BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780930|ref|YP_003065343.1| nodulation protein (outer
membrane efflux protein) [Candidatus Liberibacter asiaticus str.
psy62]
         (452 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780930|ref|YP_003065343.1| nodulation protein (outer membrane efflux protein) [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040607|gb|ACT57403.1| nodulation protein (outer membrane efflux protein) [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 452

 Score =  286 bits (730), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 452/452 (100%), Positives = 452/452 (100%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS
Sbjct: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL 120
           LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL
Sbjct: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL 120

Query: 121 DSDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI 180
           DSDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI
Sbjct: 121 DSDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI 180

Query: 181 LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP 240
           LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP
Sbjct: 181 LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP 240

Query: 241 ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLY 300
           ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLY
Sbjct: 241 ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLY 300

Query: 301 PSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQE 360
           PSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQE
Sbjct: 301 PSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQE 360

Query: 361 TVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERA 420
           TVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERA
Sbjct: 361 TVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERA 420

Query: 421 TAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           TAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP
Sbjct: 421 TAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452


>gi|315122644|ref|YP_004063133.1| nodulation protein (outer membrane efflux protein) [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313496046|gb|ADR52645.1| nodulation protein (outer membrane efflux protein) [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 452

 Score =  271 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 336/452 (74%), Positives = 398/452 (88%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           MNIL+  FS+ +VLLAGC VGPEYTKP MP LPTQFSIG S + IN+DTLKWWESFNDT 
Sbjct: 1   MNILKINFSILVVLLAGCAVGPEYTKPQMPRLPTQFSIGKSNSPINVDTLKWWESFNDTC 60

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL 120
           LNKLV IALQQNLTIL+ATERIN+AKENIL+V+ADLFPS   S+S++ +P   TNSTG++
Sbjct: 61  LNKLVNIALQQNLTILKATERINSAKENILAVKADLFPSLQTSVSYQIMPKSDTNSTGRV 120

Query: 121 DSDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI 180
            SDWKIDLFGQ+R +ES+LAN DS YAQ +IAKL +I+KLI +YIDARHF+ERISIAH+I
Sbjct: 121 HSDWKIDLFGQKRRMESALANFDSVYAQSEIAKLTIIAKLISTYIDARHFQERISIAHKI 180

Query: 181 LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP 240
           LDLYK+N++L+ LK  +GA SKL L+KLEAE+KSIES+IP LEK FR+NVHNISTLLG+ 
Sbjct: 181 LDLYKRNLKLTRLKLFEGAISKLPLIKLEAELKSIESEIPNLEKGFRVNVHNISTLLGHS 240

Query: 241 ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLY 300
           AT+FL Y+QKQ   FQPNLY+ INIGIPADLIRNRPDIRY+EK +ADS+AKIGIAK+DLY
Sbjct: 241 ATDFLAYIQKQKKPFQPNLYMKINIGIPADLIRNRPDIRYREKNIADSIAKIGIAKADLY 300

Query: 301 PSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQE 360
           P++SLNG I+LTHDN  PGY++ WSFGPKLY+PIFD  KI+SNIRRAES A EQYI WQE
Sbjct: 301 PAISLNGFISLTHDNISPGYHSGWSFGPKLYVPIFDGQKIRSNIRRAESFAHEQYIAWQE 360

Query: 361 TVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERA 420
           TVLNA+KEVE+AL SIN+DKK+VT LQ+ VEL+K++MSLS I+YRQG+YSL+D+LDIE+ 
Sbjct: 361 TVLNAVKEVEDALISINQDKKVVTALQNTVELYKQAMSLSTISYRQGKYSLIDLLDIEKT 420

Query: 421 TAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           TAK EVDLSIAKRQLAKSYVDLY+AIGSGYNP
Sbjct: 421 TAKAEVDLSIAKRQLAKSYVDLYVAIGSGYNP 452


>gi|146298670|ref|YP_001193261.1| RND efflux system outer membrane lipoprotein [Flavobacterium
           johnsoniae UW101]
 gi|146153088|gb|ABQ03942.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Flavobacterium johnsoniae UW101]
          Length = 455

 Score =  225 bits (572), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 115/458 (25%), Positives = 221/458 (48%), Gaps = 11/458 (2%)

Query: 1   MNILRAIFSLFIVLLA--GCTVGPEYTKPHMPLLPT-QFSIGNSKNLINIDTLKWWESFN 57
           M  L+ + ++F++ +   GC VGP+Y KP  P   + ++S  ++ +  ++ T+KW   FN
Sbjct: 1   MKTLKILLAIFLIAVFPYGCMVGPKYAKPEQPQTDSFRYSNQSADSTKSVTTIKWSSIFN 60

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST 117
           D  L  L++  +Q N  +  A  R+   + N+   +ADLFP+   S            S+
Sbjct: 61  DDVLIGLIEKGIQNNYDLKIAIARLEQVQANLGMAKADLFPAFQYSGQVNSAETFMQPSS 120

Query: 118 GQLDSDWKIDLFGQR-RHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISI 176
              +  W++D +G+     ++    L ++     +   N++S +  SY + R F  ++ I
Sbjct: 121 VFANMSWELDFWGKYRHQTKALQNELLASDEARKVVLSNIVSTIATSYFELRDFDNQLEI 180

Query: 177 AHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL 236
               L+  +K  ++ + +F  G  ++L  V++E ++   E++IP +++      ++IS L
Sbjct: 181 TIHTLETRQKAYDIINERFISGYVAELDKVQIEQQVAIAEANIPLIKRQITALENSISIL 240

Query: 237 LGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
           +G         + +   N +  +       +P+ L+ NRPD++ QE     +  +IG+A+
Sbjct: 241 VGQVP----QPIPRGKTNSELLILTEFPTSVPSALLENRPDVKRQEYLYKAAFERIGVAQ 296

Query: 297 SDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQE 353
           +  YPS ++            + F   +   + G  +  PIF+ GK K  +      A+E
Sbjct: 297 ALRYPSFNIGALAGFASITVGDLFNDGSYTQNVGAGVAGPIFNFGKNKRRVEVNRQIAEE 356

Query: 354 QYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLD 413
               +Q+T L AI EVEN+L ++   K+  T     V   +K+  LS   Y  G  S L+
Sbjct: 357 MKFNFQKTYLTAISEVENSLQNVAMFKEEWTARNRQVVAAQKNYDLSNARYYNGYVSYLE 416

Query: 414 ILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +LD +R+  + ++ LS   ++   S V LY A+G G++
Sbjct: 417 VLDAQRSLFEAQLSLSQLTQKQLSSMVQLYKALGGGWS 454


>gi|289677852|ref|ZP_06498742.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. syringae FF5]
          Length = 486

 Score =  225 bits (571), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 103/470 (21%), Positives = 206/470 (43%), Gaps = 24/470 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL----INIDTLKWWESF 56
           M+      ++   +L GC++ P+Y +P  P+            +    +      W   F
Sbjct: 1   MSKSLISLAVTAFILGGCSLIPDYKQPEAPVAAQYPQGPAYSPVEGAKMAAAEQGWRHFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           ND +L +L++ AL  N  +  A   I+A +      R+DLFP+  A+ S          S
Sbjct: 61  NDPALQQLIQTALLNNRDLRVAALNIDAYRAQYRIQRSDLFPAVSATGSGSRQRVPGDQS 120

Query: 117 TGQLD------------SDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPS 163
                            S +++DLFG+ R + E +L    ++       ++++++ +  +
Sbjct: 121 QTGQPGITSSYSATLGVSSYELDLFGRVRSLSEQALETYFASEEARRSTQISLVASVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  +  KE + +    L  Y+++  L+      G +S L L +    ++S  + +   +
Sbjct: 181 YMTWQADKELLKLTQDTLKTYEESFRLTSRASEVGVSSALDLSQSRTAVESARAKLAQYQ 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    + +++  LLG    + L      S+    ++   +  G+P+DL++ RPDI   E 
Sbjct: 241 RLVAQDQNSLVLLLGTSLPDNL----PASHLLDSDMLTEMPAGLPSDLLQRRPDILEAEH 296

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  S   +       F G +  W F P + +PIF+ G +
Sbjct: 297 SLKAANANIGAARAAFFPSISLTASAGTSSSELSGLFKGGSGAWLFQPSINIPIFNAGNL 356

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++++  ++   +     +++ +  A +EV + L S     + +   +  V  ++    L+
Sbjct: 357 RASLDYSKIQKEISVANYEKAIQTAFQEVSDGLASRKTYDEQLQAQRDFVAANQDYYRLA 416

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              YR G  S L  LD +R+    +  L   +     S V+LY A+G G+
Sbjct: 417 ERRYRIGIDSNLTFLDAQRSLFSAQQTLITDRLSQLTSEVNLYKALGGGW 466


>gi|330981513|gb|EGH79616.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. aptata str. DSM 50252]
          Length = 486

 Score =  225 bits (571), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 103/470 (21%), Positives = 206/470 (43%), Gaps = 24/470 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL----INIDTLKWWESF 56
           M+      ++   +L GC++ P+Y +P  P+            +    +      W   F
Sbjct: 1   MSKSLISLAVTAFILGGCSLIPDYKQPEAPVAAQYPQGPAYSPVEGAKMAAAEQGWRHFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           ND +L +L++ AL  N  +  A   I+A +      R+DLFP+  A+ S          S
Sbjct: 61  NDPALQQLIQTALLNNRDLRVAALNIDAYRAQYRIQRSDLFPAVSATGSGSRQRVPGDQS 120

Query: 117 TGQLD------------SDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPS 163
                            S +++DLFG+ R + E +L    ++       ++++++ +  +
Sbjct: 121 QTGQPGITSSYSATLGVSSYELDLFGRVRSLSEQALETYFASEEARRSTQISLVASVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  +  KE + +    L  Y+++  L+      G +S L L +    ++S  + +   +
Sbjct: 181 YMTWQADKELLKLTQDTLKTYEESFRLTSRASEVGVSSALDLSQSRTAVESARAKLAQYQ 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    + +++  LLG    + L      S+    ++   +  G+P+DL++ RPDI   E 
Sbjct: 241 RLVAQDQNSLVLLLGTSLPDNL----PASHLLDSDMLTEMPAGLPSDLLQRRPDILEAEH 296

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  S   +       F G +  W F P + +PIF+ G +
Sbjct: 297 SLKAANANIGAARAAFFPSISLTASAGTSSSELSGLFKGGSGAWLFQPSINIPIFNAGNL 356

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++++  ++   +     +++ +  A +EV + L S     + +   +  V  ++    L+
Sbjct: 357 RASLDYSKIQKEINVANYEKAIQTAFQEVSDGLASRKTYDEQLQAQRDFVAANQDYYRLA 416

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              YR G  S L  LD +R+    +  L   +     S V+LY A+G G+
Sbjct: 417 ERRYRIGIDSNLTFLDAQRSLFSAQQTLITDRLSQLTSEVNLYKALGGGW 466


>gi|223938971|ref|ZP_03630857.1| RND efflux system, outer membrane lipoprotein, NodT family [bacterium
            Ellin514]
 gi|223892398|gb|EEF58873.1| RND efflux system, outer membrane lipoprotein, NodT family [bacterium
            Ellin514]
          Length = 1392

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 126/467 (26%), Positives = 213/467 (45%), Gaps = 25/467 (5%)

Query: 6    AIFSLFIVLLAG-CTVGPEYTKPHMPLLPTQFSIGN------SKNLINIDTLKWWESFND 58
            A+  + +V L+    VGP Y +P    +P ++           K L ++   KWWE + D
Sbjct: 906  AVLLITMVALSAKAAVGPNYVRP-TNAVPQEYKAEELGNWKEGKPLDHLPKGKWWEVYED 964

Query: 59   TSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTN--- 115
             +LN+L + A   N  +  A  R+  A+      R +L PS     S             
Sbjct: 965  ATLNELEENASAGNQGLKGAVARVEQARATARVARGELLPSLNFDPSFIRQRFSPNQDPS 1024

Query: 116  --------STGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYID 166
                     +  LD  ++IDL+G+ R   ES+     ++ A      L + S +  +Y  
Sbjct: 1025 FGAITANSFSVPLDLSYEIDLWGRVRRGFESARDQAAASLASYYSVLLTLQSDVAQNYFG 1084

Query: 167  ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
             R     I+   + ++L K+ ++L H ++  G  S+L + + E E+ + E++   L K  
Sbjct: 1085 LRSLDAEIATVARTVELRKEQVQLVHGRYEGGIGSELDMARAETELANAEAEAAGLAKRR 1144

Query: 227  RMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLA 286
                + I+ L+G   +EF   +   +          I  G+PADL++ RPD+   E+ LA
Sbjct: 1145 AELENAIAILVGKIPSEFH--LAAGTAPNWNPQPPTIPAGLPADLLQRRPDVATAERNLA 1202

Query: 287  DSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSN 343
             + A+IG+AK+  +P +SL  S      +    F   +  WS GP + LPIF  G+ K+N
Sbjct: 1203 SANAQIGVAKAAFFPVVSLTASGGYLSGDIETLFNWSSRTWSIGPSISLPIFAGGRNKAN 1262

Query: 344  IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
             RR++++ QE   T+++ VL A  +VEN+L  I    K       AV   +++  L+   
Sbjct: 1263 YRRSKAAYQEAIATYRQQVLVAFGDVENSLAGIYHLAKQSEAQNRAVASAQRAADLATER 1322

Query: 404  YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            YR G  S LD++D +R     E   +    Q   + V L  A+G G+
Sbjct: 1323 YRSGLVSYLDVVDADREALTAERARAQLAGQRLVASVQLIKALGGGW 1369


>gi|320327210|gb|EFW83224.1| NodT family outer membrane efflux lipoprotein [Pseudomonas syringae
           pv. glycinea str. race 4]
          Length = 486

 Score =  224 bits (569), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 106/470 (22%), Positives = 206/470 (43%), Gaps = 24/470 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL----INIDTLKWWESF 56
           M+      ++   +L GC++ PEY +P  P+            +    +      W   F
Sbjct: 1   MSKSLISLAVTAFILGGCSLIPEYKQPEAPVAAQYPQGPAYSPVEGAKMATAEQGWRHFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           ND +L +L++ AL  N  +  A   I+A +      R+DLFP+  A+ S          S
Sbjct: 61  NDPALQQLIQTALLNNRDLRVAALNIDAYRAQYRIQRSDLFPAVSATGSGTRQRVPADQS 120

Query: 117 TGQL------------DSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPS 163
                            S +++DLFG+ R + E +L    S+       ++++++ +  +
Sbjct: 121 QTGQAGITSSYSATLGVSSYELDLFGRVRSLSEQALETYFSSEEARRSTQISLVASVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  +  KE + +    L  Y+++  L+      G +S L L +    ++S  + +   E
Sbjct: 181 YMTWQADKELLKLTQDTLKTYEESYRLTSRSNEVGVSSALDLSQSRTAVESARAKLAQYE 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    + +++  LLG    + L      S+    ++   +  G+P+DL++ RPDI   E 
Sbjct: 241 RLVAQDQNSLVLLLGTSLPDNL----PASHLLDSDMLTEMPAGLPSDLLQRRPDILEAEH 296

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  S   +       F G +  W F P + +PIF+ G +
Sbjct: 297 TLKAANANIGAARAAFFPSISLTASAGTSSSELSGLFKGGSGAWLFQPSINIPIFNAGNL 356

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++++  ++   +     +++ +  A +EV + L S     + +   +  V  ++    L+
Sbjct: 357 RASLDYSKIQKEISVANYEKAIQTAFQEVSDGLASRKTYDEQLQAQRDFVAANQDYYRLA 416

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              YR G  S L  LD +R+    +  L   +     S V+LY A+G G+
Sbjct: 417 ERRYRIGIDSNLTFLDAQRSLFSAQQTLITDRLSQLTSEVNLYKALGGGW 466


>gi|330973524|gb|EGH73590.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. aceris str. M302273PT]
          Length = 486

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 104/470 (22%), Positives = 206/470 (43%), Gaps = 24/470 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL----INIDTLKWWESF 56
           M+      ++   +L GC++ P+Y +P  P+            +    +      W   F
Sbjct: 1   MSKSLISLAVTAFILGGCSLIPDYKQPQAPVAAQYPQGPAYSPVEGAKMAAAEQGWRHFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           ND +L +L++ AL  N  +  A   I+A +      R+DLFP+  A+ S          S
Sbjct: 61  NDPALQQLIQTALLNNRDLRVAALNIDAYRAQYRIQRSDLFPAVSATGSGSRQRVPGDQS 120

Query: 117 TGQLD------------SDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPS 163
                            S +++DLFG+ R + E +L    S+       ++++++ +  +
Sbjct: 121 QTGQPGITSSYSATLGVSSYELDLFGRVRSLSEQALETYFSSEEARRSTQISLVASVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  +  KE + +    L  Y+++  L+      G +S L L +    ++S  + +   +
Sbjct: 181 YMTWQADKELLKLTQDTLKTYEESFRLTSRASEVGVSSALDLSQSRTAVESARAKLAQYQ 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    + +++  LLG    + L      S+    ++   +  G+P+DL++ RPDI   E 
Sbjct: 241 RLVAQDQNSLVLLLGTSLPDNL----PASHLLDSDMLTEMPAGLPSDLLQRRPDILEAEH 296

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  S   +       F G +  W F P + +PIF+ G +
Sbjct: 297 SLKAANANIGAARAAFFPSISLTASAGTSSSELSGLFKGGSGAWLFQPSINIPIFNAGNL 356

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++++  ++   +     +++ +  A +EV + L S     + +   +  V  ++    L+
Sbjct: 357 RASLDYSKIQKEISVANYEKAIQTAFQEVSDGLASRKTYDEQLQAQRDFVAANQDYYRLA 416

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              YR G  S L  LD +R+    +  L   +     S V+LY A+G G+
Sbjct: 417 ERRYRIGIDSNLTFLDAQRSLFSAQQTLITDRLSQLTSEVNLYKALGGGW 466


>gi|66047236|ref|YP_237077.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. syringae B728a]
 gi|63257943|gb|AAY39039.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. syringae B728a]
          Length = 486

 Score =  223 bits (568), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 103/470 (21%), Positives = 206/470 (43%), Gaps = 24/470 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL----INIDTLKWWESF 56
           M+      ++   +L GC++ P+Y +P  P+            +    +      W   F
Sbjct: 1   MSKSLISLAVTAFILGGCSLIPDYKQPQAPVAAQYPQGPAYSPVEGAKMAAAEQGWRHFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           ND +L +L++ AL  N  +  A   I+A +      R+DLFP+  A+ S          S
Sbjct: 61  NDPALQQLIQTALLNNRDLRVAALNIDAYRAQYRIQRSDLFPAVSATGSGSRQRVPGDQS 120

Query: 117 TGQLD------------SDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPS 163
                            S +++DLFG+ R + E +L    ++       ++++++ +  +
Sbjct: 121 QTGQPGITSSYSATLGVSSYELDLFGRVRSLSEQALETYFASEEARRSTQISLVASVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  +  KE + +    L  Y+++  L+      G +S L L +    ++S  + +   +
Sbjct: 181 YMTWQADKELLKLTQDTLKTYEESFRLTSRASEVGVSSALDLSQSRTAVESARAKLAQYQ 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    + +++  LLG    + L      S+    ++   +  G+P+DL++ RPDI   E 
Sbjct: 241 RLVAQDQNSLVLLLGTSLPDNL----PASHLLDSDMLTEMPAGLPSDLLQRRPDILEAEH 296

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  S   +       F G +  W F P + +PIF+ G +
Sbjct: 297 SLKAANANIGAARAAFFPSISLTASAGTSSSELSGLFKGGSGAWLFQPSINIPIFNAGNL 356

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++++  ++   +     +++ +  A +EV + L S     + +   +  V  ++    L+
Sbjct: 357 RASLDYSKIQKEISVANYEKAIQTAFQEVSDGLASRKTYDEQLQAQRDFVAANQDYYRLA 416

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              YR G  S L  LD +R+    +  L   +     S V+LY A+G G+
Sbjct: 417 ERRYRIGIDSNLTFLDAQRSLFSAQQTLITDRLSQLTSEVNLYKALGGGW 466


