), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 112/163 (68%), Gaps = 2/163 (1%)

Query: 256 QPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDN 315
           QP     IN GIPADLIRNRPDIR  E+ LA + A IG+A++ LYPS+SL+GSI+ ++ N
Sbjct: 1   QPVFRGGINSGIPADLIRNRPDIRVAERDLAAATANIGVAEAQLYPSISLSGSISPSYIN 60

Query: 316 --SFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENAL 373
                G  T WSFGP L LPIFD G++++N++ A+S A   Y+ W+ TVL A+++VENAL
Sbjct: 61  QRGIHGGLTPWSFGPTLNLPIFDGGRLRANVKSAQSDAATAYLNWKSTVLTAVEQVENAL 120

Query: 374 TSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILD 416
            ++  D + V  LQ  V+  ++++ LS  +Y+ G  SLLD+LD
Sbjct: 121 AAVRRDAQTVAALQAQVKTTQETLELSTASYKDGASSLLDVLD 163


>gi|226944951|ref|YP_002800024.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Azotobacter vinelandii DJ]
 gi|226719878|gb|ACO79049.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Azotobacter vinelandii DJ]
          Length = 512

 Score =  166 bits (419), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 122/483 (25%), Positives = 229/483 (47%), Gaps = 43/483 (8%)

Query: 5   RAIFSLFIVL---LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLIN----IDTLKWWESFN 57
           R  +S+ + L   L GCT+GP+Y +P +   P  F  G    L       +   WWE + 
Sbjct: 12  RLAWSMTLALGLALGGCTLGPDYQRPQLSA-PDSFREGEGWKLATPADEAERGPWWEMYG 70

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH-RFIPNLKTNS 116
           D  L+ L++   + N T+ Q+  +   AK  + + +AD FP+   ++   R      +  
Sbjct: 71  DPILDDLMRRLDESNQTVAQSIAQYLQAKATVRTAKADFFPTGRVTVDETRSATASGSGG 130

Query: 117 TGQLDS-----------------------DWKIDLFGQ-RRHIESSLANLDSAYAQVDIA 152
           T +L                          W++D +G+ RR +ES  A L ++ A +   
Sbjct: 131 TSRLPDGSTVSSGGGGGTISNSYNAVSNISWELDFWGKMRRQLESDRAGLQASAADLAAV 190

Query: 153 KLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEI 212
           +L+  S L  SY+  R    +  +    ++ Y + + L+  ++  G  +K  + + + ++
Sbjct: 191 RLSQQSTLAQSYLQLRVLDGQRRLLKATVEAYARTLRLTENQYRAGMVTKADVTQAQTQL 250

Query: 213 KSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLI 272
           KS E+    L+       H I+ L+G P +E    ++    +  P+L   I   +P+ LI
Sbjct: 251 KSTEAQAIDLDYQRAQLEHAIAVLIGVPPSE----LELAELDSLPDL-PEIPTLLPSQLI 305

Query: 273 RNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLN--GSIALTH-DNSFPGYNTHWSFGPK 329
             RPD+   E+++  + A IG+AK+  +P+ SL+  G    TH D  F   N  W+  P+
Sbjct: 306 ERRPDVAAAEREVMSANALIGVAKAARFPTFSLSAAGGYRATHTDYWFEKDNRFWNISPE 365

Query: 330 LYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHA 389
           + L +FD G +++ + +A ++ Q+   T+++TVL++ +EVE+ L  ++  ++     Q A
Sbjct: 366 MALTLFDGGLLRAQVDQARATHQQAVATYRQTVLDSFREVEDYLVQLSVLERETRAQQEA 425

Query: 390 VELHKKSMSLSMINYRQGRYSLLDILDIERATAKVE-VDLSIAKRQLAKSYVDLYIAIGS 448
           VE  ++S  L    Y+ G      ++D++ A    E   L++   +L  S V L  A+G 
Sbjct: 426 VEAAQESRRLMENQYKAGTVDYSSVVDVQTAALSNERTVLTLLSNRLTAS-VQLIAALGG 484

Query: 449 GYN 451
           G++
Sbjct: 485 GWD 487


>gi|237752859|ref|ZP_04583339.1| cation efflux system protein cusC [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229375126|gb|EEO25217.1| cation efflux system protein cusC [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 474

 Score =  166 bits (419), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 121/460 (26%), Positives = 223/460 (48%), Gaps = 25/460 (5%)