>gi|330950119|gb|EGH50379.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae Cit 7]
          Length = 486

 Score =  223 bits (568), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 103/470 (21%), Positives = 206/470 (43%), Gaps = 24/470 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL----INIDTLKWWESF 56
           M+      ++   +L GC++ P+Y +P  P+            +    +      W   F
Sbjct: 1   MSKSLISLAVTAFILGGCSLIPDYKQPEAPVAAQYPQGPAYSPVEGAKMAAAEQGWRHFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           ND +L +L++ AL  N  +  A   I+A +      R+DLFP+  A+ S          S
Sbjct: 61  NDPALQQLIQTALLNNRDLRVAALNIDAYRAQYRIQRSDLFPAVSATGSGTRQRVPADQS 120

Query: 117 TGQLD------------SDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPS 163
                            S +++DLFG+ R + E +L    ++       ++++++ +  +
Sbjct: 121 QTGQSGITSSYSASLGVSSYELDLFGRVRSLSEQALETYFASEEARRSTQISLVASVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  +  KE + +    L  Y+++  L+      G +S L L +    ++S  + +   +
Sbjct: 181 YMTWQADKELLKLTQDTLKTYEESFRLTSRASEVGVSSALDLSQSRTAVESARAKLAQYQ 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    + +++  LLG    + L      S+    ++   +  G+P+DL++ RPDI   E 
Sbjct: 241 RLVAQDQNSLVLLLGTSLPDNL----PASHLLDSDMLTEMPAGLPSDLLQRRPDILEAEH 296

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  S   +       F G +  W F P + +PIF+ G +
Sbjct: 297 SLKAANANIGAARAAFFPSISLTASAGTSSSELSGLFKGGSGAWLFQPSINIPIFNAGNL 356

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++++  ++   +     +++ +  A +EV + L S     + +   +  V  ++    L+
Sbjct: 357 RASLDSSKIQKEISVANYEKAIQTAFQEVSDGLASRKTYDEQLQAQRDFVAANQDYYRLA 416

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              YR G  S L  LD +R+    +  L   +     S V+LY A+G G+
Sbjct: 417 ERRYRIGIDSNLTFLDAQRSLFSAQQTLITDRLSQLTSEVNLYKALGGGW 466


>gi|302187782|ref|ZP_07264455.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. syringae 642]
          Length = 486

 Score =  223 bits (567), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 104/470 (22%), Positives = 206/470 (43%), Gaps = 24/470 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL----INIDTLKWWESF 56
           M+      ++   +L GC++ P+Y +P  P+            +    +      W   F
Sbjct: 1   MSKSLISLAVTAFILGGCSLIPDYKQPEAPVAAQYPQGPAYSPVEGAKMAAAEQGWRHFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           ND +L +L++ AL  N  +  A   I+A +      R+DLFP+  A+ S          S
Sbjct: 61  NDPALQQLIQTALLNNRDLRVAALNIDAYRAQYRIQRSDLFPAVSATGSGSRQRVPADQS 120

Query: 117 TGQLD------------SDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPS 163
                            S +++DLFG+ R + E +L    S+       ++++++ +  +
Sbjct: 121 QTGQSGITSSYSATLGVSSYELDLFGRVRSLSEQALETYFSSEEARRSTQISLVASVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  +  KE + +    L  Y+++  L+      G +S L L +    ++S  + +   +
Sbjct: 181 YMTWQADKELLKLTQDTLKTYEESFRLTSRASEVGVSSALDLSQSRTAVESARAKLAQYQ 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    + +++  LLG    + L      S+    ++   +  G+P+DL++ RPDI   E 
Sbjct: 241 RLVAQDQNSLVLLLGTSLPDNL----PASHLLDSDMLTEMPAGLPSDLLQRRPDILEAEH 296

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  S   +       F G +  W F P + +PIF+ G +
Sbjct: 297 SLKAANANIGAARAAFFPSISLTASAGTSSSELSGLFKGGSGAWLFQPSINIPIFNAGNL 356

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++++  ++   +     +++ +  A +EV + L S     + +   +  V  ++    L+
Sbjct: 357 RASLDYSKIQKEISVANYEKAIQTAFQEVSDGLASRKTYDEQLQAQRDFVAANQDYYRLA 416

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              YR G  S L  LD +R+    +  L   +     S V+LY A+G G+
Sbjct: 417 ERRYRIGIDSNLTFLDAQRSLFSAQQTLITDRLSQLTSEVNLYKALGGGW 466


>gi|289674189|ref|ZP_06495079.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. syringae FF5]
          Length = 472

 Score =  223 bits (566), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 103/469 (21%), Positives = 216/469 (46%), Gaps = 24/469 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLL---PTQFSIGNSKNLINIDTLKWWESFN 57
           MN   + +   ++ L+GC++ P+Y +P  P+    P  F+   + +      + W + F 
Sbjct: 1   MNKPVSPWLFAVLSLSGCSLIPDYQRPAAPVAAHYPQSFNSAPAFSGPLAADMGWRDLFR 60

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST 117
           D +L +L++ AL  N  +  A   + A +      RADLFP+  A+ S        + + 
Sbjct: 61  DPTLQQLIESALLNNRDLRVAALNVEAYQAQYRIQRADLFPAISATGSGTRQRQPASITQ 120

Query: 118 GQLDS------------DWKIDLFGQRRHIESSLA-NLDSAYAQVDIAKLNVISKLIPSY 164
                             +++DLFG+ R +    +    S+      A+L++++ +  +Y
Sbjct: 121 TGGPVTSGTYSATLGISSYELDLFGRIRSLSDQASLTYLSSEEAQRSAQLSLVASVATAY 180

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           +  R  +E +++    L  Y+K+++L+      GA+S L L +    ++S  + + T ++
Sbjct: 181 LTWRADQELLALTQDTLMSYEKSLKLTTRSQQVGASSSLDLAQSRTSVESARASLATFQR 240

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
               +++N++ L+G    +        S          +  G+P+DL++ RPDI   E +
Sbjct: 241 QVAQDLNNLTLLVGTTVAD-----SAPSRPLSSEWLAEVPAGLPSDLLQRRPDILEAEYQ 295

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIK 341
           L  + A IG A++  +PS++L  +   +       F   +  W F P++ +PIF+ G ++
Sbjct: 296 LQSAKASIGAARAAFFPSITLTANAGTSSTELSGLFKAGSGGWVFSPQINIPIFNAGSLR 355

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           +++  ++         +++++  A +EV + L +    K+ +      V+  ++  SL+ 
Sbjct: 356 ASLDYSKIQKDISVSKYEKSIQTAFQEVSDGLAARQTYKRQLKAQSDLVQASQEYYSLAE 415

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             YR G  S L  LD +R+    +  L   +     + V+LY A+G G+
Sbjct: 416 RRYRIGVDSSLTFLDAQRSLFSAQQTLITDRLSQLTAEVNLYKALGGGW 464


>gi|298488621|ref|ZP_07006651.1| Outer membrane protein of RND family multidrug efflux pump
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|298156962|gb|EFH98052.1| Outer membrane protein of RND family multidrug efflux pump
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
          Length = 486

 Score =  223 bits (566), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 106/470 (22%), Positives = 206/470 (43%), Gaps = 24/470 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL----INIDTLKWWESF 56
           M+      ++   +L GC++ PEY +P  P+            +    +      W   F
Sbjct: 1   MSKSLISLAVTAFILGGCSLIPEYKQPEAPVAAQYPQGPAYSPVEGAKMAAAEQGWRHFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           ND +L +L++ AL  N  +  A   I+A +      R+DLFP+  A+ S          S
Sbjct: 61  NDPALQQLIQTALLNNRDLRVAALNIDAYRAQYRIQRSDLFPAVSATGSGTRQRVPADQS 120

Query: 117 TGQL------------DSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPS 163
                            S +++DLFG+ R + E +L    S+       ++++++ +  +
Sbjct: 121 QTGQAGITSSYSATLGVSSYELDLFGRVRSLSEQALETYFSSEEARRSTQISLVASVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  +  KE + +    L  Y+++  L+      G +S L L +    ++S  + +   E
Sbjct: 181 YMTWQADKELLKLTQDTLKTYEESYRLTSRSNEVGVSSALDLSQSRTAVESARAKLAQYE 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    + +++  LLG    + L      S+    ++   +  G+P+DL++ RPDI   E 
Sbjct: 241 RLVAQDQNSLVLLLGTSLPDNL----PASHLLDSDMLTEMPSGLPSDLLQRRPDILEAEH 296

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  S   +       F G +  W F P + +PIF+ G +
Sbjct: 297 TLKAANANIGAARAAFFPSISLTASAGTSSSELSGLFKGGSGAWLFQPSINIPIFNAGNL 356

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++++  ++   +     +++ +  A +EV + L S     + +   +  V  ++    L+
Sbjct: 357 RASLDYSKIQKEISVANYEKAIQTAFQEVSDGLASRKTYDEQLQAQRDFVAANQDYYRLA 416

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              YR G  S L  LD +R+    +  L   +     S V+LY A+G G+
Sbjct: 417 ERRYRIGIDSNLTFLDAQRSLFSAQQTLITDRLSQLTSEVNLYKALGGGW 466


>gi|302188902|ref|ZP_07265575.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. syringae 642]
          Length = 472

 Score =  223 bits (566), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 101/469 (21%), Positives = 215/469 (45%), Gaps = 24/469 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLL---PTQFSIGNSKNLINIDTLKWWESFN 57
           MN     +    + L+GC++ P+Y +P  P+    P   +   +        + W + F 
Sbjct: 1   MNRSIGPWLFAALSLSGCSLIPDYQRPAAPVAAHYPQSSAYAPALPGPLAADMGWRDLFR 60

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST 117
           D +L +L++ AL  N  +  A   + A +      RADLFP+  A+ S        + + 
Sbjct: 61  DPTLQQLIESALLNNRDLRVAALNVEAYQAQYRIQRADLFPAISATGSGTRQRLPASITQ 120

Query: 118 GQLDS------------DWKIDLFGQRRHIESSLA-NLDSAYAQVDIAKLNVISKLIPSY 164
                             +++DLFG+ R +    +    S+       +L++++ +  +Y
Sbjct: 121 TGGPVTSGTYSATLGISSYELDLFGRIRSLSDQASLTYLSSEEARRSTQLSLVASVATAY 180

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           +  R  +E +++    L  Y+K+++L+      GA+S L L +    ++S  + + T ++
Sbjct: 181 LTWRADQELLALTQDTLMSYEKSLKLTTRSQQLGASSSLDLAQSRTSVESARASLATFQR 240

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
               +++N+++L+G   ++        S+         +  G+P+DL++ RPDI   E +
Sbjct: 241 QVAQDLNNLTSLVGTTVSDSAPDRPLSSD-----WLAEVPAGLPSDLLQRRPDILEAEYQ 295

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIK 341
           L  + A IG A++  +PS++L  +   +       F G +  W F P++ +PIF+ G ++
Sbjct: 296 LQSANASIGAARAAFFPSITLTANAGTSSTELSGLFKGGSGGWVFSPQINIPIFNAGSLR 355

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           +++  ++         +++++  A +EV + L +    K+ +      V+ +++   L+ 
Sbjct: 356 ASLDYSKIQKDISVSKYEKSIQTAFQEVSDGLAARQTYKRQLKAQSDLVQANQEYYRLAE 415

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             YR G  S L  LD +R+    +  L   +     + V+LY A+G G+
Sbjct: 416 RRYRIGVDSSLTFLDAQRSLFSAQQTLITDRLSQLTAEVNLYKALGGGW 464


>gi|71736997|ref|YP_276145.1| NodT family outer membrane efflux lipoprotein [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|71557550|gb|AAZ36761.1| outer membrane efflux lipoprotein, NodT family [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|320325502|gb|EFW81564.1| NodT family outer membrane efflux lipoprotein [Pseudomonas syringae
           pv. glycinea str. B076]
          Length = 486

 Score =  223 bits (566), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 106/470 (22%), Positives = 206/470 (43%), Gaps = 24/470 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL----INIDTLKWWESF 56
           M+      ++   +L GC++ PEY +P  P+            +    +      W   F
Sbjct: 1   MSKSLISLAVTAFILGGCSLIPEYKQPEAPVAAQYPQGPAYSPVEGAKMATAEQGWRHFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           ND +L +L++ AL  N  +  A   I+A +      R+DLFP+  A+ S          S
Sbjct: 61  NDPALQQLIQTALLNNRDLRVAALNIDAYRAQYRIQRSDLFPAVSATGSGTRQRVPADQS 120

Query: 117 TGQL------------DSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPS 163
                            S +++DLFG+ R + E +L    S+       ++++++ +  +
Sbjct: 121 QTGQAGITSSYSATLGVSSYELDLFGRVRSLSEQALETYFSSEEARRSTQISLVASVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  +  KE + +    L  Y+++  L+      G +S L L +    ++S  + +   E
Sbjct: 181 YMTWQADKELLKLTQDTLKTYEESYRLTSRSNEVGVSSALDLSQSRTAVESARAKLAQYE 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    + +++  LLG    + L      S+    ++   +  G+P+DL++ RPDI   E 
Sbjct: 241 RLVAQDQNSLVLLLGTSLPDNL----PASHLLDSDMLTEMPAGLPSDLLQRRPDILEAEH 296

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  S   +       F G +  W F P + +PIF+ G +
Sbjct: 297 TLKAANANIGAARAAFFPSISLTASAGTSSSELSGLFKGGSGAWLFQPSINIPIFNAGNL 356

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++++  ++   +     +++ +  A +EV + L S     + +   +  V  ++    L+
Sbjct: 357 RASLDYSKIQKEISVANYEKAIQTAFQEVSDGLASRKTYDEQLQAQRDFVAANQDYYRLA 416

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              YR G  S L  LD +R+    +  L   +     S V+LY A+G G+
Sbjct: 417 ERRYRIGIDSNLTFLDAQRSLFSAQQTLITDRLSQLTSEVNLYKALGGGW 466


>gi|95930203|ref|ZP_01312941.1| Hydrophobe/amphiphile efflux-1 HAE1 [Desulfuromonas acetoxidans DSM
            684]
 gi|95133666|gb|EAT15327.1| Hydrophobe/amphiphile efflux-1 HAE1 [Desulfuromonas acetoxidans DSM
            684]
          Length = 1503

 Score =  223 bits (566), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 119/461 (25%), Positives = 214/461 (46%), Gaps = 26/461 (5%)

Query: 6    AIFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKL 64
             +  +   ++ GC TVGP+Y +P   ++   F          +D   WW  FND  L +L
Sbjct: 1045 LVLMILPFIMNGCITVGPDYQRPDPVVIEGAFEQA-------VDVGDWWTQFNDPLLTEL 1097

Query: 65   VKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL---------KTN 115
            V+ AL  N  +  A  R+  A+  +   +A L+P+  A  S                 T 
Sbjct: 1098 VQQALANNRDLKTAVARVREARATLARSKAALWPTLDALGSVSRSKTSENASENAGESTL 1157

Query: 116  STGQLDSDWKID-LFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
                +++ W+ID   G RR +E++ A+  S    +   +++V ++   +YI  R  + ++
Sbjct: 1158 YDTGVNAAWEIDVFGGTRRSVEAANADWQSMLIDLGDVQVSVAAETALAYIALRTVQYQL 1217

Query: 175  SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
             +A   L + ++   +   +   G  + L+L +    ++S  S IPTLE       + + 
Sbjct: 1218 VVARDNLAIQQETHAILADRRQAGLDNDLALQQATYNLESTRSSIPTLEAKVESAYNALC 1277

Query: 235  TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
             L+G            Q       +      GIPADL+R RPD++  E++LA   A+IG+
Sbjct: 1278 VLIGVLPGSVALEPLSQIPRSTVEVE-----GIPADLLRRRPDVQRAERQLAAQTARIGV 1332

Query: 295  AKSDLYPSLSLNGSIALTHDNSFP---GYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
            A +DLYP  +L GSI L   N+       +  +S  P +  PIF  G I++NI+  ++  
Sbjct: 1333 ATADLYPRFTLTGSIGLESLNTSDLLTSESERYSIIPGVQWPIFYFGSIRNNIKVQQAVR 1392

Query: 352  QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
            ++    ++  VL A++EV NAL    ++++    L  AV   + +  L+   YR G    
Sbjct: 1393 EQYLQAYESAVLTAVEEVRNALMDYRKEQERYVALNRAVTAAQTAEFLAKDQYRNGLTDF 1452

Query: 412  LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
              +LD +R+    +    +++  ++++ V LY A+G G+ P
Sbjct: 1453 NAVLDAQRSLLSFQEQRVVSEGAVSQNIVRLYRAMGGGWTP 1493


>gi|257486450|ref|ZP_05640491.1| NodT family outer membrane efflux lipoprotein [Pseudomonas syringae
           pv. tabaci ATCC 11528]
 gi|330987790|gb|EGH85893.1| NodT family outer membrane efflux lipoprotein [Pseudomonas syringae
           pv. lachrymans str. M301315]
 gi|331009937|gb|EGH89993.1| NodT family outer membrane efflux lipoprotein [Pseudomonas syringae
           pv. tabaci ATCC 11528]
          Length = 486

 Score =  222 bits (565), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 106/470 (22%), Positives = 206/470 (43%), Gaps = 24/470 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL----INIDTLKWWESF 56
           M+      ++   +L GC++ PEY +P  P+            +    +      W   F
Sbjct: 1   MSKSLISLAVTAFILGGCSLIPEYKQPEAPVAAQYPQGPAYSPVEGAKMAAAEQGWRHFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           ND +L +L++ AL  N  +  A   I+A +      R+DLFP+  A+ S          S
Sbjct: 61  NDPALQQLIQTALLNNRDLRVAALNIDAYRAQYRIQRSDLFPAVSATGSGTRQRVPADQS 120

Query: 117 TGQL------------DSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPS 163
                            S +++DLFG+ R + E +L    S+       ++++++ +  +
Sbjct: 121 QTGQAGITSSYSASLGVSSYELDLFGRVRSLSEQALETYFSSEEARRSTQISLVASVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  +  KE + +    L  Y+++  L+      G +S L L +    ++S  + +   E
Sbjct: 181 YMTWQADKELLKLTQDTLKTYEESYRLTSRSNEVGVSSALDLSQSRTAVESARAKLAQYE 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    + +++  LLG    + L      S+    ++   +  G+P+DL++ RPDI   E 
Sbjct: 241 RLVAQDQNSLVLLLGTSLPDNL----PASHLLDSDMLTEMPAGLPSDLLQRRPDILEAEH 296

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  S   +       F G +  W F P + +PIF+ G +
Sbjct: 297 TLKAANANIGAARAAFFPSISLTASAGTSSSELSGLFKGGSGAWLFQPSINIPIFNAGNL 356

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++++  ++   +     +++ +  A +EV + L S     + +   +  V  ++    L+
Sbjct: 357 RASLDYSKIQKEISVANYEKAIQTAFQEVSDGLASRKTYDEQLQAQRDFVAANQDYYRLA 416

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              YR G  S L  LD +R+    +  L   +     S V+LY A+G G+
Sbjct: 417 ERRYRIGIDSNLTFLDAQRSLFSAQQTLITDRLSQLTSEVNLYKALGGGW 466


>gi|289628491|ref|ZP_06461445.1| NodT family outer membrane efflux lipoprotein [Pseudomonas syringae
           pv. aesculi str. NCPPB3681]
 gi|289648233|ref|ZP_06479576.1| NodT family outer membrane efflux lipoprotein [Pseudomonas syringae
           pv. aesculi str. 2250]
 gi|330868779|gb|EGH03488.1| NodT family outer membrane efflux lipoprotein [Pseudomonas syringae
           pv. aesculi str. 0893_23]
 gi|330888480|gb|EGH21141.1| NodT family outer membrane efflux lipoprotein [Pseudomonas syringae
           pv. mori str. 301020]
          Length = 486

 Score =  222 bits (565), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 106/470 (22%), Positives = 206/470 (43%), Gaps = 24/470 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL----INIDTLKWWESF 56
           M+      ++   +L GC++ PEY +P  P+            +    +      W   F
Sbjct: 1   MSKSLISLAVTAFILGGCSLIPEYKQPEAPVAAQYPQGPAYSPVEGAKMAAAEQGWRHFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           ND +L +L++ AL  N  +  A   I+A +      R+DLFP+  A+ S          S
Sbjct: 61  NDPALQQLIQTALLNNRDLRVAALNIDAYRAQYRIQRSDLFPAVSATGSGTRQRVPADQS 120

Query: 117 TGQL------------DSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPS 163
                            S +++DLFG+ R + E +L    S+       ++++++ +  +
Sbjct: 121 QTGQAGITSSYSATLGVSSYELDLFGRVRSLSEQALETYFSSEEARRSTQISLVASVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  +  KE + +    L  Y+++  L+      G +S L L +    ++S  + +   E
Sbjct: 181 YMTWQADKELLKLTQDTLKTYEESYRLTSRSNEVGVSSALDLSQSRTAVESARAKLAQYE 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    + +++  LLG    + L      S+    ++   +  G+P+DL++ RPDI   E 
Sbjct: 241 RLVAQDQNSLVLLLGTSLPDNL----PASHLLDSDMLTEMPAGLPSDLLQRRPDILEAEH 296

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  S   +       F G +  W F P + +PIF+ G +
Sbjct: 297 TLKAANANIGAARAAFFPSISLTASAGTSSSELSGLFKGGSGAWLFQPSINIPIFNAGNL 356

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++++  ++   +     +++ +  A +EV + L S     + +   +  V  ++    L+
Sbjct: 357 RASLDYSKIQKEISVANYEKAIQTAFQEVSDGLASRKTYDEQLQAQRDFVAANQDYYRLA 416

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              YR G  S L  LD +R+    +  L   +     S V+LY A+G G+
Sbjct: 417 ERRYRIGIDSNLTFLDAQRSLFSAQQTLITDRLSQLTSEVNLYKALGGGW 466


>gi|237807128|ref|YP_002891568.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Tolumonas auensis DSM 9187]
 gi|237499389|gb|ACQ91982.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Tolumonas auensis DSM 9187]
          Length = 463

 Score =  222 bits (565), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 106/464 (22%), Positives = 211/464 (45%), Gaps = 19/464 (4%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLN 62
           I R I  L  +LLAGC++ P+Y +P  P +P  +   ++  +  +    W ++F D +L 
Sbjct: 2   IKRPIAFLVSLLLAGCSLAPDYQRPAAP-IPAGYDTSSASTIAAVKATDWQQAFTDPALQ 60

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDS 122
           KL+  ALQ N  +  A   + A +      RA   P+  AS          T S      
Sbjct: 61  KLIDTALQNNRDLRIAILNVEAYQAQYRIQRAAQLPTLTASGYQARQRIPSTYSGTADAI 120

Query: 123 D-----------WKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                       +++DLFG+ + + + +L N  +        +L++I+ +  +Y+     
Sbjct: 121 SNTDSATVGISAYELDLFGRVQSLKDQALENYLAQEETQRSTQLSLIANVATAYMTLLAD 180

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           ++ + +A Q    Y+++ +L   ++  G +S L + +  + ++S+ S +    +   ++ 
Sbjct: 181 QDLLRLAEQTAKSYEQSYQLIEQRYQAGISSSLDVSQSRSNLESVRSSLAQYRRQVTLDK 240

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  L+G      L     + +     L  P+   IP+ L+  RPDI   E  L  + A
Sbjct: 241 NALRLLMGTNIPAGLSSGLPEQDLT---LLSPLGADIPSTLLTRRPDILAAEHSLKAANA 297

Query: 291 KIGIAKSDLYPSLSLNGS---IALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +P++SL  +   ++ + +  F   +  W F P + LPIFD G   + +  A
Sbjct: 298 NIGAARAAFFPTISLTANAGSMSSSLNKLFDAGSGTWLFQPNISLPIFDWGSRDAQLDVA 357

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           +   + +  T+++ +  A +EV + L + +  +  +   Q  V+ ++    L+   Y +G
Sbjct: 358 KVQEKIEVATYEKAIQTAFQEVSDGLAAQDGYRDQLQAQQALVDANRTYYQLAQSRYEKG 417

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             S L +LD +R+    E  L   +  L  + V L+ A+G G+ 
Sbjct: 418 VDSYLTLLDAQRSLFSAEQGLVSTRLALLSNRVSLFKALGGGWQ 461


>gi|116751340|ref|YP_848027.1| outer membrane efflux protein [Syntrophobacter fumaroxidans MPOB]
 gi|116700404|gb|ABK19592.1| outer membrane efflux protein [Syntrophobacter fumaroxidans MPOB]
          Length = 569

 Score =  222 bits (565), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 123/481 (25%), Positives = 238/481 (49%), Gaps = 32/481 (6%)

Query: 1   MNILRAIFSLFIVL-LAGC-TVGPEYTKPHMPLLPTQFSIGNSK-NLINIDTLKWWESFN 57
           M  + A+  L   L  AGC  VGP++ KP  P+        NSK    + D  +WW  F 
Sbjct: 36  MRCVSALMLLAATLGAAGCTAVGPDFAKPSAPVAANWSEKDNSKVKTESGDYSQWWTVFE 95

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSY--------------AS 103
           D  LN L++IA + N  +  A  RI  A+  +     + FP                 A+
Sbjct: 96  DEVLNNLIRIAYENNPDLQVAGLRILEARAQLGIALGNQFPQKQQGNAAYTYTRNSENAA 155

Query: 104 ISHRFIPNLKTNSTGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIP 162
            +              +D+ W+ID +G+ +  IES+ A+L ++ A  D A +++   +  
Sbjct: 156 NTAGGGDLRYGAYNYGIDASWEIDFWGKYKRGIESADASLTASVADYDSALVSLAGNVAS 215

Query: 163 SYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTL 222
           +Y+  R ++ER+ +A + +++ K+++ L+ +++  GA ++L + +    +   ++ IP+L
Sbjct: 216 TYVQIRTYEERLKVARENVEIQKESLRLTEVRYRNGAVTELDVQQARTLLYDTQAQIPSL 275

Query: 223 EKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQE 282
           E S + + ++++ LLG P  +    +  +     P     + +GIPA+L+R RPDIR  E
Sbjct: 276 EISLQQSRNSLAVLLGMPPGDLAGLLGDKPGTI-PTPPAEVVLGIPAELLRRRPDIRSAE 334

Query: 283 KKLADSVAKIGIAKSDLYPS-------------LSLNGSIALTHDNSFPGYNTHWSFGPK 329
            + A   A+IG+AK++L+P                L  +      + F   +   + GP 
Sbjct: 335 LQAAAQCAQIGVAKAELFPRISLLGSFGFLASDSRLTRTGGSGFTDLFTWSSYTMTTGPT 394

Query: 330 LYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHA 389
           +  PI + G+I +N+R  ++  ++  +T++ TVL A KEVE+AL      +     L+ +
Sbjct: 395 IEWPILNYGRITNNVRVQDARFEQLMVTYRNTVLGAAKEVEDALVGFLRSQDKTALLEES 454

Query: 390 VELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           V+  K+++ L+M+ YR+G      +L+ +++  + +  L+ ++  +  + V LY  +G G
Sbjct: 455 VKAAKRAVDLAMLQYREGAVDFTTVLNSQQSLVQEQDSLTQSRGAVPTNLVALYKGLGGG 514

Query: 450 Y 450
           +
Sbjct: 515 W 515


>gi|330901383|gb|EGH32802.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. japonica str. M301072PT]
          Length = 472

 Score =  222 bits (564), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 102/469 (21%), Positives = 216/469 (46%), Gaps = 24/469 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLL---PTQFSIGNSKNLINIDTLKWWESFN 57
           MN   + +   ++ L+GC++ P+Y +P  P+    P  F    + +      + W + F 
Sbjct: 1   MNKSVSPWLFAVLSLSGCSLIPDYQRPAAPVAAHYPQSFDSAPALSGPLAADMGWRDLFR 60

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST 117
           D +L +L++ AL  N  +  A   + A +      RADLFP+  A+ S        + + 
Sbjct: 61  DPTLQQLIESALLNNRDLRVAALNVEAYQAQYRIQRADLFPAISATGSGTRQRQPASITQ 120

Query: 118 GQLDS------------DWKIDLFGQRRHIESSLA-NLDSAYAQVDIAKLNVISKLIPSY 164
                             +++DLFG+ R +    +    S+      A+L++++ +  +Y
Sbjct: 121 TGGPVTSGTYSATLGISSYELDLFGRIRSLSDQASLTYLSSEEAQRSAQLSLVASVATAY 180

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           +  R  +E +++    L  Y+K+++L+      GA+S L L +    ++S  + + T ++
Sbjct: 181 LTWRADQELLALTQDTLMSYEKSLKLTTRSQQVGASSSLDLAQSRTSVESARASLATFQR 240

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
               +++N++ L+G    +        S          +  G+P++L++ RPDI   E +
Sbjct: 241 QVAQDLNNLTLLVGTTVAD-----SAPSRPLSSEWLAEVPAGLPSELLQRRPDILEAEYQ 295

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIK 341
           L  + A IG A++  +PS++L  +   +       F   +  W F P++ +PIF+ G ++
Sbjct: 296 LQSANASIGAARAAFFPSITLTANAGTSSTELSGLFKAGSGGWVFSPQINIPIFNAGSLR 355

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           +++  ++         +++++ +A +EV + L +    K+ +      V+  ++  SL+ 
Sbjct: 356 ASLDYSKIQKNISVSKYEKSIQSAFQEVSDGLAARQTYKRQLKAQSDLVQASREYYSLAE 415

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             YR G  S L  LD +R+    +  L   +     + V+LY A+G G+
Sbjct: 416 RRYRIGVDSSLTFLDAQRSLFSAQQTLITDRLSQLTAEVNLYKALGGGW 464


>gi|213970268|ref|ZP_03398398.1| outer membrane efflux protein [Pseudomonas syringae pv. tomato T1]
 gi|301382926|ref|ZP_07231344.1| outer membrane efflux protein [Pseudomonas syringae pv. tomato
           Max13]
 gi|302063780|ref|ZP_07255321.1| outer membrane efflux protein [Pseudomonas syringae pv. tomato K40]
 gi|302133533|ref|ZP_07259523.1| outer membrane efflux protein [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213924940|gb|EEB58505.1| outer membrane efflux protein [Pseudomonas syringae pv. tomato T1]
          Length = 486

 Score =  222 bits (564), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 104/470 (22%), Positives = 207/470 (44%), Gaps = 24/470 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL----INIDTLKWWESF 56
           M+      ++   +L GC++ PEY +P  P+            +    +      W   F
Sbjct: 1   MSKSLISLAVTAFILGGCSLIPEYKQPEAPVAAQYPQGPAYSPVEGAKMAAAEQGWRHFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           ND +L +L++ AL  N  +  A   I+A +      R+DLFP+  A+ S          S
Sbjct: 61  NDPALQQLIETALLNNRDLRVAALNIDAYRAQYRIQRSDLFPAVSATGSGSRQRVPADQS 120

Query: 117 TGQLDS------------DWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPS 163
                +             +++DLFG+ R + E +L    S+       ++++++ +  +
Sbjct: 121 QTGQSAISSSYSATLGVSAYELDLFGRVRSLSEQALETYFSSEEARRSTQISLVANVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  +  KE + +    L  Y+++  L+      G +S L L +    ++S  + +   +
Sbjct: 181 YMTWQADKELLKLTQDTLKTYEESFRLTSRSNEVGVSSALDLSQSRTAVESARARLAQYQ 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    + +++  LLG    + L      S+    ++   +  G+P+DL++ RPDI   E 
Sbjct: 241 RLVAQDQNSLVLLLGTGLPDNL----PASHLLDSDMLTEMPAGLPSDLLQRRPDILQAEH 296

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  S   +       F G +  W F P + +PIF+ G +
Sbjct: 297 SLKAANANIGAARAAFFPSISLTASAGTSSTELSGLFKGGSGTWLFQPSINIPIFNAGNL 356

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++++  ++   +     +++++  A +EV + L S     + +   +  V  ++    L+
Sbjct: 357 RASLDYSKIQKEISVANYEKSIQTAFQEVSDGLASRKTYDEQLQAQRDFVTANQDYYRLA 416

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              YR G  S L  LD +R+    +  L   +     S V+LY A+G G+
Sbjct: 417 ERRYRIGIDSNLTFLDAQRSLFSAQQTLITDRLSQLTSEVNLYKALGGGW 466


>gi|330877822|gb|EGH11971.1| outer membrane efflux protein [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330966623|gb|EGH66883.1| outer membrane efflux protein [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 486

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 103/470 (21%), Positives = 207/470 (44%), Gaps = 24/470 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL----INIDTLKWWESF 56
           M+      ++   +L GC++ PEY +P  P+            +    +      W   F
Sbjct: 1   MSKSLISLAVTAFILGGCSLIPEYKQPEAPVAAQYPQGPAYSPVEGAKMAAAEQGWRHFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           ND +L +L++ AL  N  +  A   I+A +      R+DLFP+  A+ S          +
Sbjct: 61  NDPALQQLIETALLNNRDLRVAALNIDAYRAQYRIQRSDLFPAVSATGSGSRQRVPADQT 120

Query: 117 TGQLDS------------DWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPS 163
                +             +++DLFG+ R + E +L    S+       ++++++ +  +
Sbjct: 121 QTGQSAISSSYSATLGVSAYELDLFGRVRSLSEQALETYFSSEEARRSTQISLVANVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  +  KE + +    L  Y+++  L+      G +S L L +    ++S  + +   +
Sbjct: 181 YMTWQADKELLKLTQDTLKTYEESFRLTSRSNEVGVSSALDLSQSRTAVESARARLAQYQ 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    + +++  LLG    + L      S+    ++   +  G+P+DL++ RPDI   E 
Sbjct: 241 RLVAQDQNSLVLLLGTGLPDNL----PASHLLDSDMLTEMPAGLPSDLLQRRPDILQAEH 296

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  S   +       F G +  W F P + +PIF+ G +
Sbjct: 297 TLKAANANIGAARAAFFPSISLTASAGTSSTELSGLFKGGSGTWLFQPSINIPIFNAGNL 356

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++++  ++   +     +++++  A +EV + L S     + +   +  V  ++    L+
Sbjct: 357 RASLDYSKIQKEISVANYEKSIQTAFQEVSDGLASRKTYDEQLQAQRDFVTANQDYYRLA 416

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              YR G  S L  LD +R+    +  L   +     S V+LY A+G G+
Sbjct: 417 ERRYRIGIDSNLTFLDAQRSLFSAQQTLITDRLSQLTSEVNLYKALGGGW 466


>gi|330955166|gb|EGH55426.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae Cit 7]
          Length = 472

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 100/469 (21%), Positives = 212/469 (45%), Gaps = 24/469 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLL---PTQFSIGNSKNLINIDTLKWWESFN 57
           MN     +    + L+GC++ P+Y +P  P+    P   S   + +      + W + F 
Sbjct: 1   MNKFLGPWLFAALSLSGCSLIPDYQRPAAPVPAHYPQSSSYAPALSGPLAADMGWRDLFR 60

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST 117
           D +L +L++ AL  N  +  A   + A +      RADLFP+  A+ S        + + 
Sbjct: 61  DPTLQQLIESALLNNRDLRVAALNVEAYQAQYRIQRADLFPAISATGSGTRQRQPASITQ 120

Query: 118 GQLDS------------DWKIDLFGQRRHIESSLA-NLDSAYAQVDIAKLNVISKLIPSY 164
                             +++DLFG+ R +    +    S+       +L++++ +  +Y
Sbjct: 121 TGAPVTSGSYSATLGISSYELDLFGRIRSLSDQASLTYLSSEEARRSTQLSLVASVATAY 180

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           +  R  +E +++    L  Y+K+++L+      GA+S L L +    ++S  + + T ++
Sbjct: 181 LTWRADQELLALTQDTLMSYEKSLKLTTRSQQVGASSSLDLAQSRTSVESARASLATFQR 240

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
               +++N++ L+G    +        S          +  G+P+DL++ RPDI   E +
Sbjct: 241 QVAQDLNNLTLLVGTTVADTAPDRPLSSE-----WLAEVPAGLPSDLLQRRPDILEAEYQ 295

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIK 341
           L  + A IG A++  +PS++L  +   +       F      W F P++ +PIF+ G ++
Sbjct: 296 LQSANASIGAARAAFFPSITLTANAGTSSTELSGLFKAGAGGWVFSPQIDIPIFNAGSLR 355

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           +++  ++         +++++  A +EV + L +    K+ +      V+ +++   L+ 
Sbjct: 356 ASLDYSKIQKDISVSKYEKSIQTAFQEVSDGLAARQTYKRQLKAQSDLVQANQEYYRLAE 415

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             YR G  + L  LD +R+    + +L   +     + V+LY A+G G+
Sbjct: 416 RRYRIGVDNSLTFLDAQRSLFSAQQNLITDRLSQLTAEVNLYKALGGGW 464


>gi|330981797|gb|EGH79900.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. aptata str. DSM 50252]
          Length = 472

 Score =  221 bits (563), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 103/469 (21%), Positives = 216/469 (46%), Gaps = 24/469 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLL---PTQFSIGNSKNLINIDTLKWWESFN 57
           MN   + +   ++ L+GC++ P+Y +P  P+    P  F+   + +      + W + F 
Sbjct: 1   MNKPVSPWLFAVLSLSGCSLIPDYQRPAAPVAAHYPQSFNSAPALSGPLAADMGWGDLFR 60

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST 117
           D +L +L++ AL  N  +  A   + A +      RADLFP+  A+ S        + + 
Sbjct: 61  DPTLQQLIESALLNNRDLRVAALNVEAYQAQYRIQRADLFPAISATGSGTRQRQPASITQ 120

Query: 118 GQLDS------------DWKIDLFGQRRHIESSLA-NLDSAYAQVDIAKLNVISKLIPSY 164
                             +++DLFG+ R +    +    S+      A+L++++ +  +Y
Sbjct: 121 TGGPVTSGTYSATLGISSYELDLFGRIRSLSGQASLTYLSSEEAQRSAQLSLVASVATAY 180

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           +  R  +E +++    L  Y+K+++L+      GA+S L L +    ++S  + + T ++
Sbjct: 181 LTWRADQELLALTQDTLMSYEKSLKLTTRSQQVGASSSLDLAQSRTSVESARASLATFQR 240

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
               +++N++ L+G    +        S          +  G+P+DL++ RPDI   E +
Sbjct: 241 QVAQDLNNLTLLVGTTVAD-----SAPSRPLSSEWLAEVPAGLPSDLLQRRPDILEAEYQ 295

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIK 341
           L  + A IG A++  +PS++L  +   +       F   +  W F P++ +PIF+ G ++
Sbjct: 296 LQSANASIGAARAAFFPSITLTANAGTSSTELSGLFKAGSGGWVFSPQINIPIFNAGSLR 355

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           +++  ++         +++++  A +EV + L +    K+ +      V+  ++  SL+ 
Sbjct: 356 ASLDYSKIQKDISVSKYEKSIQTAFQEVSDGLAARQTYKRQLKAQSDLVQASQEYYSLAE 415

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             YR G  S L  LD +R+    +  L   +     + V+LY A+G G+
Sbjct: 416 RRYRIGVDSSLTFLDAQRSLFSAQQTLITDRLSQLTAEVNLYKALGGGW 464


>gi|223935014|ref|ZP_03626933.1| RND efflux system, outer membrane lipoprotein, NodT family
           [bacterium Ellin514]
 gi|223896467|gb|EEF62909.1| RND efflux system, outer membrane lipoprotein, NodT family
           [bacterium Ellin514]
          Length = 495

 Score =  221 bits (561), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 113/461 (24%), Positives = 202/461 (43%), Gaps = 20/461 (4%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKI 67
                V+L GC VGP Y +P +       S        +   L WWE F D +L  L+KI
Sbjct: 32  ILASTVILVGCAVGPNYKRPTVNSPNNFRSATGPPTTNSFGDLPWWEIFQDDTLQNLIKI 91

Query: 68  ALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF------------IPNLKTN 115
           AL  N  I  A  R+  A+      RA  FP     +                   + ++
Sbjct: 92  ALTNNYDIRVAATRVEQARAIYAENRAAFFPQLGYQVGASRGKNALFTTPFFNNGRVTSD 151