Query: 11  FIVLLA----GCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVK 66
           F+ +LA    GC++ P+Y+KP   L   +  + NS+ ++ I   KWWE F DT LN  V+
Sbjct: 12  FVAILALGFGGCSLSPKYSKPTTNLPDIKEGLQNSE-VLEIKE-KWWEDFGDTQLNVFVE 69

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDS---- 122
            AL  N  +L A ERI  A+      R+D +PS   S       N K  + GQ ++    
Sbjct: 70  EALVNNYDLLVAMERIEQARAQWGYARSDRYPS--LSAQGEATRNRKNLNLGQRENYNNF 127

Query: 123 ------DWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERIS 175
                  +++DL+G+ R  + S+LA L +  A  D+ +L++++ ++ SY        ++ 
Sbjct: 128 SLSAVLSFELDLWGRARDADRSALAKLLAIKANGDMVRLSLVANIMQSYFGVLTLNNQVQ 187

Query: 176 IAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIST 235
           I+   L    +N E    +F  G  S++ + + ++E+ S+++ + +L             
Sbjct: 188 ISQNTLKSRTENYEYRKKEFEAGKISEIDMQQAKSEMASVQAQLQSLLMEQNSAQSAFLI 247

Query: 236 LLGYPATEFLHYMQKQSNNFQPNLYIP-INIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
           LLG           K     Q  +  P I  G+P+ +++ RPDI   E+ L  +   IG+
Sbjct: 248 LLGRDGKGMFE--NKIPTKPQALVSAPSIKAGLPSSILQKRPDIEAAEQNLKAANFSIGV 305

Query: 295 AKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           A+S  +P++SL G         +  F   N+ W+FG      + D G+  +N+  A+S  
Sbjct: 306 ARSVYFPTISLTGLFGYASPQLNELFRTSNSTWNFGGNFIGNLLDFGRTSANVDLAKSQY 365

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           +E  +T+ +T+  A  EV  +L ++    + +  L+  VE  ++++ L+ + Y +G  S 
Sbjct: 366 REMLLTYGQTLRTAFGEVRESLFNVQMTNQRLNSLKEQVEALQRTLELANLRYAEGYVSY 425

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           L++L  + A    E++   A+ +   + + LY A G G++
Sbjct: 426 LEVLSTQSALFAAELEQEGARLESLSATISLYKAFGGGWD 465


>gi|83747315|ref|ZP_00944356.1| OprM [Ralstonia solanacearum UW551]
 gi|207739107|ref|YP_002257500.1| outer membrane chanel lipoprotein [Ralstonia solanacearum IPO1609]
 gi|83726015|gb|EAP73152.1| OprM [Ralstonia solanacearum UW551]
 gi|206592480|emb|CAQ59386.1| outer membrane chanel lipoprotein [Ralstonia solanacearum IPO1609]
          Length = 522

 Score =  166 bits (419), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 120/465 (25%), Positives = 215/465 (46%), Gaps = 37/465 (7%)

Query: 20  VGPEYTKPHMPLL--PTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQ 77
           VGP+Y  P +  +  P  +      +   +   +WWE F+DT+L +L++ A   + T+ Q
Sbjct: 33  VGPDYRTPRLAGVEAPAGWHATLPHHGSRMMLARWWEQFHDTALTQLIEQAGADSPTLAQ 92

Query: 78  ATERINAAKENILSVRADLFPSSYASIS---------HRFI--------------PNLK- 113
           A  R+  A+ ++ S RA L P    S S          +F+              P L  
Sbjct: 93  AVGRVREARASVSSSRAALLPQLKGSGSAVRQGGFGGSQFLGGAGGTGVSSTSVSPTLGL 152

Query: 114 ---TNSTGQLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
              T      D+ W++DLFG +RR +E + A L+++ A    A++ + +++  +Y+  R 
Sbjct: 153 GTFTTLAASADASWELDLFGGKRRGLEGADARLEASLADWHDARVTLSAEVANTYLQQRE 212

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
            +  ++I    L   ++ ++L+  KF  G  +   L + +A +    + + +        
Sbjct: 213 CEALVAIGETTLASRRETLQLTERKFGAGFVAPADLAQAQATVADATNALESQRAQCEQG 272

Query: 230 VHNISTLLG--YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
           +  + TL G  + A   L    K      P+   P    +PA ++  RPD+   E+ +A 
Sbjct: 273 LDQLVTLTGLDHAALAALLAPGKGRMPAPPDAGAPD---VPAQVLSQRPDVSSAERAVAG 329