Query: 116 STGQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
             G  +  W+IDL+G+ R +  ++ A   ++        + +I+ L  SY+        +
Sbjct: 152 YIGAGNVSWEIDLWGRIRRLNEAAQAQYFASQEARRNVMITLIADLAQSYLQLLALDREL 211

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
            I  Q    +  ++++ + +  QG  SKL   +  A + S  + IP LE+   +  + IS
Sbjct: 212 EITRQNTASFSDSLKIFNQRLEQGVASKLETSRAAAALASTAASIPDLERQIVIQENQIS 271

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
            LLG         + +  N  Q  L   +  G+P+ L++ RPDIR  ++    + A+IG+
Sbjct: 272 VLLGQNPG----PVFRNKNLLQLTLPPDVPAGLPSSLLQRRPDIREADQLFRSANAQIGV 327

Query: 295 AKSDLYPSLSLNGSIALTHDNSF---PGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           A +D  P L L   +            G +  WS    L  PIF  G++      A++  
Sbjct: 328 AVADFLPVLDLTALLGAVSPELSAITSGKSGLWSVAGSLTGPIFQGGRLVGQYHAAQAVR 387

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           ++  +++Q+T L A +EV NAL +  + ++I  +   +V  +++++ +S   Y  G+ S 
Sbjct: 388 EQARLSYQQTALIAFQEVSNALIARQKFQEIRVQQTLSVSAYEEAVRVSTQRYLVGQASY 447

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            ++L+ ++     ++ L   +     + V LY A+G G+ P
Sbjct: 448 YELLEAQQQLFPAQISLVQTQLNQFLAVVQLYRALGGGWQP 488


>gi|28871442|ref|NP_794061.1| outer membrane efflux protein [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|28854693|gb|AAO57756.1| outer membrane efflux protein [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|331018026|gb|EGH98082.1| outer membrane efflux protein [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 486

 Score =  220 bits (560), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 105/470 (22%), Positives = 207/470 (44%), Gaps = 24/470 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL----INIDTLKWWESF 56
           M+      ++   +L GC++ PEY +P  P+            +    +      W   F
Sbjct: 1   MSKSLISLAVTAFILGGCSLIPEYKQPEAPVAAQYPQGPAYSPVEGAKMAAAEQGWRHFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           ND +L +L++ AL  N  +  A   I+A +      R+DLFP+  A+ S          S
Sbjct: 61  NDPALQQLIETALLNNRDLRVAALNIDAYRAQYRIQRSDLFPAVSATGSGSRQRVPADQS 120

Query: 117 TGQLD------------SDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPS 163
                            S +++DLFG+ R + E +L    S+       ++++++ +  +
Sbjct: 121 QTSQSAISSSYSATLGVSAYELDLFGRVRSLSEQALETYFSSEEARRSTQISLVANVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  +  KE + +    L  Y+++  L+      G +S L L +    ++S  + +   +
Sbjct: 181 YMTWQADKELLKLTQDTLKTYEESFRLTSRSNEVGVSSALDLSQSRTAVESARARLAQYQ 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    + +++  LLG    + L      S+    ++   +  G+P+DL++ RPDI   E 
Sbjct: 241 RLVAQDQNSLVLLLGTGLPDNL----PASHLLDSDMLTEMPAGLPSDLLQRRPDILQAEH 296

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  S   +       F G +  W F P + +PIF+ G +
Sbjct: 297 SLKAANANIGAARAAFFPSISLTASAGTSSTELSGLFKGGSGTWLFQPSINIPIFNAGNL 356

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++++  ++   +     +++++  A +EV + L S     + +   +  V  ++    L+
Sbjct: 357 RASLDYSKIQKEISVANYEKSIQTAFQEVSDGLASRKTYDEQLQAQRDFVTANQDYYRLA 416

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              YR G  S L  LD +R+    +  L   +     S V+LY A+G G+
Sbjct: 417 ERRYRIGIDSNLTFLDAQRSLFSAQQTLITDRLSQLTSEVNLYKALGGGW 466


>gi|37519362|gb|AAQ92182.1| outer membrane protein [Pseudomonas fluorescens]
          Length = 486

 Score =  220 bits (559), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 98/471 (20%), Positives = 202/471 (42%), Gaps = 24/471 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL----KWWESF 56
           M+      ++   +L+GC++ P+Y +P  P+                        W + F
Sbjct: 1   MSKSLLSIAVAAFVLSGCSLIPDYQQPEAPVAAQYPQGPAYSPTQAPAQAAAEQGWKQFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           +D +L +L+++AL+ N  +  A   I+A        RADLFP+  A+ +          S
Sbjct: 61  HDPALQQLIQVALENNRDLRVAALNIDAFAAQYRIQRADLFPAVSANGTGSRQRVPADAS 120

Query: 117 TGQL------------DSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPS 163
                            S +++DLFG+ R +         +        ++++++ +  +
Sbjct: 121 QTGQAGITSSYSATVGISAYELDLFGRVRSLSEEALQKYFATEEGRRSTQISLVASVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  +  KE   +    L  ++++ +L+      G  S L L +    +++  + +    
Sbjct: 181 YLTWQADKELRKLTQDTLGAFEESYKLTSRSNEVGVASALDLAQSRTSVENARAQLARYT 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    + +++  LLG      L   +  S++   ++      G+P+DL++ RPDI   E 
Sbjct: 241 RQVAQDENSLVLLLGTGIPANLREAKPLSDDLLSDVPP----GLPSDLLQRRPDILQAEY 296

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  +      +    F G +  W F P++ LPIF+ G +
Sbjct: 297 NLKAANANIGAARAAFFPSISLTANAGTLSPDLSGLFKGGSGTWLFQPQINLPIFNAGSL 356

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++++  ++         +++++  A +EV + L +     + +   +  V  ++    L+
Sbjct: 357 RASLDYSKIQKDIGVANYEKSIQTAFQEVADGLAARQTYTEQLQAQRDFVTANQDYYRLA 416

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
              YR G  S L  LD +R     +  L   +     S V+LY A+G G+N
Sbjct: 417 ERRYRIGVDSNLTFLDAQRQLFSAQQALITDRLAQLTSAVNLYKALGGGWN 467


>gi|220915664|ref|YP_002490968.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219953518|gb|ACL63902.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 470

 Score =  219 bits (558), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 109/463 (23%), Positives = 209/463 (45%), Gaps = 20/463 (4%)

Query: 4   LRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNK 63
           L  + +   + ++GCT+ P Y +P  P+     +   +        L W + F D  L  
Sbjct: 6   LATLVAASALAVSGCTLAPRYQRPAAPVAAEFPAGAGAATGPAASDLGWRDVFQDPGLQA 65

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL----------- 112
           ++  AL++N  +  A   +  A+      R+ L P+  A+ S                  
Sbjct: 66  VIDQALRENRDLRVAALNVELARAQYGIQRSYLLPTVGATGSGSRARTAKDLSFTGEPSV 125

Query: 113 -KTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
             T S G   + ++IDLFG+ R +   +L    S       A L ++S++   Y+ +R  
Sbjct: 126 GNTFSAGVGLTSFEIDLFGRVRSLRNQALEQYLSTEEAHRSAHLALVSEVAVQYLASRAL 185

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           + ++++A Q L   +++ +L+   F  G TS+L     EA++++   ++   ++      
Sbjct: 186 QSQVALAEQTLQTVQQSYDLAKRTFEAGRTSELDFRTAEAQVETARVNLSAYQQQLAQAE 245

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  L G P  + L     +S      L      G+P+DL++ RPDI   E +L  + A
Sbjct: 246 NALVLLAGGPLPKDLPTAPLESQPPVAELP----AGLPSDLLQRRPDILSAEHQLKAANA 301

Query: 291 KIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL  S+        N F   +  W+F P++ LPIF  G+ K+N+  A
Sbjct: 302 SIGAARAAFFPSISLTASVGTASTELSNLFTAGSGTWAFSPRIDLPIFTGGRNKANLDAA 361

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
               Q +  ++++ +  A +EV +AL +     + +      V+  ++   +S + YR+G
Sbjct: 362 NVRKQIEIASYEKAIQVAFREVADALVARGRLDEQLEAQTRRVQAEQRRYDISELRYRKG 421

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             S L++L  +R     +  L   +     + + LY A+G G+
Sbjct: 422 VDSYLNVLTAQRDLYGAQQQLIQTRLTRFSNSIGLYRALGGGW 464


>gi|295701080|ref|YP_003608973.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. CCGE1002]
 gi|295440293|gb|ADG19462.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. CCGE1002]
          Length = 504

 Score =  219 bits (558), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 120/466 (25%), Positives = 213/466 (45%), Gaps = 27/466 (5%)

Query: 4   LRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQ-FSIGNSKNLINIDTLKWWESFNDTSLN 62
            R + S+ ++ L+GC +GP Y +P + +  T  F+ G +  + N     WWE F D  LN
Sbjct: 7   KRLLASVMLLALSGCLLGPNYQRPAVDVPATYRFAQGEAAGIANAA---WWEQFQDPVLN 63

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP------------ 110
           +L+  ALQ N  +  A  R++  +   ++ R+ LFP   A                    
Sbjct: 64  QLIATALQDNRDVKVAAARVDEFRGMFVTTRSGLFPQVSAGADASRQRVSQVEAVTVPKG 123

Query: 111 --NLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
              +       L   W++DLFG+ RR  E++ ANL ++        L ++S +  +YI+ 
Sbjct: 124 VSPVYNQFDATLAVSWELDLFGKVRRETEAARANLLASEEGRRATILTLVSSVASAYINL 183

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
           R    ++ IA + +    +++ +   +F  G  S++ L + ++E ++ +  +P LE    
Sbjct: 184 RSLDRQLEIAKETVQSRAESVRVFEARFRYGEVSQMELAQSQSEYQAAQVTVPQLEAQIG 243

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
                +S L+G      L   +       P        G+P++L+  RPD+   E+ L  
Sbjct: 244 QQEDALSVLIGRNPGAILRGRELSQMGTPPIPE-----GLPSELLERRPDLLEAEQTLVA 298

Query: 288 SVAKIGIAKSDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNI 344
             A IG A++  +PS+SL G     +    N F G    WSF   +  PIF  G I   +
Sbjct: 299 QNALIGAARALYFPSISLTGLFGSVSAQFSNLFTGPARVWSFAGSVTQPIFTAGNITGQV 358

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
            +AE+  QE   ++++ +  A +EVE++L S+ +  + +      VE       L+   Y
Sbjct: 359 HQAEARQQEALYSYEKAIQVAFQEVEDSLISVQKTHQALDAQNLQVEALVTYARLARQRY 418

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             G  S +++LD ER+    ++  +  +  +  SYV LY A G G+
Sbjct: 419 EGGYTSYIEVLDAERSLFNAQLSYAQTQGAVLTSYVTLYKATGGGW 464


>gi|327188981|gb|EGE56170.1| nodulation protein (outer membrane efflux protein) [Rhizobium etli
           CNPAF512]
          Length = 478

 Score =  219 bits (558), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 186/464 (40%), Positives = 282/464 (60%), Gaps = 15/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M  LR      ++LL+GC VGP++  P MP LP +F  G +K++ ++ T  WW +F D  
Sbjct: 1   MVSLRFATPALLLLLSGCVVGPDHAPPEMP-LPAKFGEGGTKSVGDVATAAWWTAFKDPR 59

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN--------- 111
           LN  V+  L+QNLT+ QA ERINAA  N+    A   PS     SH              
Sbjct: 60  LNGYVQAGLEQNLTVQQAIERINAASANVTIAGAGGLPSLNVGASHTVSGQKGELRTQFD 119

Query: 112 LKTNSTGQLDSDWKID-LFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
            +  S G +   W +D     +R  ES+ A+LDSAYA  D+AKL ++  L+ SYID R +
Sbjct: 120 TRNTSAGDVQLSWLLDLFGLYKRSTESAAASLDSAYASADVAKLTLVQDLVSSYIDVRFY 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           ++R++++   L   ++  EL+  +   GA S+L +V+ E  ++S  ++IP LE + R++ 
Sbjct: 180 QQRLALSKANLKSRQETYELTKFQLEAGAASRLDVVQAEGLVQSTLAEIPGLETNIRISA 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           H+I+TLLG PA+  ++ + +     QP  +  IN GIPADLIRNRPDIR  E+ LA + A
Sbjct: 240 HHIATLLGLPASALVNELLRGGG--QPVFHGGINSGIPADLIRNRPDIRVAERDLAAATA 297

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS--FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
            IG+A++ LYPS+SL+GSI+ ++ N     G  T WSFGP L LPIFD G++++N++ A+
Sbjct: 298 NIGVAEAQLYPSISLSGSISPSYINQRGVHGGLTPWSFGPTLNLPIFDGGRLRANVKSAQ 357

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           S A   Y+ W+ TVL A+++VENAL ++  D + V  LQ  V+  ++++ LS  +Y+ G 
Sbjct: 358 SDAATAYLNWKSTVLTAVEQVENALAAVRRDAQTVAALQAQVKTTQETLELSTASYKDGA 417

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            SLLD+LD +R  +  +  L+ + +Q+AK YV L IA+G GY P
Sbjct: 418 SSLLDVLDAQRQVSLAQASLAQSVQQMAKDYVSLNIAVGGGYAP 461


>gi|241665000|ref|YP_002983360.1| NodT family RND efflux system outer membrane lipoprotein [Ralstonia
           pickettii 12D]
 gi|240867027|gb|ACS64688.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Ralstonia pickettii 12D]
          Length = 514

 Score =  219 bits (556), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 116/462 (25%), Positives = 210/462 (45%), Gaps = 29/462 (6%)

Query: 14  LLAGCTVGPEYTKPHMPLLPTQFSIGNS-----------KNLINIDTLKWWESFNDTSLN 62
           +L+GC++ P Y +P  P+                     +N      L W E F D  L 
Sbjct: 22  VLSGCSMAPTYERPDAPITSAYPQAPAGYAVPADSAKPGENAPRATELGWREFFPDARLQ 81

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST----- 117
           KL+ +AL+ N  +  A   + AA+       ADL P   AS ++       + ST     
Sbjct: 82  KLIGLALENNRDLRVAMLNVEAARAQYRLQIADLLPPVNASATYTRSHTPPSISTTGGDI 141

Query: 118 -------GQLDSDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                  G   S+++++LF       S+ A+  +       A++++IS++  +Y++ R +
Sbjct: 142 YNKQYQLGVGISNYQVNLFSVGDVTSSARASYLATDEGRRAAQISLISQVAKAYLNERAY 201

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
            E++ +A Q L   +   +L+  +F  GA+S L L + E  ++S+   +  L + +    
Sbjct: 202 AEQLDLAQQTLKGREDYYKLAKQRFDVGASSALDLRQTETLVESVRVSVAQLTRQYAQAT 261

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  L+G P    L      S+     +   I  G+P++L+  RPDIR  E+KL  + A
Sbjct: 262 NALVLLVGAPLPADLPAPTTVSSE---KIVADIPPGLPSELLEQRPDIRQAEQKLIAANA 318

Query: 291 KIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG+A++  +PS+ L  ++        + F      WSF P L LPIF+ G    N+   
Sbjct: 319 NIGVARAAFFPSIGLTSNVGTASGALHDLFKSGTQFWSFVPNLTLPIFNWGTNIFNLDLT 378

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           +++ +     +++T+  A +EV +AL +    ++ V   +   +     ++LS   YR G
Sbjct: 379 KTNQKIAVANYEKTIQTAFREVSDALVARGTLEEQVAAQKRFRDATADRLTLSDQRYRNG 438

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
             S LD+LD +R     +  L   +     + +DLY A+G G
Sbjct: 439 VSSFLDVLDAQRDLFSADQTLVQTRLARLTNAIDLYTALGGG 480


>gi|86156944|ref|YP_463729.1| RND efflux system, outer membrane lipoprotein, NodT
           [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85773455|gb|ABC80292.1| RND efflux system, outer membrane lipoprotein, NodT
           [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 500

 Score =  219 bits (556), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 109/452 (24%), Positives = 207/452 (45%), Gaps = 20/452 (4%)

Query: 15  LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           ++GCT+ P Y +P  P+     + G +        L W + F D  L  ++  AL++N  
Sbjct: 17  VSGCTLAPRYQRPAAPVAAEFPAGGGAPTGPAAADLGWRDVFQDPGLQAVIDQALRENRD 76

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKT------------NSTGQLDS 122
           +  A   +  A+      R+ L P+  A+ S       K              S G   +
Sbjct: 77  LRVAALNVELARAQYGIQRSYLLPTVGATGSGSRSRTAKDLSFTGEPSVGNVFSAGVGLT 136

Query: 123 DWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQIL 181
            ++IDLFG+ R +   +L    S       A L ++S++   Y+ +R  + ++++A Q L
Sbjct: 137 SFEIDLFGRVRSLRNQALEQYLSTEEAHRSAHLALVSEVAVQYLASRALQSQVALAEQTL 196

Query: 182 DLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPA 241
              +++ +L+   F  G TS+L     EA++++   ++   +++     + +  L G P 
Sbjct: 197 QTVQQSYDLAKRTFEAGRTSELDFRTAEAQVETARVNLSAYQQALAQAENALVLLAGGPL 256

Query: 242 TEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYP 301
            + L     +S      L      G+P+DL++ RPDI   E +L  + A IG A++  +P
Sbjct: 257 PKDLPTAPLESQPPVAELP----AGLPSDLLQRRPDILSAEHQLKAANASIGAARAAFFP 312

Query: 302 SLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITW 358
           S+SL  S+        N F   +  W+F P++ LPIF  G+ K+N+  A      Q  ++
Sbjct: 313 SISLTASVGTASTELSNLFTAGSGTWAFSPRIDLPIFTGGRNKANLDAANVRKSIQIASY 372

Query: 359 QETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIE 418
           ++ +  A +EV +AL +     + +      V+  ++   +S + YR+G  S L++L  +
Sbjct: 373 EKAIQVAFREVADALVARGRLDEQLEAQTRRVQAEQRRYDISELRYRKGVDSYLNVLTAQ 432

Query: 419 RATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           R     +  L   +    ++ + LY A+G G+
Sbjct: 433 RDLYGAQQQLIQTRLARYQNSIGLYRALGGGW 464


>gi|301057385|ref|ZP_07198502.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [delta proteobacterium NaphS2]
 gi|300448528|gb|EFK12176.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [delta proteobacterium NaphS2]
          Length = 514

 Score =  219 bits (556), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 130/467 (27%), Positives = 236/467 (50%), Gaps = 23/467 (4%)

Query: 2   NILRAIFSLFIVLLAGCT-VGPEYTKPHMPLLPTQFSIG-----NSKNLINIDTLKWWES 55
             L+A+F   + LLA C  VGP+Y  P  P  P Q+          K+  N     WW +
Sbjct: 7   KRLKALF--LMTLLAACAPVGPDYVPPE-PDAPKQWDTPLKGGLVEKDNDNNALSTWWNA 63

Query: 56  FNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP----- 110
           F+D  L  LV+ A+  NL +  A  R+  A+       A L P+   + S          
Sbjct: 64  FDDPLLTDLVERAVSGNLDLKSARSRVREARAGRGISEAGLVPAVDVAASATRNRLSEDR 123

Query: 111 ---NLKTNSTGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYID 166
              +     +   D+ W+ID+FG  R  +E++ A+L++    +    ++++S++  +Y+D
Sbjct: 124 YGGDEYNLYSAGFDAGWEIDVFGGIRRSVEAATADLEAEEETLRDVMVSLLSEVALNYLD 183

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
            R  +  I +A   L+  +++  L+  ++  G T++LS+ +    ++S  S IP L  + 
Sbjct: 184 VRTIQLGIEVAVHNLEAQERSYRLALSRYEAGLTNELSVQQARYNMESTRSQIPLLRTAL 243

Query: 227 RMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLA 286
              ++ +S LLG         +++ +    P   + +++G+PA+ +RNRPDIR  E++LA
Sbjct: 244 AAAMNRLSVLLGLQPGALNGQLKEHAPIPVP--PLKVSVGVPAEALRNRPDIRRAERQLA 301