Query: 288 SVAKIGIAKSDLYPSLSLNGSIAL-THDNSFPGYNTH-WSFGPKLYLPIFDKGKIKSNIR 345
           + A IG+A +   PSL+L GSI + T   S     T  WSFGP + LP+FD G   + + 
Sbjct: 330 ASADIGVAVASRLPSLTLAGSIGINTFQISGQSLTTKSWSFGPSVSLPVFDGGSGAARVE 389

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
            A +   +    ++  V  A++EVE+AL  ++   + +     A   + K +  +   YR
Sbjct: 390 TARARYDQALAGYRAKVRQAVQEVEDALVRLDAAGRRLDAATVADAQYIKVLEAASARYR 449

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            G  SLL + D+ R T      L+  + + A+++V LY A+G G+
Sbjct: 450 LGAGSLLQLEDVRRTTLSASQALAAVQLERAQAWVALYKAVGGGW 494


>gi|107026811|ref|YP_624322.1| RND efflux system, outer membrane lipoprotein, NodT [Burkholderia
           cenocepacia AU 1054]
 gi|116691996|ref|YP_837529.1| RND efflux system outer membrane lipoprotein [Burkholderia
           cenocepacia HI2424]
 gi|170736010|ref|YP_001777270.1| RND efflux system outer membrane lipoprotein [Burkholderia
           cenocepacia MC0-3]
 gi|105896185|gb|ABF79349.1| RND efflux system, outer membrane lipoprotein, NodT [Burkholderia
           cenocepacia AU 1054]
 gi|116649996|gb|ABK10636.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia cenocepacia HI2424]
 gi|169818198|gb|ACA92780.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia cenocepacia MC0-3]
          Length = 495

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 123/479 (25%), Positives = 223/479 (46%), Gaps = 46/479 (9%)

Query: 13  VLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK-----WWESFNDTSLNKLVKI 67
            LLAGCTVGP+Y     P  P   +   +     +DT       WW + ND  L+ L+  
Sbjct: 19  CLLAGCTVGPDYHG--APAAPDASTFVRAP-ATGVDTASPAPSAWWHALNDRQLDALIVA 75

Query: 68  AL---------------------QQNLTILQATERINAA---KENILSVRADLFPSSYAS 103
           AL                     QQ    +  +    AA   +E  +S    L PS+ + 
Sbjct: 76  ALVYNPDLHAAQARLRAARAQLSQQRAAQMPKSSATVAAIRMREPDVSALGSLLPSNGSE 135

Query: 104 ISHRFIPNLKTNSTGQL-----DSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVI 157
            S    P+L  +   QL     D+ W+IDLFG  RR +E++ A  ++  A +   ++++ 
Sbjct: 136 QSGGTSPSLGGSGPLQLYSAGFDATWEIDLFGGTRRAVEAASAQAEAVDADLADTQVSIA 195

Query: 158 SKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIES 217
           +++  +Y+D R  ++R++++ +   L ++ +EL+  +  +G  +   + +L  ++++  +
Sbjct: 196 AEVANAYVDLRDQQQRLALSKRTAQLQQQMLELTQQRRARGVAADADIERLTTQVENTRA 255

Query: 218 DIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPD 277
            +  L+     ++  ++ L G  A   L       +   P L   + IG PA L++ RPD
Sbjct: 256 SLIPLDAQVTESLDRLAILTGR-APGALDAALSTPDAALPTLPGSVAIGDPATLLKQRPD 314

Query: 278 IRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGY-----NTHWSFGPKLYL 332
           IR  E++LA S A+IG   +D +P ++L G +  +  +  PG+     N  W   P L  
Sbjct: 315 IRAAERRLASSNAQIGEHVADYFPKVTLLGDLGFSATD--PGHLFRKQNFTWVGAPYLQW 372

Query: 333 PIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVEL 392
            I D G+ +  +R AE+S  E    +Q+ VL A+++   AL      ++ V  L      
Sbjct: 373 NILDFGRTRGAVRAAEASRDEAEANYQKAVLGALQDANTALQRYGHQREHVVALTKVQTS 432

Query: 393 HKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
              S +L    YR G  S++D+LD +R     + ++   + +L K+YV +  ++G G+ 
Sbjct: 433 AVHSRALMDQRYRAGVASMIDLLDTQREAFAAQQNVIAGQAELIKNYVSVQKSLGLGWQ 491


>gi|330809644|ref|YP_004354106.1| outer membrane efflux protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327377752|gb|AEA69102.1| putative outer membrane efflux protein [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 493

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 117/472 (24%), Positives = 225/472 (47%), Gaps = 43/472 (9%)

Query: 10  LFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLIN----IDTLKWWESFNDTSLNKLV 65
           L + +L+ C VGP+Y +P     P Q+         N    +    WWE + D  LN LV
Sbjct: 26  LCVAMLSACAVGPDYQRPQAAA-PVQYKEAQGWRQANPSDAMARGAWWELYGDAQLNGLV 84

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH---------------RFIP 110
                 N T+ QA  +   A+  + + R   FP+   ++                     
Sbjct: 85  NQLNASNQTVAQADAQYRQARALVRNARGAFFPTVDLTVGKTRSSQGTGSSSSSLSSSSS 144

Query: 111 NLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
            ++     Q    W+ D++G+ RR +E+  A+  +++A +   +L+  S+L+ +Y+  R 
Sbjct: 145 GIRDTYNAQAGVSWEADVWGKLRRTLEADEASAQASFADLAAMRLSQQSELVQNYLQLRV 204

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
             E+  +    +D Y+++++++  ++  G + K ++ + + ++K+ + D+  L       
Sbjct: 205 IDEQKRLLQTTVDNYQRSLKMTENQYRAGVSGKDAVAQAQTQLKTTQGDLIDLIWQRAQF 264

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP----INIGIPADLIRNRPDIRYQEKKL 285
            + I+ L+G P  EF         N      IP    I + +P+ L+  RPDI   E+ +
Sbjct: 265 ENAIAVLIGLPPAEF---------NLAETQDIPSLPQIPVALPSQLLERRPDIASAERSV 315

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIAL---THDNSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG+AK+  YP L+L+ S      T+DN     N  WS GP+L + +FD G+  +
Sbjct: 316 MAANANIGVAKAAYYPDLTLSLSGGYSSSTYDNWVSVPNRFWSVGPQLAMTLFDGGQRSA 375

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSIN--EDKKIVTKLQHAVELHKKSMSLS 400
            + R  ++  +   T+++TVL+ ++EVEN +  +   ED+  V   Q A++  ++S+ L+
Sbjct: 376 EVDRTVAAYDQTVATYRQTVLDGLREVENYMIQLKVLEDEARVR--QEALDAARESLRLT 433

Query: 401 MINYRQGRYSLLDILDIERATAKVEVD-LSIAKRQLAKSYVDLYIAIGSGYN 451
              Y+ G  + LD++ ++      E   L + + +L  S V L  A+G G++
Sbjct: 434 QNQYKAGLIAYLDVVTVQATALSNERSVLGLQQSRLIAS-VQLIAALGGGWD 484


>gi|300309818|ref|YP_003773910.1| drug efflux lipoprotein [Herbaspirillum seropedicae SmR1]
 gi|300072603|gb|ADJ62002.1| drug efflux lipoprotein [Herbaspirillum seropedicae SmR1]
          Length = 483

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 121/454 (26%), Positives = 218/454 (48%), Gaps = 20/454 (4%)

Query: 14  LLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNL 73
           +L GC++ P Y +P  P+  +  +    +  +    L W + F D  L +L+  AL+ N 
Sbjct: 24  VLGGCSLAPTYERPQAPVESSYPADAAGRAELQAVNLGWRQFFPDQRLQQLIAAALENNR 83

Query: 74  TILQATERINAAKENILSVRADLFPS-----------SYASISHRFIPNLKTN-STGQLD 121
            +  A   I  A+      RADL P+           + AS S    P +  +   G   
Sbjct: 84  DLRTAVLNIEEARAQYQIARADLLPNLNLSGNAARTRTAASQSLTGQPTISNSYQVGLAV 143

Query: 122 SDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI 180
             +++D FG+ R++ +++LA+  S       A++++++++  +Y+  R + E++ +A + 
Sbjct: 144 PAYELDFFGRVRNLKDAALASYLSTEEAQKSAQISLVAQVAQAYLAERSYAEQLKLADET 203

Query: 181 LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP 240
           L   + N++L+  +   GA++ L     +  ++S       LE+  R    N  TLL   
Sbjct: 204 LKSRQSNLDLAQKRLDVGASTALDFRLTQTLVESARVAKTQLERQ-RAQAENALTLLVGK 262

Query: 241 ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLY 300
               L   Q  S+     +   I  G+P+DL+ NRPDIR  E+ L  + A IG A++  +
Sbjct: 263 KIGELPPAQLLSDE---KIVTDIPAGLPSDLLTNRPDIRSAEQSLLAANANIGAARAAFF 319

Query: 301 PSLSLNG---SIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYIT 357
           P +SL G   S + T    F   +  WSFGP L LPIFD G+  +N+  AE    +  +T
Sbjct: 320 PRISLTGNFGSASSTLGGLFESGSGAWSFGPSLSLPIFDFGRNSANLDLAEVRKNKAVVT 379