Query: 287 DSVAKIGIAKSDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSN 343
              A++G A +DLYP  SL GSI    L+  + F      +  GP +  P+FD G I+SN
Sbjct: 302 AQTARVGTATADLYPKFSLVGSIGLETLSLGDVFSASGLAYLIGPSVTWPVFDAGAIRSN 361

Query: 344 IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
           I+      ++  I ++  +L A++EVENAL +  +++  +  L+ + +  ++++SLS   
Sbjct: 362 IQVQTERQKQALIQYEYAILAALEEVENALVAYADEQNRMKALEASTDAAERAVSLSQSQ 421

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           YR G      +LD +R+    +  L+ +K  +  + V LY A+G G+
Sbjct: 422 YRAGLTDFTSVLDAQRSLLSFQEQLAQSKGNVTSNLVRLYKALGGGW 468


>gi|15077770|gb|AAK83331.1|AF372703_2 putative outer membrane protein [Pseudomonas syringae pv. syringae]
          Length = 475

 Score =  218 bits (555), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 101/469 (21%), Positives = 213/469 (45%), Gaps = 24/469 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLL---PTQFSIGNSKNLINIDTLKWWESFN 57
           MN     +    + L+GC++ P+Y +P  P+    P   +   + +      + W + F 
Sbjct: 1   MNRSIGPWLFAALSLSGCSLIPDYQRPAAPVAAHYPQSSAYAPALSGPLAADMGWRDLFR 60

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST 117
           D +L +L++ AL  N  +  A   + A +      RADLFP+  A+ S        + + 
Sbjct: 61  DPTLQQLIESALLNNRDLRVAALNVEAYQAQYRIQRADLFPAISATGSGTRQRQPASITQ 120

Query: 118 GQLDS------------DWKIDLFGQRRHIESSLA-NLDSAYAQVDIAKLNVISKLIPSY 164
                             +++DLFG+ R +    +    S+       +L++++ +  +Y
Sbjct: 121 TGGPVTSGTYSATLGISSYELDLFGRIRSLSDQASLTYLSSEEARRSTQLSLVASVATAY 180

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           +  R  +E +++    L  Y+K+++L+      GA+S L L +    ++S  + + T ++
Sbjct: 181 LTWRADQELLALTQDTLMSYEKSLKLTTRSQQVGASSSLDLAQSRTSVESARASLATFQR 240

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
               +++N++ L+G    +        S          +  G+P+DL++ RPDI   E +
Sbjct: 241 QAAQDLNNLTLLVGTEVAD-----SAPSRPLSSEWLAEVPAGLPSDLLQRRPDILEAEYQ 295

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIK 341
           L  + A IG A++  +PS++L  +   +       F G +  W F P++ +PIF+ G ++
Sbjct: 296 LQSANASIGAARAAFFPSITLTANAGTSSTELSGLFKGGSGGWVFSPQIDIPIFNAGSLR 355

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           +++  ++         +++++  A +EV + L +    K  +      V+ +++   L+ 
Sbjct: 356 ASLDYSKIQKDISVSKYEKSIQTAFQEVADGLAARQTYKHQLKAQSDLVQANQEYYRLAE 415

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             YR G  S L  LD +R+    + +L   +     + V+LY A+G G+
Sbjct: 416 RRYRIGVDSSLTFLDAQRSLFSAQQNLITDRLSQLTAEVNLYKALGGGW 464


>gi|66045842|ref|YP_235683.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. syringae B728a]
 gi|10764639|gb|AAG22805.1|AF297010_1 putative outer membrane efflux protein OprM [Pseudomonas syringae
           pv. syringae]
 gi|63256549|gb|AAY37645.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. syringae B728a]
          Length = 478

 Score =  218 bits (555), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 101/469 (21%), Positives = 212/469 (45%), Gaps = 24/469 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLL---PTQFSIGNSKNLINIDTLKWWESFN 57
           MN     +    + L+GC++ P+Y +P  P+    P   +   + +      + W + F 
Sbjct: 7   MNRSIGPWLFTALSLSGCSLIPDYQRPAAPVAAHYPQSSAYAPALSGPLAADMGWRDLFR 66

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST 117
           D +L +L++ AL  N  +  A   + A +      RADLFP+  A+ S        + + 
Sbjct: 67  DPTLQQLIESALLNNRDLRVAALNVEAYQAQYRIQRADLFPAISATGSGTRQRQPASITQ 126

Query: 118 GQLDS------------DWKIDLFGQRRHIESSLA-NLDSAYAQVDIAKLNVISKLIPSY 164
                             +++DLFG+ R +    +    S+        L++++ +  +Y
Sbjct: 127 TGGPVTSGTYSATLGISSYELDLFGRIRSLSDQASLTYLSSEEARRSTLLSLVASVATAY 186

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           +  R  +E +++    L  Y+K+++L+      GA+S L L +    ++S  + + T ++
Sbjct: 187 LTWRADQELLALTQDTLMSYEKSLKLTTRSQQVGASSSLDLAQSRTSVESARASLATFQR 246

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
               +++N++ L+G    +        S          +  G+P+DL++ RPDI   E +
Sbjct: 247 QAAQDLNNLTLLVGTEVAD-----SAPSRPLSSEWLAEVPAGLPSDLLQRRPDILEAEYQ 301

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIK 341
           L  + A IG A++  +PS++L  +   +       F G +  W F P++ +PIF+ G ++
Sbjct: 302 LQSANASIGAARAAFFPSITLTANAGTSSTELSGLFKGGSGGWVFSPQIDIPIFNAGSLR 361

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           +++  ++         +++++  A +EV + L +    K  +      V+ +++   L+ 
Sbjct: 362 ASLDYSKIQKDISVSKYEKSIQTAFQEVADGLAARQTYKHQLKAQSDLVQANQEYYRLAE 421

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             YR G  S L +LD +R+    +  L   +     + V+LY A+G G+
Sbjct: 422 RRYRIGVDSSLTLLDAQRSLFSAQQTLITDRLSQLTAEVNLYKALGGGW 470


>gi|330996773|ref|ZP_08320645.1| RND transporter, HAE1 family [Paraprevotella xylaniphila YIT 11841]
 gi|329572495|gb|EGG54146.1| RND transporter, HAE1 family [Paraprevotella xylaniphila YIT 11841]
          Length = 1489

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 105/455 (23%), Positives = 211/455 (46%), Gaps = 16/455 (3%)

Query: 6    AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
             I       L+ C +G  YT+P MP LP +     +++  +I  L WWE +NDT+L +L+
Sbjct: 1040 LILLAAGTGLSSCQIGKSYTRPDMP-LPARLDT-LTQDTASIGDLSWWELYNDTTLQQLI 1097

Query: 66   KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF--------IPNLKTNST 117
              AL  N  +  A+ R+N          A++FP + A ++             +  +  +
Sbjct: 1098 HRALTYNKDLKIASARMNELAALKRVDFANMFPQATARLNGNRETTNYGDDNFDADSELS 1157

Query: 118  GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISI 176
                  W++DL+G  R   + S A   ++       K+ +++++  SY +       ++I
Sbjct: 1158 LTASISWELDLWGNLRWARDRSTAEFLASVENCRAVKMGLVAQVAQSYFELMALDNELAI 1217

Query: 177  AHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL 236
              + L+  ++ + L+ ++F  G TS++   + + E+    + +P LE+   +    I+ L
Sbjct: 1218 VRRTLEARREGVRLAEIRFKGGLTSEIVFQQAKVELAKTATMVPDLERRISLKESEIALL 1277

Query: 237  LGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
             G         +  +       L     +G+P+ L+  RPDIR  E++L  + A++G+A 
Sbjct: 1278 TGDFPYAVNRNILPEEIQLPDALP----LGLPSTLLERRPDIRKAERELMAAHAEVGLAY 1333

Query: 297  SDLYPSLSLNGSIALTHDNSFPGYNTHW-SFGPKLYLPIFDKGKIKSNIRRAESSAQEQY 355
            ++++P L+L  ++    +       + +      L  P+F  GK ++ ++   ++ +   
Sbjct: 1334 TNMFPRLALTATLGTESETLRDFLKSPYSYLAGNLLSPLFAMGKNRAALKAKRAAYEGAV 1393

Query: 356  ITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDIL 415
              +++TVL A KE  +A+ + N+ K I    +   E  + ++ L+ + Y  G    LD+L
Sbjct: 1394 AEYEQTVLTAFKETHDAIINFNKIKDIYESRRQLAEASRTAVELAQLQYINGVIGYLDLL 1453

Query: 416  DIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            D +R     +V LS A        ++LY A+G G+
Sbjct: 1454 DAQRNYFDAQVSLSNAVCNKQLMIINLYKALGGGW 1488


>gi|242309948|ref|ZP_04809103.1| conserved hypothetical protein [Helicobacter pullorum MIT 98-5489]
 gi|239523245|gb|EEQ63111.1| conserved hypothetical protein [Helicobacter pullorum MIT 98-5489]
          Length = 466

 Score =  218 bits (554), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 105/463 (22%), Positives = 209/463 (45%), Gaps = 17/463 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           MN          +L+ GC++ P+Y +P    LP  F +  SK  I+     WW+ FND  
Sbjct: 1   MNKSILALVCLGILVGGCSLSPKYEQPKTN-LPQDFGVEASKESISQT---WWKDFNDEY 56

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI--------PNL 112
           LN +V+ AL+ N  +  A ER++ A+ +    R+D +P+  A                + 
Sbjct: 57  LNNIVEEALKNNYDLAVAMERVSQARSSWSYARSDRYPTISAQGEATRNKENPSQGMYDN 116

Query: 113 KTNSTGQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
             N +      +++DL+G+ R  + S  A L +  A  D  +L++I+ ++ SY       
Sbjct: 117 YNNFSLSGVLSFELDLWGKARDTDRSAYATLLANKANRDTVRLSLIANVVESYFGILTLN 176

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
            ++ I+   L   +++ E    +F  G  S++ + + ++E+ S+ + + +L         
Sbjct: 177 NQVQISQNTLKSREESYEYRKKEFEAGKISEIDMQQAKSEMASVRAQLQSLLMERNSAQT 236

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
           ++  LLG       +          P        G+P+ L+  RPDI    + L  +   
Sbjct: 237 SLLILLGRDPQGIFNVELPTEAQMLPKAPKVP-TGLPSTLLEQRPDIEMATQNLKAANFS 295

Query: 292 IGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
           IG+A++  +P++SL G +       +  F   ++ W++G      + D G+  +N+  ++
Sbjct: 296 IGVARAAYFPTISLTGLVGYVSPELNELFQSSSSTWNYGGTFVGNVIDFGRTSANVELSK 355

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           S  +E  + +  TV  A  EV N L +     + +  L   VE  ++++ L+ + Y++G 
Sbjct: 356 SQYREMLLNYGNTVRQAFGEVRNYLYNYGMSDERLKSLDEQVEALRRTLVLAEMRYKEGY 415

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            + L++L  +      E+    A  +   + ++LY A G G++
Sbjct: 416 TNYLEVLTTQSNLFAAELTQQSANLENLSAVINLYKAFGGGWD 458


>gi|254237340|ref|ZP_04930663.1| Major intrinsic multiple antibiotic resistance efflux outer
           membrane protein OprM precursor [Pseudomonas aeruginosa
           C3719]
 gi|126169271|gb|EAZ54782.1| Major intrinsic multiple antibiotic resistance efflux outer
           membrane protein OprM precursor [Pseudomonas aeruginosa
           C3719]
          Length = 485

 Score =  218 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 101/472 (21%), Positives = 197/472 (41%), Gaps = 25/472 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQ-----FSIGNSKNLINIDTLKWWES 55
           M       ++  V+L+GC++ P+Y +P  P+         +        +    + W E 
Sbjct: 1   MKRSFLSLAVAAVVLSGCSLIPDYQRPEAPVAAAYPQGQAYGQNTGAAAVPAADIGWREF 60

Query: 56  FNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTN 115
           F D  L +L+ +AL+ N  +  A   + A +      RADLFP      S          
Sbjct: 61  FRDPQLQQLIGLALENNRDLRVAALNVEAFRAQYRIQRADLFPRIGVDGSGTRQRLPGDL 120

Query: 116 STGQLDS------------DWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIP 162
           ST    +             W++DLFG+ R +   +L    +       A+  +++ +  
Sbjct: 121 STTGSPAISSQYGVTLGTTAWELDLFGRLRSLRDQALEQYLATEQAQRSAQTTLVASVAT 180

Query: 163 SYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTL 222
           +Y+  +  + ++ +    L  Y+K+ +L+   +  G  S L L + +  ++   + +   
Sbjct: 181 AYLTLKADQAQLQLTKDTLGTYQKSFDLTQRSYDVGVASALDLRQAQTAVEGARATLAQY 240

Query: 223 EKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQE 282
            +    + + +  LLG      +     Q       L   +  G+P+DL++ RPDI   E
Sbjct: 241 TRLVAQDQNALVLLLG----SGIPANLPQGLGLDQTLLTEVPAGLPSDLLQRRPDILEAE 296

Query: 283 KKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGK 339
            +L  + A IG A++  +PS+SL  +           F   +  W F P + LPIF  G 
Sbjct: 297 HQLMAANASIGAARAAFFPSISLTANAGTMSRQLSGLFDAGSGSWLFQPSINLPIFTAGS 356

Query: 340 IKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSL 399
           +++++  A+         +++ +  A +EV + L +     + +   +  V+   +   L
Sbjct: 357 LRASLDYAKIQKDINVAQYEKAIQTAFQEVADGLAARGTFTEQLQAQRDLVKASNEYYQL 416

Query: 400 SMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +   YR G  + L +LD +R+    +  L   +     S V+LY A+G G+N
Sbjct: 417 ADKRYRTGVDNYLTLLDAQRSLFTAQQQLITDRLNQLTSEVNLYKALGGGWN 468


>gi|190893232|ref|YP_001979774.1| nodulation protein (outer membrane efflux protein) [Rhizobium etli
           CIAT 652]
 gi|190698511|gb|ACE92596.1| nodulation protein (outer membrane efflux protein) [Rhizobium etli
           CIAT 652]
          Length = 478

 Score =  218 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 186/464 (40%), Positives = 282/464 (60%), Gaps = 15/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M  LR      ++LL+GC VGP++  P MP LP +F  G +K++ ++ T  WW +F D  
Sbjct: 1   MVSLRFATPALLLLLSGCVVGPDHAPPEMP-LPAKFGEGGTKSVGDVATAAWWTAFKDPR 59

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN--------- 111
           LN  V+  L+QNLT+ QA ERINAA  N+    A   PS     SH              
Sbjct: 60  LNGYVQAGLEQNLTVQQAIERINAASANVTIAGAGALPSLNVGASHTVSGQKGELRTQFD 119

Query: 112 LKTNSTGQLDSDWKID-LFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
            +  S G +   W +D     +R  ES+ A+LDSAYA  D+AKL ++  L+ SYID R +
Sbjct: 120 TRNTSAGDVQLSWLLDLFGLYKRSTESAAASLDSAYASADVAKLTLVQDLVSSYIDVRFY 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           ++R++++   L   ++  EL+  +   GA S+L +V+ E  ++S  ++IP LE + R++ 
Sbjct: 180 QQRLALSKANLKSRQETYELTKFQLEAGAASRLDVVQAEGLVQSTLAEIPGLETNIRISA 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           H+I+TLLG PA+  ++ + +     QP  +  IN GIPADLIRNRPDIR  E+ LA + A
Sbjct: 240 HHIATLLGLPASALVNELLRGGG--QPVFHGGINSGIPADLIRNRPDIRVAERDLAAATA 297

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS--FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
            IG+A++ LYPS+SL+GSI+ ++ N     G  T WSFGP L LPIFD G++++N++ A+
Sbjct: 298 NIGVAEAQLYPSISLSGSISPSYINQRGVHGGLTPWSFGPTLNLPIFDGGRLRANVKSAQ 357

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           S A   Y+ W+ TVL A+++VENAL ++  D + V  LQ  V+  ++++ LS  +Y+ G 
Sbjct: 358 SDAATAYLNWKSTVLTAVEQVENALAAVRRDAQTVAALQAQVKTTQETLELSTASYKDGA 417

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            SLLD+LD +R  +  +  L+ + +Q+AK YV L IA+G GY P
Sbjct: 418 SSLLDVLDAQRQVSLAQASLAQSVQQMAKDYVSLNIAVGGGYAP 461


>gi|86359005|ref|YP_470897.1| nodulation protein (outer membrane efflux protein) [Rhizobium etli
           CFN 42]
 gi|86283107|gb|ABC92170.1| nodulation protein (outer membrane efflux protein) [Rhizobium etli
           CFN 42]
          Length = 478

 Score =  218 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 186/464 (40%), Positives = 283/464 (60%), Gaps = 15/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M  LR      ++LL+GC VGP++  P MP LP +F  G +K++ ++ T  WW +FND  
Sbjct: 1   MVSLRFATPALLLLLSGCVVGPDHAPPEMP-LPAKFGEGGTKSVGDVATAAWWTAFNDPK 59

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN--------- 111
           LN  V+  L QNL++ QA ERINAA  N+ +  A   P+     SH              
Sbjct: 60  LNGYVQAGLDQNLSVQQAIERINAASANVTTAGAGGLPNLTVGGSHTVSGQRGELRTQFD 119

Query: 112 LKTNSTGQLDSDWKID-LFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
            +  + G +   W +D     +R  ES+LA+LDSAYA  D+AKL ++  L+ SYID R++
Sbjct: 120 TRNTTAGDVQLSWLLDLFGLYKRSTESALASLDSAYASADVAKLTLVQDLVSSYIDVRYY 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           ++R++++   L   ++  EL+  +   GA S+L +V+ E  ++S  ++IP LE + R++ 
Sbjct: 180 QQRLALSKANLKSRQETYELTKFQLEAGAASRLDVVQAEGLVQSTLAEIPGLETNIRVSA 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           H+I+TLLG PA+  +  +       QP     IN GIPADLIRNRPDIR  E+ LA + A
Sbjct: 240 HHIATLLGLPASALVDEL--LKGRGQPVFRGGINSGIPADLIRNRPDIRVAERDLAAATA 297

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS--FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
            IG+A++ LYPS+SL+GSI+ ++ N     G  T WSFGP L LPIFD G++++N++ A+
Sbjct: 298 NIGVAEAQLYPSISLSGSISPSYINQRGIHGDLTPWSFGPTLNLPIFDGGRLRANVKSAQ 357

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           S+A   Y+ W+ TVL A+++VENAL ++  D + V  LQ  V+  ++++ LS  +Y+ G 
Sbjct: 358 STAATAYLNWKSTVLTAVEQVENALAAVRRDARTVAALQAQVKTTQETLELSTASYKDGA 417

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            SLLD+LD +R  +  +  L+ A +Q+AK YV L IA+G GY P
Sbjct: 418 SSLLDVLDAQRQVSLAQASLAQAVQQMAKDYVSLNIAVGGGYAP 461


>gi|15595624|ref|NP_249118.1| Major intrinsic multiple antibiotic resistance efflux outer
           membrane protein OprM precursor [Pseudomonas aeruginosa
           PAO1]
 gi|107099413|ref|ZP_01363331.1| hypothetical protein PaerPA_01000425 [Pseudomonas aeruginosa PACS2]
 gi|116054158|ref|YP_788601.1| major intrinsic multiple antibiotic resistance efflux outer
           membrane protein OprM precursor [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218889169|ref|YP_002438033.1| Major intrinsic multiple antibiotic resistance efflux outer
           membrane protein OprM precursor [Pseudomonas aeruginosa
           LESB58]
 gi|254243525|ref|ZP_04936847.1| Major intrinsic multiple antibiotic resistance efflux outer
           membrane protein OprM precursor [Pseudomonas aeruginosa
           2192]
 gi|296386926|ref|ZP_06876425.1| Major intrinsic multiple antibiotic resistance efflux outer
           membrane protein OprM precursor [Pseudomonas aeruginosa
           PAb1]
 gi|313111949|ref|ZP_07797738.1| major intrinsic multiple antibiotic resistance efflux outer
           membrane protein OprM precursor [Pseudomonas aeruginosa
           39016]
 gi|12644685|sp|Q51487|OPRM_PSEAE RecName: Full=Outer membrane protein oprM; Flags: Precursor
 gi|9946283|gb|AAG03816.1|AE004479_11 Major intrinsic multiple antibiotic resistance efflux outer
           membrane protein OprM precursor [Pseudomonas aeruginosa
           PAO1]
 gi|3184190|dbj|BAA28694.1| OprM [Pseudomonas aeruginosa]
 gi|115589379|gb|ABJ15394.1| major intrinsic multiple antibiotic resistance efflux outer
           membrane protein OprM precursor [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126196903|gb|EAZ60966.1| Major intrinsic multiple antibiotic resistance efflux outer
           membrane protein OprM precursor [Pseudomonas aeruginosa
           2192]
 gi|218769392|emb|CAW25152.1| Major intrinsic multiple antibiotic resistance efflux outer
           membrane protein OprM precursor [Pseudomonas aeruginosa
           LESB58]
 gi|310884240|gb|EFQ42834.1| major intrinsic multiple antibiotic resistance efflux outer
           membrane protein OprM precursor [Pseudomonas aeruginosa
           39016]
          Length = 485