Query: 358 WQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDI 417
           +++ +  A +EV +AL +     + V   +  +   ++ + L+ + ++ G  S LD LD 
Sbjct: 380 YEKAIQTAFREVADALVARGSLDEQVKAQEAFLAAQQERLKLTDLRFKNGIASSLDQLDA 439

Query: 418 ERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +R     +  L  A++    + +DLY A+G G N
Sbjct: 440 QRDLFSAQQALIQARQLRLNNAIDLYKALGGGLN 473


>gi|209521511|ref|ZP_03270214.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. H160]
 gi|209498041|gb|EDZ98193.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. H160]
          Length = 503

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 121/465 (26%), Positives = 229/465 (49%), Gaps = 28/465 (6%)

Query: 8   FSLFIVLLAGC-TVGPEYTKPHMPLLPTQF--SIGN----SKNLINIDTLKWWESFNDTS 60
            ++ I LLAGC ++ P + +P MP+ P  F  + GN     +N      + W + F D +
Sbjct: 20  LAVLIALLAGCVSLAPPFERPPMPV-PATFPDAHGNPTTGGENAPGAAAVGWQDYFIDPT 78

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS--SYASISHRFIPN------- 111
           L +L+  AL+ N  +  A +R+  A+      RAD FP+    A ++   +P        
Sbjct: 79  LQRLIGEALEYNRDLRLAIQRVEEARAMYGIRRADQFPTIGMEADLARARVPADLSGVGR 138

Query: 112 -LKTNS--TGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
            +  N    G   + W++D +G+  ++ E++L N  ++ A      L VI ++  +Y++ 
Sbjct: 139 AVTANQFQVGVGLASWELDFWGRVANLKEAALQNYLASDAARQAVTLTVIEQVANNYLNL 198

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
           R   ERI + ++ +   +K+  +   ++  G+TS+L L ++E   +   +    L++   
Sbjct: 199 RELDERIMLMNETIASREKSYRIFKHRYEVGSTSRLDLKQVETLWRQAVALGTQLQQERA 258

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
             ++ +  L+G P  +  H   + ++N    +   +  G+P+DL+ NRPDI   E +L  
Sbjct: 259 TRLNALQVLVGKP-VDLPHEDIRLNDN---AVMADLPAGLPSDLLVNRPDIVSAEYQLRA 314

Query: 288 SVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNI 344
           + A IG A+++ +P ++L GS        DN F G +  WSFGP + LPIFD G+ ++N+
Sbjct: 315 ANANIGAARAEFFPKITLTGSFGTASTQLDNLFTGPSRAWSFGPSVSLPIFDMGRREANL 374

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
              ++   +   +++  V +A ++V +A+ +     + V  L+   E   +   L+ + Y
Sbjct: 375 DVTKAQRDQAVTSYELAVQSAFRDVADAIAARQWLAEQVDALRATEEAQAERARLAQMRY 434

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
             G    L++LD +R     +  L   +R L  S V L+ A+G G
Sbjct: 435 DHGASPFLEVLDAQRDLLAAQQQLVETRRALLSSRVSLFSALGGG 479


>gi|154491095|ref|ZP_02031036.1| hypothetical protein PARMER_01017 [Parabacteroides merdae ATCC
           43184]
 gi|154088515|gb|EDN87559.1| hypothetical protein PARMER_01017 [Parabacteroides merdae ATCC
           43184]
          Length = 456

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 119/460 (25%), Positives = 228/460 (49%), Gaps = 30/460 (6%)

Query: 10  LFIVL-----LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKL 64
           +FIVL     L  C +G +Y +P + L P +   G   +  +ID++ W   + DT+L +L
Sbjct: 7   IFIVLSLALALPSCKIGKKYARPELDL-PEEIVAG--ADTASIDSISWQSLYVDTTLQRL 63

Query: 65  VKIALQQNLTILQATERINAAKENILSVR---ADLFPSSYASI---SHRFI-----PNLK 113
           + IAL  N  +  A  ++   KE I S R   AD FP   A I     R       P   
Sbjct: 64  ITIALDNNKDMKIAVAKV---KEMIASKRITFADQFPEIGARIYGQKERLNYGGDNPKPD 120

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
           +    +L   W++DL+G  R   E+ +A    +       ++ +++++  +Y +     +
Sbjct: 121 SEYGAKLALSWELDLWGNLRWANEAGIAAYLQSVEARHALQMTLVAEVAAAYYELCALDQ 180

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
              I    L   ++ + L+ L+F  G TS+ S  + + E+   E+ +P+LE+  ++  ++
Sbjct: 181 EQDIVRHTLAARREGVRLAKLRFEGGLTSETSYSQAQVELARTETLLPSLEQKIKIKEND 240

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           ++ LLG  + +    +  +  +    L     +G+P+ L+  RPD+R  E+KL ++ A +
Sbjct: 241 LAFLLGQYSGDIPRGLPLREQHLLETL----PVGLPSSLLERRPDMRQAEQKLREANAGV 296

Query: 293 GIAKSDLYPSLSLNGSIALTHD--NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESS 350
           G+A++DL+P +SL G++   ++   +F   +  W     L  P+F  GK K+ ++ A + 
Sbjct: 297 GVAQTDLFPKISLTGNLGFENEELTNFIK-SPAWFLAGDLLQPLFAMGKNKAKLKAARAR 355

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
            +++   +Q++VL+  KEV NA+ +I + K++    +  +      + L+ + Y  G  S
Sbjct: 356 YEQEVYNYQKSVLSVFKEVNNAIVTIRKAKEVRMSYEKLLNAADTYLQLAQLQYINGVTS 415

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            +D+LD +R     ++ L+ A      S V LY A+G G+
Sbjct: 416 YMDVLDAQRGLLDAQLSLNKAMLDELLSTVYLYKALGGGW 455


>gi|91774525|ref|YP_544281.1| RND efflux system, outer membrane lipoprotein, NodT
           [Methylobacillus flagellatus KT]
 gi|91708512|gb|ABE48440.1| RND efflux system, outer membrane lipoprotein, NodT
           [Methylobacillus flagellatus KT]
          Length = 493

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 116/453 (25%), Positives = 224/453 (49%), Gaps = 29/453 (6%)

Query: 17  GC-TVGPEYTKPHMPLLP--TQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNL 73
           GC ++ P+Y +P  P+     Q   G +    +  +L W + F DT+L  L++ AL  N 
Sbjct: 30  GCQSMAPDYERPAAPVAEHFPQAGTGTA----DAPSLAWQDYFADTTLQDLIQEALANNR 85

Query: 74  TILQATERINAAKENILSVRADLFPS--SYASISHRFIPN----------LKTNSTGQLD 121
            +  A +R+  A+      RADLFP   +  S      P           L     G   
Sbjct: 86  DLRSAIQRVEGARALYGVQRADLFPGLNAQGSFGRSRTPEDMSLIGRPMVLSEYRVGFGI 145

Query: 122 SDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI 180
           ++W++D +G+ R + +++L    +A +    + +++++++  SY++ R   +RI IA + 
Sbjct: 146 TNWELDFWGRIRSLRDAALETFLAAESAQRASAISLVAQVANSYLNLRELDQRILIAEKT 205

Query: 181 LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP 240
           ++  ++++ +   +F  G+TSKL L +++A +   ++    L++S  + ++ ++ L+G P
Sbjct: 206 IESRQESVRIFQRRFDVGSTSKLDLKQVQALLAQAQTLRYQLQQSRAIELNALTLLVGKP 265

Query: 241 ATEFLHYMQKQSNNF-QPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDL 299
                  +   S+ F +  +   +  G+P+D++  RPDI   E  L  + A IG A++  
Sbjct: 266 VD-----LPPASHAFSETKMLHQLKPGLPSDVLTQRPDIIAAEHILKSANANIGAARAAF 320

Query: 300 YPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYI 356
           +P ++L  S+       D  F   +  WSF P + LPIFD  + +SN+  A         
Sbjct: 321 FPRVTLTTSLGTASRELDGLFDTGSHAWSFAPSISLPIFDGWRNRSNLELANVRRDLAVT 380

Query: 357 TWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILD 416
           ++++T+  A +EV +AL + +  ++ +   Q  ++   +   L+ + Y  G  S  ++LD
Sbjct: 381 SYEQTIQTAFREVADALAAQHSIRQQLVSQQEMLDAQAERARLAKLRYDHGATSYFEVLD 440

Query: 417 IERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
            ER+  +VE  L   +R L  S V LY A+G G
Sbjct: 441 AERSLLEVEQQLVQMQRALFSSQVSLYAALGGG 473


>gi|237748467|ref|ZP_04578947.1| RND efflux system outer membrane lipoprotein [Oxalobacter
           formigenes OXCC13]
 gi|229379829|gb|EEO29920.1| RND efflux system outer membrane lipoprotein [Oxalobacter
           formigenes OXCC13]
          Length = 487