 Score =  218 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 101/472 (21%), Positives = 197/472 (41%), Gaps = 25/472 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQ-----FSIGNSKNLINIDTLKWWES 55
           M       ++  V+L+GC++ P+Y +P  P+         +        +    + W E 
Sbjct: 1   MKRSFLSLAVAAVVLSGCSLIPDYQRPEAPVAAAYPQGQAYGQNTGAAAVPAADIGWREF 60

Query: 56  FNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTN 115
           F D  L +L+ +AL+ N  +  A   + A +      RADLFP      S          
Sbjct: 61  FRDPQLQQLIGVALENNRDLRVAALNVEAFRAQYRIQRADLFPRIGVDGSGTRQRLPGDL 120

Query: 116 STGQLDS------------DWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIP 162
           ST    +             W++DLFG+ R +   +L    +       A+  +++ +  
Sbjct: 121 STTGSPAISSQYGVTLGTTAWELDLFGRLRSLRDQALEQYLATEQAQRSAQTTLVASVAT 180

Query: 163 SYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTL 222
           +Y+  +  + ++ +    L  Y+K+ +L+   +  G  S L L + +  ++   + +   
Sbjct: 181 AYLTLKADQAQLQLTKDTLGTYQKSFDLTQRSYDVGVASALDLRQAQTAVEGARATLAQY 240

Query: 223 EKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQE 282
            +    + + +  LLG      +     Q       L   +  G+P+DL++ RPDI   E
Sbjct: 241 TRLVAQDQNALVLLLG----SGIPANLPQGLGLDQTLLTEVPAGLPSDLLQRRPDILEAE 296

Query: 283 KKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGK 339
            +L  + A IG A++  +PS+SL  +           F   +  W F P + LPIF  G 
Sbjct: 297 HQLMAANASIGAARAAFFPSISLTANAGTMSRQLSGLFDAGSGSWLFQPSINLPIFTAGS 356

Query: 340 IKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSL 399
           +++++  A+         +++ +  A +EV + L +     + +   +  V+   +   L
Sbjct: 357 LRASLDYAKIQKDINVAQYEKAIQTAFQEVADGLAARGTFTEQLQAQRDLVKASDEYYQL 416

Query: 400 SMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +   YR G  + L +LD +R+    +  L   +     S V+LY A+G G+N
Sbjct: 417 ADKRYRTGVDNYLTLLDAQRSLFTAQQQLITDRLNQLTSEVNLYKALGGGWN 468


>gi|152985622|ref|YP_001345922.1| outer membrane protein OprM precursor [Pseudomonas aeruginosa PA7]
 gi|150960780|gb|ABR82805.1| outer membrane protein OprM precursor [Pseudomonas aeruginosa PA7]
          Length = 485

 Score =  217 bits (552), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 101/472 (21%), Positives = 197/472 (41%), Gaps = 25/472 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQ-----FSIGNSKNLINIDTLKWWES 55
           M       ++  V+L+GC++ P+Y +P  P+         +        +    + W E 
Sbjct: 1   MKRSFLSLAVAAVVLSGCSLIPDYQRPEAPVAAAYPQGQAYGQNTGAAAVPAADIGWREF 60

Query: 56  FNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTN 115
           F D  L +L+ +AL+ N  +  A   + A +      RADLFP      S          
Sbjct: 61  FRDPQLQQLIGVALENNRDLRVAALNVEAFRAQYRIQRADLFPRIGVDGSGTRQRLPGDL 120

Query: 116 STGQLDS------------DWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIP 162
           ST    +             W++DLFG+ R +   +L    +       A+  +++ +  
Sbjct: 121 STTGNPAISSQYGVTLGTTAWELDLFGRLRSLRDQALEQYLATEQAQRSAQTTLVASVAT 180

Query: 163 SYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTL 222
           +Y+  +  + ++ +    L  Y+K+ +L+   +  G  S L L + +  ++   + +   
Sbjct: 181 AYLTLKADQAQLQLTRDTLGTYQKSFDLTQRSYDVGVASALDLRQAQTAVEGARATLAQY 240

Query: 223 EKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQE 282
            +    + + +  LLG      +     Q       L   +  G+P+DL++ RPDI   E
Sbjct: 241 TRLVAQDQNALVLLLG----SGIPANLPQGLGLDQTLLTEVPAGLPSDLLQRRPDILEAE 296

Query: 283 KKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGK 339
            +L  + A IG A++  +PS+SL  +           F   +  W F P + LPIF  G 
Sbjct: 297 HQLMAANASIGAARAAFFPSISLTANAGTMSRQLSGLFDAGSGSWLFQPSINLPIFTAGS 356

Query: 340 IKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSL 399
           +++++  A+         +++ +  A +EV + L +     + +   +  V+   +   L
Sbjct: 357 LRASLDYAKIQKDINVAQYEKAIQTAFQEVADGLAARGTFTEQLQAQRDLVKASDEYYQL 416

Query: 400 SMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +   YR G  + L +LD +R+    +  L   +     S V+LY A+G G+N
Sbjct: 417 ADKRYRTGVDNYLTLLDAQRSLFTAQQQLITDRLNQLTSEVNLYKALGGGWN 468


>gi|330957870|gb|EGH58130.1| NodT family outer membrane efflux lipoprotein [Pseudomonas syringae
           pv. maculicola str. ES4326]
          Length = 486

 Score =  217 bits (552), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 104/470 (22%), Positives = 202/470 (42%), Gaps = 24/470 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDT----LKWWESF 56
           M+     F++   +L GC++ PEY +P  P+                        W   F
Sbjct: 1   MSKSLISFAVTAFILGGCSLIPEYKQPEAPVAAQYPQGPAYTPAEAAKMAAAEQGWRHFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           ND +L +L++ AL  N  +  A   I+A +      RADLFP+  A+ S          +
Sbjct: 61  NDPALQQLIETALLNNRDLRVAALNIDAYRAQYRIQRADLFPAVSATGSGARQRVPADQT 120

Query: 117 TGQLDS------------DWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPS 163
                +             +++DLFG+ R + E +L    +        ++++++ +  +
Sbjct: 121 QTGQSAITSSYSATLGVSAYELDLFGRVRSLSEQALETYFATEEARRATQISLVANVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  +  KE + +    L  Y+++  L+      G +S L L +    ++S  + +   +
Sbjct: 181 YMTWQADKELLKLTQDTLKTYEESFRLTSRSNEVGVSSALDLSQSRTAVESARARLAQYQ 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    + +++  LLG    + L      S     ++   +  G+P+DL++ RPDI   E 
Sbjct: 241 RLVAQDQNSLVLLLGTGLPDNL----PASQLLDSDMLTEMPAGLPSDLLQRRPDILQAEH 296

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  S           F G +  W F P + +PIF+ G +
Sbjct: 297 TLKAANANIGAARAAFFPSISLTASAGTGSTELSGLFKGGSGTWLFQPSINIPIFNAGSL 356

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++++  ++   +     +++ +  A +EV + L S     + +   +  V  ++    L+
Sbjct: 357 RASLDYSKIQKEISVANYEKAIQTAFQEVSDGLASRKTYDEQLQAQRDFVTANQDYYRLA 416

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              YR G  S L  LD +R+    +  L   +     S V+LY A+G G+
Sbjct: 417 ERRYRIGIDSNLTFLDAQRSLFSAQQTLITDRLSQLTSEVNLYKALGGGW 466


>gi|85858611|ref|YP_460813.1| type I secretion outer membrane protein [Syntrophus aciditrophicus
           SB]
 gi|85721702|gb|ABC76645.1| type I secretion outer membrane protein [Syntrophus aciditrophicus
           SB]
          Length = 516

 Score =  217 bits (551), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 127/468 (27%), Positives = 214/468 (45%), Gaps = 26/468 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           MN       L +++LAGC VGP+Y +P +   P      +         + WW+  ND  
Sbjct: 38  MNK-SIFAILIVLVLAGCAVGPDYRRPVIESPPAWRI--DEVEAQETANMAWWDQLNDPV 94

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP---------- 110
           +N L+  AL+QNL +  AT RI+         R+ LFP    +                 
Sbjct: 95  MNSLIDEALKQNLDLKIATARIDEYIGRYWMGRSGLFPQIGVTAEAGRSRSSEEGAAPMS 154

Query: 111 ----NLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
               N      G     W+IDL+G+ RR  E+S A+L +         L+++S +   YI
Sbjct: 155 PQVENPADFYQGFFSGSWEIDLWGKLRRATEASRADLLATQEARQAVILSLVSAVANGYI 214

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
             R F ++  IA       +++ +L   +F  G  S+L L ++++E +   + IP +EK 
Sbjct: 215 TLRDFDKQREIAVNTAKTREESYKLFKQRFEGGVISELELNQVKSEYEQALATIPQIEKQ 274

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
                + +S LLG            +  +    +   + +G+P+DL+ NRPDIR  E+ L
Sbjct: 275 IVFQENALSRLLGRNPG-----PIARGKHIDELVLPAVPMGLPSDLLANRPDIRQAEQVL 329

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A+IG+A++  +P+LSL G          N F G    WS+G  +  PIF  G I+ 
Sbjct: 330 VAANARIGVARAQYFPALSLTGLFGQASADLSNLFTGSARVWSWGGSVAAPIFTGGAIRG 389

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            ++ AE+  Q+    +Q  +  A +EVE+AL      ++ +   Q  V+  +     + +
Sbjct: 390 QVKAAEAVRQQALFGYQRAIQTAFREVEDALVDQRRTREQLEAQQRQVDSLRDYTRFARL 449

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            Y  G  S +++LD ER+    E+     +  L  + V+LY A+G G+
Sbjct: 450 RYENGYTSYIEVLDAERSLFSAELTYVQTQGTLFGALVNLYKAMGGGW 497


>gi|58294348|gb|AAW70092.1| NodTch [Rhizobium etli]
          Length = 479

 Score =  217 bits (551), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 185/465 (39%), Positives = 283/465 (60%), Gaps = 16/465 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M  LR      ++LL+GC VGP++  P MP LP +F  G +K++ ++ T  WW +FND  
Sbjct: 1   MVSLRFATPALLLLLSGCVVGPDHAPPEMP-LPAKFGEGGTKSVGDVATAAWWTAFNDPK 59

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSY----------ASISHRFIP 110
           LN  V+  L QNL++ QA ERINAA  N+ +  A   P+                 R   
Sbjct: 60  LNGYVQAGLDQNLSVQQAIERINAASANVTTAGAGPLPNLTVGGGSHMVSGQRGELRTQF 119

Query: 111 NLKTNSTGQLDSDWKID-LFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
           + +  + G +   W +D     +R  ES+LA+LDSAYA  D+AKL ++  L+ SYID R+
Sbjct: 120 DTRNTTAGDVQLSWLLDLFGLYKRTTESALASLDSAYASADVAKLTLVQDLVSSYIDVRY 179

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
           +++R++++   L   ++  EL+  +   GA S+L +V+ E  ++S  ++IP LE + R++
Sbjct: 180 YQQRLALSKANLKSRQETYELTKFQLEAGAASRLDVVQAEGLVQSTLAEIPGLETNIRVS 239

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            H+I+TLLG PA+  +  +       QP     IN GIPADLIRNRPDIR  E+ LA + 
Sbjct: 240 AHHIATLLGLPASALVDEL--LKGRGQPVFRGGINSGIPADLIRNRPDIRVAERDLAAAT 297

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHDNS--FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
           A IG+A++ LYPS+SL+GSI+ ++ N     G  T WSFGP L LPIFD G++++N++ A
Sbjct: 298 ANIGVAEAQLYPSISLSGSISPSYINQRGIHGDLTPWSFGPTLNLPIFDGGRLRANVKSA 357

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           +S+A   Y+ W+ TVL A+++VENAL ++  D + V  LQ  V+  ++++ LS  +Y+ G
Sbjct: 358 QSTAATAYLNWKSTVLTAVEQVENALAAVRRDARTVAALQAQVKTTQETLELSTASYKDG 417

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
             SLLD+LD +R  +  +  L+ A +Q+AK YV L IA+G GY P
Sbjct: 418 ASSLLDVLDAQRQVSLAQASLAQAVQQMAKDYVSLNIAVGGGYAP 462


>gi|299068425|emb|CBJ39649.1| putative outer membrane protein (Probable drug efflux lipoprotein)
           [Ralstonia solanacearum CMR15]
          Length = 506

 Score =  217 bits (551), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 109/462 (23%), Positives = 206/462 (44%), Gaps = 29/462 (6%)

Query: 14  LLAGCTVGPEYTKPHMPLLPTQFSIG-----------NSKNLINIDTLKWWESFNDTSLN 62
           +L+GC++ P Y +P  P+                     +       L W E F D  L 
Sbjct: 14  VLSGCSLAPRYERPAAPVAGDYPQAPTGYGVPADTAKPGETAPRATDLGWREFFPDPRLQ 73

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLD- 121
           +L+ ++L+ N  +  A   I AA+       ADL P   A+ ++      ++ S    + 
Sbjct: 74  RLIGLSLENNRDLRVAILNIEAARAQYRQQIADLLPPVNATATYTRSLTPQSISQTGQEI 133

Query: 122 -----------SDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                      S+++++LF       S+ A+  +        ++++IS++  +Y++ R +
Sbjct: 134 NTKQYQLGVGISNYQVNLFSVGDVTSSARASYLATEEGQRATQISLISQVAKAYLNERAY 193

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
            E++ +A Q L   +   +L+  +F  GA+S L L + E  ++S    +  L + +    
Sbjct: 194 AEQLELAQQTLKGREDYYKLAKQRFDVGASSALDLRQNETLVESARVSVAQLTRQYAQAT 253

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  L+G P       +   +      +   I  G+P++L+  RPDIR  E+KL  + A
Sbjct: 254 NALVLLVGSPLPAD---LPPPTTVSSEKIVADIPPGLPSELLEQRPDIRQAEQKLVAANA 310

Query: 291 KIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG+A++  +PSL L  ++        + F      WSF P L LPIF+ G    N+   
Sbjct: 311 NIGVARAAFFPSLGLTSNVGTASTALHDLFKSGTGLWSFVPNLTLPIFNWGTNVFNLDLT 370

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           +++ +     +++T+  A +EV +AL +     + V   +   +   + ++LS   YR G
Sbjct: 371 KANQKIAVANYEKTIQTAFQEVSDALVARGTLDEQVAAQKRFRDATAERLTLSDQRYRNG 430

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
             S LD+LD +R     +  L   +     + +DLY A+G G
Sbjct: 431 VSSFLDVLDAQRDLFSADQTLVQTRLARLTNAIDLYTALGGG 472


>gi|78062045|ref|YP_371953.1| RND efflux system outer membrane lipoprotein [Burkholderia sp. 383]
 gi|77969930|gb|ABB11309.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. 383]
          Length = 482

 Score =  217 bits (551), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 106/467 (22%), Positives = 212/467 (45%), Gaps = 19/467 (4%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNS-KNLINIDTLKWWESFNDT 59
           M IL+       +L+A CT+ P Y +P   +     +         +   + W + + D 
Sbjct: 1   MKILKLAVLPAALLMASCTMIPTYHRPDPSVAAQYATAAQDNAGQPSAAEVGWRDFYTDP 60

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQ 119
            L  L+ +AL+ N  +  A   I AA+      RADL P+  A  S          ST  
Sbjct: 61  HLQTLIGMALENNRDLRVAVLNIEAARAQYRIQRADLLPTLSAGASGSIQRLPSDLSTTG 120

Query: 120 L-----------DSDWKIDLFGQRRHIESSLAN-LDSAYAQVDIAKLNVISKLIPSYIDA 167
                        + +++DLFG+ R +         +  A     ++++I+++  +++  
Sbjct: 121 QAGVTRSYNVGGVASYELDLFGKIRSLTEQAMQTYLATEATRKATQISLIAEVATAWLTL 180

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
           +  ++   +    L   + +++++   +  G +S L L + E  +++ E ++   ++  R
Sbjct: 181 QADQDIKVLTADTLASQRASLKITEAGYRNGTSSLLDLRQAETTVRAAEVNLAQYDRQVR 240

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
            +++ ++ L+G P  +    +  + +     L   +  G+P+DL+  RPDI   E +L  
Sbjct: 241 TDINALTLLVGVPLDD---ALLSRESLATVRLDEDLPAGLPSDLLARRPDIIAAEHQLMA 297

Query: 288 SVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNI 344
           S A IG A++  +PS+SL  +         N F   +  WSFGP + +PIFD G+  +N+
Sbjct: 298 SNANIGAARAAFFPSISLTANGGTASASLRNLFDPGSAAWSFGPTISVPIFDYGRNSANL 357

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
             ++ +   +  T+Q+ V  A +EV +AL       +  T  +  V+  + +  LS + Y
Sbjct: 358 AVSKVNRDIEVATYQKAVQTAFREVSDALDGRATWGQQETAQRLLVDASQSAYRLSDVRY 417

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           R+G    +++L  +R+    + +L   +     + VDLY A+G G+ 
Sbjct: 418 REGVDGYVNVLVNQRSLYDAQQNLVKVRLARMSNTVDLYRALGGGWQ 464


>gi|330819605|ref|YP_004348467.1| RND efflux system, outer membrane lipoprotein, NodT [Burkholderia
           gladioli BSR3]
 gi|327371600|gb|AEA62955.1| RND efflux system, outer membrane lipoprotein, NodT [Burkholderia
           gladioli BSR3]
          Length = 510

 Score =  216 bits (550), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 113/476 (23%), Positives = 202/476 (42%), Gaps = 29/476 (6%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIG-----------NSKNLINIDT 49
           M         F ++  GCT+ P Y +P  P+  +  S G           +S N      
Sbjct: 4   MRKFVLSAMAFALVATGCTMAPHYQRPAAPVSGSFPSDGVYATQPGADGSHSANGQAAAD 63

Query: 50  LKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFP----------- 98
           + W   F D  L  L++IAL+ N  +  +   I AA+      RA LFP           
Sbjct: 64  IGWRNFFADPRLQALIEIALKNNRDLRVSVLNIEAARAQYQITRAGLFPTLDGTGTGNTQ 123

Query: 99  SSYASISHRFIPNLKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVI 157
              A +S    P +  +    L + W++DLFG+ + + + +LA   S       A++++I
Sbjct: 124 RLPAGVSTTGSPFISRDYNVGLSASWELDLFGRIQSLKDQALAQYLSTAQARKAAEISLI 183

Query: 158 SKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIES 217
           S++   Y+  +   + + +    L   + +  L+ L+F  G  S+L L + +  ++   +
Sbjct: 184 SQVADQYLTLQSTDDLLKVTEDTLKTAQDSYNLTKLQFDNGTGSELDLRQAQTVVEQALA 243

Query: 218 DIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPD 277
           +     +     V+ +  L+G P  + L       +    +L   I  G+P+DL+  RPD
Sbjct: 244 NQQAEARDRAQAVNALVLLIGEPLPDDLPAGLPLDS---QSLLTDIPAGLPSDLLTRRPD 300

Query: 278 IRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPI 334
           I   E+ L  + A IG A++  +P +SL  +           F      WSF P + LPI
Sbjct: 301 IMEAEQTLLAANANIGAARAAFFPKISLTAAFGTASPTLGGLFKAGTAAWSFAPNIALPI 360