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 117/468 (25%), Positives = 226/468 (48%), Gaps = 37/468 (7%)

Query: 7   IFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVK 66
           I + F   L GC +GP+Y +P MP   +   + +  +   +D+ +WWE F D  LN +V+
Sbjct: 10  IVAAFSASLGGCMMGPDYRRPDMPTPQSYRFMPDQASQQALDS-RWWEDFGDPVLNGMVE 68

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFP--SSYASISHR-----------FIPNLK 113
            A+  N  +  A      A   I+  RA LFP  ++ A +               +PN +
Sbjct: 69  EAIANNRDLKAALANSEKAAAAIMQTRAGLFPQINATAQVGRERLSEMDAEPVIGVPNPQ 128

Query: 114 TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
              +  L + W+IDL+G+ RR  E++ A+  +       A L+++S ++  Y++     E
Sbjct: 129 NAKSASLGASWEIDLWGKIRRMTEAAEADAKAMEQTRRAALLSIVSNVVTQYVNLLALDE 188

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
           ++ IA      Y++++ +  L+F  G TS++++ +  ++ ++ +S IP +  +     + 
Sbjct: 189 QLKIAQNTSANYRESLRIIDLQFKYGVTSQMTVAQAASQYETAQSQIPQIRHNITQTENA 248

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRN----RPDIRYQEKKLADS 288
           I+ L G            +  +    L  P+   +PADL  N    RPDI   E+ L  +
Sbjct: 249 INILRGRNPGAV------ERGSTLATLKTPV---VPADLPSNLLLRRPDILSAEQDLVAA 299

Query: 289 VAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
            A IG  ++  +P++SL G+   + +   N F G +  WSF   + LPIF  G I S ++
Sbjct: 300 NAMIGATRAMYFPTISLTGAFGTSSEHLRNLFKGPSKAWSFAGGISLPIFQGGSIYSQVK 359

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALT---SINEDKKIVTKLQHAVELHKKSMSLSMI 402
           +AE+  +     ++  V +A  +V+NAL+    +NE     T+L + ++ + +   L+ +
Sbjct: 360 QAEAGQRAALARYEGAVQSAFADVDNALSYRQRVNEQLDKETRLVNQLKDYSR---LAKL 416

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            Y +G  +   +L  +++    ++ L+  +     S V +Y ++G G+
Sbjct: 417 QYDEGYSAYSVVLQADQSLFPRQLTLAQLRASSLTSVVGVYKSMGGGW 464


>gi|237801370|ref|ZP_04589831.1| outer membrane efflux protein [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331024229|gb|EGI04286.1| outer membrane efflux protein [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 364

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 100/337 (29%), Positives = 183/337 (54%), Gaps = 7/337 (2%)

Query: 120 LDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAH 178
           LD  W++DLFG+ +R +E+S A+ D+A A +   ++ +I++++ +Y   R  + R +IA 
Sbjct: 29  LDMAWEVDLFGRIQRQLEASDADQDAAEANLYQLQVTLIAEVVDAYGQLRGAQLREAIAK 88

Query: 179 QILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG 238
             L   +K+ +++      G  ++L +++ +A + ++E+ +P L+       H I+TLLG
Sbjct: 89  DNLTNQQKSQDITTQLRDAGVGNELDVMRSDARLAAVEATVPQLQAEQARQTHRIATLLG 148

Query: 239 YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSD 298
                    +   S +  P +   + IG    ++RNRPD+R  E++LA S A+IG+A +D
Sbjct: 149 ERPESLSVDL---SPSKLPAIAKALPIGDATQVLRNRPDVRAAERQLAASTARIGVATAD 205

Query: 299 LYPSLSLNGSIALTHD-NSFPGYNTH--WSFGPKLYLPIFDKGKIKSNIRRAESSAQEQY 355
           L+P +SL+G +  T    S  G +    WS GP +    FD G +++ IR A++ A+   
Sbjct: 206 LFPRVSLSGFLGFTAGRGSQIGSSAARAWSLGPSITWAAFDLGSVRAQIRSADADAEGAL 265

Query: 356 ITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDIL 415
             +++ VL A++E ENA +  N+ ++ +  L    E  + +  L+ + YR+G    L +L
Sbjct: 266 ANYEQQVLLALEESENAFSDYNKRQQRLVALMRQSESSRAAARLASVQYREGTADFLVLL 325

Query: 416 DIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           D ER     E   + A+  L +  V +Y A+G G+ P
Sbjct: 326 DAERERLAAEDSQAQAEIDLYRGIVAIYKALGGGWQP 362


>gi|288573271|ref|ZP_06391628.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288569012|gb|EFC90569.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 525

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 116/425 (27%), Positives = 208/425 (48%), Gaps = 33/425 (7%)

Query: 52  WWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN 111
           WW S  D +L +L+  +L+ N  +  A      A+  +   +A L P  +   +  F  N
Sbjct: 69  WWNSLGDETLTRLILASLENNRDMASARSSFAEARAALGISKAALLP--WLDSAGSFT-N 125

Query: 112 LKTNSTGQL---------------DSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLN 155
           +KT     L               D+ W+IDLFG Q   I++S A+L + Y  +  + ++
Sbjct: 126 MKTGENASLTGSQVGPIDLYKLGIDASWEIDLFGGQALKIKASAADLQARYGALHNSWVS 185

Query: 156 VISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSI 215
           + S++  +YI  R  ++R+ +A + L L    +EL   ++  G   +L+L + +  ++  
Sbjct: 186 LSSEVALNYISLRTLQKRLMVAEKNLGLQNATLELLQSQYDSGLADELALSQAKYTMEQT 245

Query: 216 ESDIPTLEKSFRMNVHNISTLLG-YP---ATEFLHYMQKQSNNFQPNLYIPINIGIPADL 271
            S IP ++      ++ ++ L+G  P   A E   Y +       P+      +GIPAD 
Sbjct: 246 RSSIPPIKTGIEEAMNRLAILVGQVPGSLAEELFDYEE------LPDPEKIDLVGIPADF 299

Query: 272 IRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTH----WSFG 327
           IR RPDI   E++LA  +A+   ++ D  P  SL GSI L   +S  G +      +S G
Sbjct: 300 IRQRPDIYMAERQLAAQIARKDASRKDFLPKFSLFGSIGLESYSSAGGLSVSDGGVYSIG 359

Query: 328 PKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQ 387
           PK+  PIF  G I+ NI+      ++    +++TVLNA+ EV NALT+  +++     L 
Sbjct: 360 PKISWPIFHGGAIRKNIKVQTEKQKQALANYEQTVLNAVAEVRNALTAETQERLRNESLG 419

Query: 388 HAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIG 447
             VE    +M+++   Y  G     +++  +RA   +E  L++++ ++  + V ++ A+G
Sbjct: 420 RGVESAASAMAVAEDQYVNGLTDFNNVIIAQRALLDLEEQLAVSEGEMLSNLVRIFKALG 479

Query: 448 SGYNP 452
            G+ P
Sbjct: 480 GGWAP 484


>gi|253995459|ref|YP_003047523.1| NodT family RND efflux system outer membrane lipoprotein
           [Methylotenera mobilis JLW8]
 gi|253982138|gb|ACT46996.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Methylotenera mobilis JLW8]
          Length = 498

 Score =  165 bits (417), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 134/470 (28%), Positives = 234/470 (49%), Gaps = 38/470 (8%)

Query: 14  LLAGCTVGPEYTKPHMPLLP----TQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIAL 69
           +L+ C VGPEY K    L P     Q ++ N K   N D  KWWE F D  L + V +AL
Sbjct: 15  ILSSCAVGPEYKKVDASL-PDHYLGQVALDNRKATTNADFAKWWEGFGDPQLTQFVALAL 73

Query: 70  QQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKT--NSTGQL------- 120
            QN  I QA  RI  AK  + +  A L PS   +IS + I N ++  +  GQL       
Sbjct: 74  AQNFDIAQAQARIQQAKSGLSAAHAALIPSG--NISAQTIRNHQSLESPLGQLLNATPGY 131

Query: 121 -----------DSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
                      ++ W++D+FG  +R   ++LA   +A A     +L V ++   +YI  R
Sbjct: 132 NRDANLYEANFNASWELDIFGGLKREQNAALAEYQAAKAGAVATRLAVAAQTADTYITIR 191

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
             + R+ IA + L+  ++ +   ++  ++G   KL + + EA +  +E+ IP LE    +
Sbjct: 192 GLQSRLDIAKKQLETQQQLVTKVNILHSRGLAPKLQVQQAEAAVAQVEATIPVLEAGLDV 251

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP--INIGIPADLIRNRPDIRYQEKKLA 286
            ++ +  +LG    ++    + + + F+P    P   ++G PADL++ RPD+   E+KLA
Sbjct: 252 AMNALDVMLGAAPGKY----RSELSTFKPIPAAPQIASVGSPADLLQRRPDLIVAERKLA 307

Query: 287 DSVAKIGIAKSDLYP----SLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKS 34