Query: 335 FDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHK 394
           F+ G   +N+  A    + +   +++ +  A +EV + L +     + +  L    E  +
Sbjct: 361 FEGGSNIANLDLAHVQKRIEIANYEKAIQTAFREVSDGLAARGTYDQQIAALARNEEAQQ 420

Query: 395 KSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +   LS + YR G  S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 421 RRYDLSDLRYRNGVDSYLTVLTAQTDLYTAQTSLISARLARWTNLVDLYRALGGGW 476


>gi|209515073|ref|ZP_03263942.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. H160]
 gi|209504699|gb|EEA04686.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. H160]
          Length = 504

 Score =  216 bits (550), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 122/465 (26%), Positives = 212/465 (45%), Gaps = 27/465 (5%)

Query: 5   RAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQ-FSIGNSKNLINIDTLKWWESFNDTSLNK 63
           R + S+ ++ L+GC +GP Y +P + +  T  F+ G +  + N     WWE F D  L++
Sbjct: 8   RLLASVMLLALSGCLLGPNYERPAVDVPATYRFAQGEAAGIANAT---WWEQFQDPVLDQ 64

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK---------- 113
           L+  ALQ N  +  A  R++  +   ++ R+ LFP   A          +          
Sbjct: 65  LIAAALQDNRDVKVAAARVDEFRGQFVTTRSGLFPQVSAGADASRQRVSQDEGVPVPKGV 124

Query: 114 ----TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
                     L   W++DLFG+ RR  E++ ANL ++        L ++S +  SYI+ R
Sbjct: 125 SPIFNQFDATLAVSWELDLFGKVRRETEAARANLLASEEGRRATILTLVSSVASSYINLR 184

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
               ++ IA + +    +++ +   +F  G  S++ L + ++E ++    IP LE     
Sbjct: 185 SLDRQLEIAKETVQSRAESVRVFEARFRYGEVSQMELAQSQSEYQAALVTIPQLEAQIAQ 244

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
               +S L+G      L   +       P        G+P+DL+  RPD+   E+ L   
Sbjct: 245 QEDALSVLIGRNPGAILRGRELAQMGTPPIPE-----GLPSDLLERRPDLLEAEQTLVAQ 299

Query: 289 VAKIGIAKSDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
            A IG A++  +PS+SL G     +    N F G    WSF   +  PIF  G I   + 
Sbjct: 300 NALIGAARALYFPSISLTGLFGSVSAQFSNLFTGPARVWSFAGSVTQPIFTAGNITGQVH 359

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
           +AE+  QE   ++++ +  A +EVE++L S+ +  + +      VE       L+   Y 
Sbjct: 360 QAEARQQEALYSYEKAIQVAFQEVEDSLISVQKTHEALDAQNLQVEALITYAHLARQRYE 419

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            G  S +++LD ER+    ++  +  +  +  SYV LY A G G+
Sbjct: 420 GGYTSYIEVLDAERSLFNAQLSYAQTQGAVLTSYVTLYKATGGGW 464


>gi|330818161|ref|YP_004361866.1| RND efflux system, outer membrane lipoprotein, NodT [Burkholderia
           gladioli BSR3]
 gi|327370554|gb|AEA61910.1| RND efflux system, outer membrane lipoprotein, NodT [Burkholderia
           gladioli BSR3]
          Length = 508

 Score =  216 bits (550), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 111/478 (23%), Positives = 202/478 (42%), Gaps = 31/478 (6%)

Query: 1   MNILRAIFSLFIVLL--AGCTVGPEYTKPHMPL-----------LPTQFSIGNSKNLINI 47
           M + + + +     L   GCT+ P Y +P  P+                   +S N    
Sbjct: 1   MTMRKLVLTAMAFALVATGCTMAPHYQRPAAPVSGSFPSDGVYATQPGADGAHSANGQAA 60

Query: 48  DTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFP--------- 98
             + W   F D  L  L++IAL+ N  +  +   I AA+      RA LFP         
Sbjct: 61  ADIGWRNFFADPRLQALIEIALKNNRDLRVSVLNIEAARAQYQITRAGLFPTLDGTGTGN 120

Query: 99  --SSYASISHRFIPNLKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLN 155
                A +S    P +       L + W++DLFG+ + + + +LA   S       A+++
Sbjct: 121 TQRLPAGVSTTGSPLITRTYNVGLSASWELDLFGRIQSLKDQALAQYLSTAQARKAAEIS 180

Query: 156 VISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSI 215
           +IS++   Y+  +   + + +  + L   + +  L+ L+F  G  S+L L + +  ++  
Sbjct: 181 LISQVADQYLTLQSTDDLLKVTEETLKTAQDSYNLTKLQFDNGTGSELDLRQAQTVVEQA 240

Query: 216 ESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNR 275
            ++     +     V+ +  L+G P  + L       +    +L   I  G+P+DL+  R
Sbjct: 241 LANQQAEARDRAQAVNALVLLIGEPLPDDLPAGLPLDS---QSLLTDIPAGLPSDLLTRR 297

Query: 276 PDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYL 332
           PDI   E+ L  + A IG A++  +P +SL  +           F      WSF P + L
Sbjct: 298 PDIMEAEQTLLAANANIGAARAAFFPKISLTAAFGTASPTLGGLFKAGTAAWSFAPNIAL 357

Query: 333 PIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVEL 392
           PIF+ G   +N+  A    + +   +++ +  A +EV + L +     + +  L+   E 
Sbjct: 358 PIFEGGSNIANLDLAHVQKRIEIANYEKAIQTAFREVSDGLAARGTYDQQIAALERNEEA 417

Query: 393 HKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            ++   LS + YR G  S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 418 QQRRYDLSDLRYRNGVDSYLTVLTAQTDLYTAQTSLISARLARWTNLVDLYRALGGGW 475


>gi|83593387|ref|YP_427139.1| RND efflux system, outer membrane lipoprotein, NodT [Rhodospirillum
           rubrum ATCC 11170]
 gi|83576301|gb|ABC22852.1| RND efflux system, outer membrane lipoprotein, NodT [Rhodospirillum
           rubrum ATCC 11170]
          Length = 499

 Score =  216 bits (549), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 101/470 (21%), Positives = 201/470 (42%), Gaps = 24/470 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINI-----DTLKWWES 55
           M          + LL GC+  P+Y +P  P +PT +  G + +          TL W E 
Sbjct: 13  MRSSLMSCVAVLALLGGCSFIPDYQRPAAP-VPTAWPDGPAYDQAQAGGETIATLGWREF 71

Query: 56  FNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTN 115
           F D +L +L+  AL+ N  +  A   + +A+      RADL P+             +T 
Sbjct: 72  FRDPALQRLIAQALEHNRDLRSAALTVESARATYRIERADLLPTVNGGTDLTHQRTPRTA 131

Query: 116 STGQL------------DSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIP 162
           +                 + ++ID FG+ R +E        +        ++ +I+++  
Sbjct: 132 TQTGKAQTTTNYSANIGTTSYEIDFFGRIRSLEEEALEQYFATEEARRSVQIALIAEVAN 191

Query: 163 SYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTL 222
           +YI     +  + +  + L+   ++  L+   F +G  ++L + + +  +++  ++    
Sbjct: 192 AYITLLADRTLLQLTEETLNTRIESFNLTQQSFDRGVGTRLDVTQAQTTVETARANRAIY 251

Query: 223 EKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQE 282
            +    +++ +  L+G      L       +  +      +  G+P+DL+  RPDI   E
Sbjct: 252 TRYVAQDINALRLLVGDQLDANLLAGTPPLDLGRFF--PNVPAGLPSDLLLRRPDILEAE 309

Query: 283 KKLADSVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGK 339
            KL  + A IG A++  +P +SL G++        + F   +  WS GP L +P+FD  +
Sbjct: 310 HKLVAANANIGAARAAFWPKISLTGNLGTASASLGDLFSSGSLAWSVGPSLSVPLFDFWR 369

Query: 340 IKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSL 399
            ++ +  A+   +     +++++  A +EV +AL +       +   Q  V   ++S +L
Sbjct: 370 NEATLESAKVQREIAVAAYEKSIQTAFREVADALAAKGTLGDQLRAQQDLVAATQESYAL 429

Query: 400 SMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           S   Y QG  + L  LD +R+    + DL   +     +Y+ LY  +G G
Sbjct: 430 SRNRYDQGIDNYLSTLDSQRSLYAAQQDLISVRANQLTNYITLYKVLGGG 479


>gi|300310691|ref|YP_003774783.1| outer membrane drug efflux lipoprotein [Herbaspirillum seropedicae
           SmR1]
 gi|300073476|gb|ADJ62875.1| outer membrane drug efflux lipoprotein [Herbaspirillum seropedicae
           SmR1]
          Length = 498

 Score =  216 bits (548), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 106/466 (22%), Positives = 204/466 (43%), Gaps = 22/466 (4%)

Query: 7   IFSLFIVLLAGCTVGPEYTKPHMPLLP-----TQFSIGNSKNLINIDTLKWWESFNDTSL 61
           +  +  +LL GCT+ P+Y +P  P+          +   + +   +  + W + F D SL
Sbjct: 16  LPVMLAMLLGGCTLMPDYHRPDAPVAAHFAGADSKNAAGASSAPVVADIGWRDVFTDPSL 75

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL- 120
            +++ +AL+ N  +  A   I  A+      RA LFPS  A+ S          S+    
Sbjct: 76  QQVIALALENNRDLRVAVLNIEKARAQYGVQRAALFPSIKAATSETASRTPGDLSSTGSA 135

Query: 121 -----------DSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
                       S +++DLFG+ R ++     +  S        ++++I+++  +++   
Sbjct: 136 LTSRSYTATLGFSAYELDLFGRVRSLKEQALQSFLSTAEARRSTQISLIAEVATAWLTLA 195

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
             ++R+ +A   L+    +  L+   F  G++S L+L + +  ++S   D+ +       
Sbjct: 196 SDQDRLRLAQDTLESQSSSYALTQRSFELGSSSALTLRQAQTSVESARVDVESYTAQVDQ 255

Query: 229 NVHNISTLLGYP-ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
           + + +  L+G    T  L      +     +    I  G+P+DL++ R DI   E+ L  
Sbjct: 256 DRNALVLLVGKDLPTALLPQGLPDTRLAAASPLATIPPGLPSDLLQRRADIVQAERDLRA 315

Query: 288 SVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNI 344
           + A IG A++  YPS++L  +           F G +  WSF P++ LPIFD G  ++N+
Sbjct: 316 ANANIGAARAAFYPSITLTVNAGTASARLAGLFKGGSGSWSFVPQISLPIFDGGANQANL 375

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
             A  S       +++ +  A +EV +AL   N   + +   +  V+   ++  LS   Y
Sbjct: 376 DIATVSRDISVAQYEKAIQTAFREVSDALAQRNTLGRQLQAQEALVQASDEAFRLSQARY 435

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             G  S L +LD +R     + +L   +     + V  Y  +G G+
Sbjct: 436 HSGVDSYLTVLDSQRTLYSAQKNLIGTQLSRWTNLVTFYKTLGGGW 481


>gi|212704780|ref|ZP_03312908.1| hypothetical protein DESPIG_02844 [Desulfovibrio piger ATCC 29098]
 gi|212671742|gb|EEB32225.1| hypothetical protein DESPIG_02844 [Desulfovibrio piger ATCC 29098]
          Length = 511

 Score =  216 bits (548), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 110/467 (23%), Positives = 216/467 (46%), Gaps = 21/467 (4%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLN 62
           +   +  +  + + GC++ P+Y +P   +     S+    + +N D   WW  FND  LN
Sbjct: 5   LKAGLTLVLCLAVTGCSLAPDYKRPEQDIPKEWRSVDLGPSPLNTD---WWTRFNDPVLN 61

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKT-------- 114
            LV+ AL+ N  + ++  +I++A   +    + L PS   + +     N           
Sbjct: 62  ALVEEALKNNQDLAESLAKIDSAAAKLGVGTSQLAPSVSGAGAATSQSNSTKIANYNDVA 121

Query: 115 -----NSTGQLDSDWKIDLFGQRRHIESSLAN-LDSAYAQVDIAKLNVISKLIPSYIDAR 168
                N  GQL + W++D +G+ R+  + L++ L +     +  +L+V S+   SY    
Sbjct: 122 DRSYVNYQGQLSASWELDFWGKYRNNYTMLSDVLLNTVVSHEALRLSVASQTAQSYFALL 181

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
               +++ A + L   +    +   ++ QG  ++L   +  AE+++  S + +   +   
Sbjct: 182 ALDMQLATAKRTLRTREDAFGIYTSRYRQGDITELDWQRARAEVETARSQVHSSTVAVDS 241

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQP-NLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
              +++ LLG    + +  +  +  +         +  G+P++L+  RPD+R  E  +  
Sbjct: 242 AEASLAVLLGRSPRDIMSAVMPRGGDISKLPAPPVLPAGLPSELLERRPDVRAAEYMIMA 301

Query: 288 SVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNI 344
             A IG+A+++ +PS+SL G +        N F G    WS+G    +P+ D G+   N+
Sbjct: 302 YNANIGVARAEFFPSISLTGMLGTLSASVVNLFSGPAGAWSYGVTGSMPLLDFGRTWYNV 361

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
           + AE+  +     +++TV NA K+V  +LTS  E   IV   Q  V+  +++  ++ + Y
Sbjct: 362 KDAEAQKEAAIAVYRKTVQNAFKDVRTSLTSQREADAIVAASQAQVDSLRRAAEIARLQY 421

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             G    L +LD ER     E+ L+ A R    + V + +A+G G+ 
Sbjct: 422 DNGYTDYLTVLDAERQLFSAELSLANALRDRLNAVVSVCMALGGGWQ 468


>gi|91775944|ref|YP_545700.1| RND efflux system, outer membrane lipoprotein, NodT
           [Methylobacillus flagellatus KT]
 gi|91709931|gb|ABE49859.1| RND efflux system, outer membrane lipoprotein, NodT
           [Methylobacillus flagellatus KT]
          Length = 481

 Score =  216 bits (548), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 114/471 (24%), Positives = 217/471 (46%), Gaps = 26/471 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL---INIDTLKWWESFN 57
           M   + I++   + L GC VGP+Y +P    LP  FS   +       ++D   WWESF 
Sbjct: 2   MLRHKLIYAAVALALTGCMVGPDYHRPAT-KLPASFSAAEATPASEQASLDLDAWWESFE 60

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI-------- 109
           D  LN L+K A   N+ I +A  RI  A   +    A LFP    + +            
Sbjct: 61  DPVLNDLMKKAFADNVDIAKAVARIEEADAALREAGAALFPQIDMTGNAIRQKVTETGAF 120

Query: 110 ------PNLKTNSTGQLDSDWKIDLFGQRRHIESSLANLDSAYAQ-VDIAKLNVISKLIP 162
                 P ++     QL + +++D +G+ R    +      A     D   L++   +  
Sbjct: 121 PIFPGVPVIRETYNLQLGTSFELDFWGRLRRAREAARAQALATYFAKDTVSLSLSGLVAS 180

Query: 163 SYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTL 222
           +Y+  R  + +I+++ + L   ++++ L+  +   G  S L + + E    ++ + +  L
Sbjct: 181 NYLLLRSLEAQIAVSRETLKSREESLALTKRRLDGGVASILDVHQAEVSHSNLVAQLADL 240

Query: 223 EKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQE 282
            +   +  H ++ L G    +    +    +  Q         G+P+ L+  RPDIR  E
Sbjct: 241 VRQREVIQHQLAVLTG----DLELNVPVSGDIHQLPSPPVPPAGLPSTLLEARPDIREAE 296

Query: 283 KKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGK 339
           + L    A+IG+AK+ L+PS++L  +      N        +  W+ G  L LPIF+ G+
Sbjct: 297 QALISENAQIGVAKAALFPSITLTANYGGESANLNRLLESPSRVWTTGLGLNLPIFNAGR 356

Query: 340 IKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSL 399
           + + + +A +  ++   T+Q ++  A KEV++AL ++ + ++    L+ + E  KK++ +
Sbjct: 357 LSARVDQATARQKQALSTYQSSIQTAFKEVKDALVAVRQSREREEALKVSQESAKKALEV 416

Query: 400 SMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S   Y+ G  + LD+LD +R      +    +++    + VDL+ A+G G+
Sbjct: 417 SENRYKSGYSAYLDVLDSQRVYNDAVLAFIQSRQARLTATVDLFKALGGGW 467


>gi|325293923|ref|YP_004279787.1| nodulation protein T precursor [Agrobacterium sp. H13-3]
 gi|325061776|gb|ADY65467.1| nodulation protein T precursor [Agrobacterium sp. H13-3]
          Length = 480

 Score =  216 bits (548), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 188/462 (40%), Positives = 280/462 (60%), Gaps = 15/462 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M  +RA   L ++LL+GC VGP++  P +  LP +F+     +  +I ++ WW +FND  
Sbjct: 1   MLSIRATIPLTMLLLSGCVVGPDHKTPEIQ-LPGKFAEAGKTSNGDISSVAWWTAFNDNR 59

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTN----- 115
           LN  V   L QNLT++QA ERIN A+  ++   A   PS   S SH       +      
Sbjct: 60  LNGYVSTGLAQNLTVMQAIERINQAQAQVIVDGAGGLPSLTGSGSHTTSETKGSYRDVPV 119

Query: 116 ---STGQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
              S G L   W +DLFG+ R    S  A+LD+AY+ VD+ +L +IS +  +YID R+++
Sbjct: 120 TNVSNGSLSVSWFLDLFGRYRRATESADASLDAAYSTVDVQRLTLISSVAAAYIDVRYYQ 179

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
           ER++IA Q L   ++ ++L+ L+   GA S+L +V+ E  + S  S IP LE SFR + H
Sbjct: 180 ERLAIARQNLSSRRETLDLTKLQLEAGAASRLDVVQSEGLVNSTLSQIPGLETSFRKSAH 239

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
            I+TLLG PA+  +  +QK +   QP        GIPADLIRNRPDIR  E+ LA +VA 
Sbjct: 240 RIATLLGMPASSLIAELQKGAR--QPVARAVPRTGIPADLIRNRPDIRVAERNLAAAVAT 297

Query: 292 IGIAKSDLYPSLSLNGSIALTHDNSFPGYN---THWSFGPKLYLPIFDKGKIKSNIRRAE 348
           IG+ ++ LYPS+ L G+I  +++    G       WSFGP L LPI D G++++N+  A 
Sbjct: 298 IGVTEAQLYPSIELGGAITPSYNFLSGGGRGTANSWSFGPSLTLPILDGGRLRANVDIAN 357

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           S A+EQY+ W+ TVLNA++EVENAL +IN D++ V  L+  V  +++++ LS  +YR G 
Sbjct: 358 SQAREQYLVWKATVLNAVEEVENALAAINRDQRTVDALRKTVSSYQEALQLSTASYRDGA 417

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            SLLD+LD +R+ +  + +L+ A +  A+ YV L +A+G GY
Sbjct: 418 SSLLDVLDAQRSVSDAQANLATAIQTTAQDYVSLNVALGGGY 459


>gi|238028496|ref|YP_002912727.1| RND efflux system, outer membrane lipoprotein, NodT [Burkholderia
           glumae BGR1]
 gi|237877690|gb|ACR30023.1| RND efflux system, outer membrane lipoprotein, NodT [Burkholderia
           glumae BGR1]
          Length = 505

 Score =  215 bits (547), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 107/476 (22%), Positives = 201/476 (42%), Gaps = 29/476 (6%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIG-----------NSKNLINIDT 49
           M           ++  GCT+ P Y +P  P+  T  S G            S N      
Sbjct: 1   MRKFALTAMAVALVATGCTLAPHYERPAAPVAGTFPSDGVYATQPGASATRSANGQAASD 60

Query: 50  LKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFP----------- 98
           + W   F D  L +L+++AL+ N  +  +   + AA+      RA+L P           
Sbjct: 61  IGWRNFFTDPRLQRLIELALKNNRDLRVSVLNVEAARAQYQITRAELLPALNGTGTGSIQ 120

Query: 99  SSYASISHRFIPNLKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVI 157
              A +S    P +       L + W++DLFG+ + + + +LA   S       A+++++
Sbjct: 121 RLPAGVSTTGAPLISRTYNVGLSASWELDLFGRIQSLKDQALAKYLSTAQARKAAEISLV 180

Query: 158 SKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIES 217
           S++   Y+      + + +    L   + +  L+ L+F  G  S+L L + +  ++   +
Sbjct: 181 SQVADQYLTVLSTDDLLKVTEDTLKTAQASYNLTKLQFDNGTGSELDLRQAQTVVEQALA 240

Query: 218 DIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPD 277
           +     ++    ++ +  L+G P  + L   Q   +    +L   I  G+P++L+  RPD
Sbjct: 241 NQQAQARARAQALNALVVLVGEPLPDDLPAGQPLDS---QDLLTDIPAGLPSELLTRRPD 297

Query: 278 IRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPI 334
           I   E+ L  + A IG A++  +P +SL G+                  WSF P L LPI
Sbjct: 298 IMEAEQTLRAANANIGAARAAFFPRISLTGAFGSASPTLGGLLKAGTAAWSFAPDLTLPI 357

Query: 335 FDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHK 394
           F  G   +N+  A    + +   +++ +  A +EV + L +     + +  LQ   +  +
Sbjct: 358 FAGGSNLANLDLARVQKRIEVANYEKAIQTAFQEVSDGLAARGTYDQQIAALQRNEQAQR 417

Query: 395 KSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +   LS + Y+ G  + L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 418 RRYDLSELRYKNGVDNYLTVLTAQTDLYSAQQSLISARLSRWTNLVDLYRALGGGW 473


>gi|187930810|ref|YP_001901297.1| NodT family RND efflux system outer membrane lipoprotein [Ralstonia
           pickettii 12J]
 gi|309780194|ref|ZP_07674945.1| outer membrane multidrug efflux protein OprB [Ralstonia sp.
           5_7_47FAA]
 gi|187727700|gb|ACD28865.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Ralstonia pickettii 12J]
 gi|308920897|gb|EFP66543.1| outer membrane multidrug efflux protein OprB [Ralstonia sp.
           5_7_47FAA]
          Length = 514

 Score =  215 bits (547), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 117/462 (25%), Positives = 211/462 (45%), Gaps = 29/462 (6%)

Query: 14  LLAGCTVGPEYTKPHMPLLPTQFSIGNS-----------KNLINIDTLKWWESFNDTSLN 62
           +L+GC++ P Y +P  P+  T                  +N      L W E F D  L 
Sbjct: 22  VLSGCSLAPTYERPDAPITGTYPQAPAGYAVPADSAKPGENAPRATELGWREFFPDARLQ 81

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST----- 117
           KL+ +AL+ N  +  A   + AA+       ADL P   AS ++       + ST     
Sbjct: 82  KLIGLALENNRDLRVAMLNVEAARAQYRLQIADLLPPVNASATYTRSHTPPSISTTGGDI 141

Query: 118 -------GQLDSDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                  G   S+++++LF       S+ A+  +       A++++IS++  +Y++ R +
Sbjct: 142 HTKQYQLGVGISNYQVNLFSVGDVTSSARASYLATDEGRRAAQISLISQVAKAYLNERAY 201

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
            E++ +A Q L   +   +L+  +F  GA+S L L + E  ++S+   +  L + +    
Sbjct: 202 AEQLDLAQQTLKGREDYYKLAKQRFDVGASSALDLRQTETLVESVRVSVAQLTRQYAQAT 261

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  L+G P    L      S+     +   I  G+P++L+  RPDIR  E+KL  + A
Sbjct: 262 NALVLLVGAPLPADLPAPTMVSSE---KIVADIPPGLPSELLEQRPDIRQAEQKLIAANA 318

Query: 291 KIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG+A++  +PS+ L  ++        + F      WSF P L LPIF+ G    N+   
Sbjct: 319 NIGVARAAFFPSIGLTSNVGTASGALHDLFKSGTQFWSFVPNLTLPIFNWGTNIFNLDLT 378

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           +++ +     +++T+  A +EV +AL +    ++ V   +   +     ++LS   YR G
Sbjct: 379 KTNQKIAVANYEKTIQTAFREVSDALVARGTLEEQVAAQKRFRDATADRLTLSDQRYRNG 438

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
             S LD+LD +R     +  L   +     + +DLY A+G G
Sbjct: 439 VSSFLDVLDAQRDLFSADQTLVQTRLARLTNAIDLYTALGGG 480


>gi|223934898|ref|ZP_03626817.1| RND efflux system, outer membrane lipoprotein, NodT family
           [bacterium Ellin514]
 gi|223896351|gb|EEF62793.1| RND efflux system, outer membrane lipoprotein, NodT family
           [bacterium Ellin514]
          Length = 489

 Score =  215 bits (547), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 112/466 (24%), Positives = 217/466 (46%), Gaps = 29/466 (6%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGN-----SKNLINIDTLKWWESFNDTSLNK 63
            L  + +AGC VGP+Y +P   ++P  +  G      ++   +I    WWE F D+SLN 
Sbjct: 19  GLVTLFVAGCAVGPDYKRPEATVIPPAYKEGTNGWKLAEPQAHIPRGAWWEIFQDSSLNA 78

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTN-------- 115
           L   A + N  +  A E    A+  +   R+  +P   A  S     +            
Sbjct: 79  LETEAAKANQELQVALESFEQARALLSVARSGYYPHIEAIPSVTRERDSANRPINGVSIG 138

Query: 116 -------STGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
                   +  LD  +++D++G+ RR +ES+ A + ++   +   KL++ +++   Y + 
Sbjct: 139 RADTFNTFSFPLDLSYELDVWGRVRRSVESAKATMQASADDLATVKLSIQAEVANDYFNL 198

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
           R     IS+    + ++ K++EL+  +   G  S L + + E  +K+ E+ +P +     
Sbjct: 199 RALDSEISLLRSNVVVFGKSLELTRNRRAGGVASDLDVSQAETILKTTEAQLPAIALQRA 258

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
              H ++ L G PA+ F                  +  G+P+DL+  RPDI   E+ +A 
Sbjct: 259 KAEHALAVLTGKPASSFSVPEMPFLAQ-----PPNVPSGLPSDLLERRPDIATAERLMAA 313

Query: 288 SVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNI 344
           + A IG+AK+  YP++ +NG       ++   F   +  W+ GP + LPIF+ G+ ++N+
Sbjct: 314 ANAGIGVAKAAFYPTIKINGLAGFESVSAGTLFDWPSRFWAVGPSIKLPIFEGGENRANL 373

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
             A+++ +E    ++++VL A  EVE+ L + +           A++  +K++ ++   Y
Sbjct: 374 THAQAAYRENVARYRQSVLVAFSEVEDNLAAQHLLWSQQEAENAALKAAEKTLEIANNRY 433

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           R G  + L++   + A    E +    + +   S V L  ++G G+
Sbjct: 434 RAGLVTYLEVATAQNAALDRERENVRLRGERLLSTVSLIKSLGGGW 479


>gi|120603937|ref|YP_968337.1| RND efflux system outer membrane lipoprotein [Desulfovibrio
           vulgaris DP4]
 gi|120564166|gb|ABM29910.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfovibrio vulgaris DP4]
          Length = 504

 Score =  215 bits (547), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 113/468 (24%), Positives = 217/468 (46%), Gaps = 20/468 (4%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M        L   LL+GC +GP+Y +P M L         S +   +   KWW  F D +
Sbjct: 1   MIRRMTAMLLGAALLSGCAIGPDYQRPDMDLPSAWR--AESADAGMVAGEKWWTLFGDAT 58

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST--- 117
           L+ L + AL  N  +  A   ++A++  +    + L PS     S       +       
Sbjct: 59  LDALEEEALAANGDLATAMANVDASRAQLTVATSYLLPSITGQGSSVRQRGSERGQNPPV 118

Query: 118 ----------GQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYID 166
                         + +++DL+G+ R    ++ A L    A     +L V+S++  SY  
Sbjct: 119 EGREVTDLHKASALASFELDLWGKYRRAHEAARAGLLGTEAAYATVRLAVVSQVAQSYFG 178

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
            R    ++ IA Q L   ++++++   +F  G TS+L   + +AE  S  + +  LE++ 
Sbjct: 179 LRAADRQLDIARQTLTSREESLKIREARFNSGLTSELDYRQAQAETASARASVRQLEQAV 238

Query: 227 RMNVHNISTLLGYPATEFLHYMQKQSNNFQPN-LYIPINIGIPADLIRNRPDIRYQEKKL 285
                 +S+LLG    + +    ++  + +   +   I  G+PA L+  RPD+   E  L
Sbjct: 239 AAAETALSSLLGRSPRDIVERSPERGLDIETFAVPPQIPAGLPAGLLARRPDVARAEADL 298

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHDNSF---PGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG+AK+DL P++SL G +     +        +  WS+G    +P+ D G+  +
Sbjct: 299 HYATASIGVAKADLLPAISLTGLMGYESIDLTRLVSSSSGTWSYGASATMPLLDFGRTLA 358

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
           NI  A++  +     +++ V +A +E ++AL +  + +++V      V   ++S++L+ +
Sbjct: 359 NIDMADAKQRAALAAYEQAVRDAFRETQDALVANRKTRQVVDAQATQVAALERSLTLARL 418

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            Y  G  S L++LD ER+  + +++L  A+R    + V +  ++G G+
Sbjct: 419 RYENGYSSYLEVLDAERSLFQAQLNLVEARRNQLDAVVQVCKSLGGGW 466


>gi|332880523|ref|ZP_08448197.1| RND transporter, HAE1 family [Capnocytophaga sp. oral taxon 329 str.
            F0087]
 gi|332681511|gb|EGJ54434.1| RND transporter, HAE1 family [Capnocytophaga sp. oral taxon 329 str.
            F0087]
          Length = 1489

 Score =  214 bits (545), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 105/455 (23%), Positives = 207/455 (45%), Gaps = 16/455 (3%)

Query: 6    AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
             I       L+ C +G  YT+P MP LP +     +++  +I  L WWE +NDT+L +L+
Sbjct: 1040 LILLAAGTGLSSCQIGKSYTRPDMP-LPVRLDT-LTQDTASIGDLSWWELYNDTTLQQLI 1097

Query: 66   KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS--------T 117
              AL  N  +  A+ R+N          A++FP + A ++                   +
Sbjct: 1098 HRALTYNKDLKIASARMNELAALKRIDFANMFPQATARLNGNRETTNYGGDKFDADPELS 1157

Query: 118  GQLDSDWKIDLFGQRRHIESS-LANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISI 176
                  W++DL+G  R       A   ++       K+ +++++  SY +       ++I
Sbjct: 1158 LTASISWELDLWGNLRWARDHSTAEFLASVENCRAVKMGLVAQVAQSYFELMALDNELTI 1217

Query: 177  AHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL 236
              + L+  ++ + L+ ++F  G TS++   + + E+    + +P LE+   +    I+ L
Sbjct: 1218 VRRTLEARREGVRLAEIRFKGGLTSEIVFQQAKVELAKTATMVPDLERRISLKESEIALL 1277

Query: 237  LGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
             G         +  +       L     +G+P+ L+  RPDIR  E++L  + A++G+A 
Sbjct: 1278 TGDFPYAVNRNVLPEEIQLPDALP----LGLPSTLLERRPDIRKAERELIAAHAEVGLAY 1333

Query: 297  SDLYPSLSLNGSIALTHDNSFPGYNTHW-SFGPKLYLPIFDKGKIKSNIRRAESSAQEQY 355
            ++++P L+L  ++    +       + +      L  P+F  GK ++ ++   ++ +   
Sbjct: 1334 TNMFPRLALTATLGAESETLRDLLKSPYSYLAGNLLSPLFAMGKNRAALKAKRAAYEGAV 1393

Query: 356  ITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDIL 415
              +++TVL A KE  NA+ + N+ K I    +   E  + ++ L+ + Y  G    LD+L
Sbjct: 1394 AEYEKTVLTAFKETHNAIINFNKIKDIYESRRQLAEASRTAVELAQLQYINGVIGYLDLL 1453

Query: 416  DIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            D +R     +V LS A        ++LY A+G G+
Sbjct: 1454 DAQRNYFDAQVSLSNAVCDKQLMIINLYKALGGGW 1488


>gi|91778867|ref|YP_554075.1| RND efflux system outer membrane lipoprotein [Burkholderia
           xenovorans LB400]
 gi|91691527|gb|ABE34725.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia xenovorans LB400]
          Length = 486

 Score =  214 bits (545), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 116/461 (25%), Positives = 208/461 (45%), Gaps = 25/461 (5%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKI 67
                + L+GC +GP+Y +P +   P  F   +S     +DT  WW  F D  LN+L+  
Sbjct: 13  AVGLCLCLSGCLMGPDYVRPSVET-PATFRFSDSTQAQIVDTA-WWAQFGDPVLNELIST 70

Query: 68  ALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP--------------NLK 113
           AL QN  +  A  R++  +   ++ R+ LFP   A  +                      
Sbjct: 71  ALAQNRDLKIAAARVDEFRGQFVTTRSQLFPQISAGFNAGRQRVSPLAQSSLPAGIGTDY 130

Query: 114 TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
           T+    L   W+ID+FG+ RR  E++ ANL ++        L +++ +  SYI+ R   +
Sbjct: 131 TSFNATLPISWEIDVFGRVRRQTEAARANLLASEEGQRATLLTLVASVATSYINLRSLDQ 190

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
           ++ IA         ++++  L+F  G  S++ L + ++E ++  +DIP +E         
Sbjct: 191 QLEIARATAASRASSVKVFELRFKGGQISQVELAQSQSEYEASLADIPAIEAQIGQQEDA 250

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +S LLG      L                 +  G+P++L+  RPD+   E+ L  + A I
Sbjct: 251 LSVLLGRNPGPILR-----GRTLDELQAPGVPAGLPSELLARRPDVLQAEQNLVAANALI 305

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL G +  +       F G    W+F   L  PIF  G I   + +A++
Sbjct: 306 GAARALYFPQISLTGLLGSSSTQLSRLFSGPANTWAFAGALTQPIFSAGNIAGQVEQAKA 365

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             Q+    +Q+ V +A +EV +AL  + + ++ +   +  V+       L+   Y  G  
Sbjct: 366 RQQQALYAYQKAVQSAFQEVSDALLGVGKSRERLAAQERQVDALSTYAKLARQRYEGGYT 425

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S +++LD ER+    ++  +  +     S V LY A+G G+
Sbjct: 426 SYMEVLDAERSLFSAQLAYTQTRGNEYTSLVTLYKALGGGW 466


>gi|70728710|ref|YP_258459.1| outer membrane efflux protein [Pseudomonas fluorescens Pf-5]
 gi|68343009|gb|AAY90615.1| outer membrane efflux protein [Pseudomonas fluorescens Pf-5]
          Length = 486

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 103/471 (21%), Positives = 207/471 (43%), Gaps = 24/471 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGN----SKNLINIDTLKWWESF 56
           M+      ++  + L+GC++ P+Y +P  P+                 +      W + F
Sbjct: 1   MSKSLLSLAITAIALSGCSLIPDYQRPEAPVAAQFPQGPAYSPKEAANVAAAEQGWRQFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           +D +L +L++ +L+ N  +  A   I+A        RADLFP+  A+ S          S
Sbjct: 61  HDPALQQLIQTSLENNRDLRVAALNIDAYAAQYQIQRADLFPAVSANASGSRQRTPARMS 120

Query: 117 TGQL------------DSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPS 163
                            S +++DLFG+ R + E +L    S+       ++++++ +  +
Sbjct: 121 QTGEAGITSQYSATVGVSAYELDLFGRVRSLSEQALQTYFSSEEARRSTQISLVASVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  +  KE + +    L  Y+++  L+      G  S L L +    +++    +    
Sbjct: 181 YMTWQADKELLKLTQDTLAAYEESYRLTSRSNEVGVASALDLSQSRTSVENARVQLARYT 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    + ++++ LLG      L   Q  S +   +L      G+P++L++ RPDI   E 
Sbjct: 241 RQVAQDENSLTLLLGAAIPANLPKAQPLSADLLSDLP----AGLPSELLQRRPDILEAEY 296

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKI 340
           KL  + A IG A++  +PS+SL  +      +    F G +  W F P++ LPIF+ G +
Sbjct: 297 KLKAANANIGAARAAFFPSISLTANAGTLSPDLSGLFKGGSGTWLFQPQINLPIFNAGSL 356

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++++  ++         +++++  A +EV + L +     + +   +  V  ++    L+
Sbjct: 357 RASLDYSKIQKDITVAQYEKSIQTAFQEVSDGLAARQTYNQQLQAQRDFVNANQDYYRLA 416

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
              YR G  S L  LD +R+    +  L   +     S V+LY A+G G++
Sbjct: 417 ERRYRIGVDSNLTFLDAQRSLFSAQQALITDRLSQLTSEVNLYKALGGGWS 467


>gi|238023621|ref|YP_002907853.1| outer membrane protein [Burkholderia glumae BGR1]
 gi|237878286|gb|ACR30618.1| Outer membrane protein [Burkholderia glumae BGR1]
          Length = 528

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 108/471 (22%), Positives = 201/471 (42%), Gaps = 29/471 (6%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIG-----------NSKNLINIDTLKWWE 54
           AI +  +    GCT+ P YT+P  P+     + G            S N      + W E
Sbjct: 21  AIAAAVLCTTTGCTLAPHYTRPDAPVAQAYPADGVYAAQPGAAGTRSANGQPATAIGWRE 80

Query: 55  SFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK- 113
            F D  L +L++IAL+ N  +  A   I A++      RA L P+  A+ +         
Sbjct: 81  FFVDPRLQRLIEIALKNNRDLRVAVLNIEASRAQYQITRAGLLPTLEATGTGNRQRVPSS 140

Query: 114 ----------TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIP 162
                     T     L + W++DLFG+ + + + +LA   +        +++++S++  
Sbjct: 141 LAAIPGRNLTTTYNVGLSASWELDLFGRVQSLKDQALAQYLATSYARQATEISLVSQVAD 200

Query: 163 SYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTL 222
            Y+      E + +    L   + + +L+ L+F  G  S+L L + +  ++   ++    
Sbjct: 201 QYLTLLSTDELLKVTENTLKNAQASYDLTKLQFDNGTGSELDLRQAQTVVEQALANQQAQ 260

Query: 223 EKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQE 282
            ++    ++ +  L+G P  + L            NL   +  G+P+DL+  RPD+   E
Sbjct: 261 ARARAQALNALVLLIGEPLPDDLPAGMPLDA---QNLLTDVPAGLPSDLLTRRPDVMQAE 317

Query: 283 KKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGK 339
           + L  + A IG A++  +P +SL G+           F      WSF P+L LPIF  G+
Sbjct: 318 QMLKAANANIGAARAAFFPRISLTGAFGTASPTLDGLFKAGTAAWSFAPQLTLPIFAGGQ 377

Query: 340 IKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSL 399
             +N+  A    + +   +++ + +A +EV + L +     + +  L+      ++   L
Sbjct: 378 NIANLDLANVQKRIEISNYEKAIQSAFREVSDGLAARGTYDQEIAALERNEHAQQRRFEL 437

Query: 400 SMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S + YR G  S L +L  +         L  A+     + V LY A+G G+
Sbjct: 438 SNLRYRNGVDSYLSVLTAQTDLYSARQSLINARLARWTNLVALYRALGGGW 488


>gi|128491|sp|P24145|NODT_RHILT RecName: Full=Nodulation protein T; Flags: Precursor
 gi|46245|emb|CAA35773.1| nodT protein (AA 1-467) [Rhizobium leguminosarum]
          Length = 467

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 185/464 (39%), Positives = 282/464 (60%), Gaps = 15/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M   R     F +LL+GC VGP Y  P MP LP +FS G   +  ++  + WW +FND  
Sbjct: 1   MRFTRYTTPFFSLLLSGCVVGPNYAPPEMP-LPAKFSEGGVTSNGDVTVVAWWTAFNDPM 59

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHR---------FIPN 111
           L   V+  + QNL + QA ERI+ A  N+    A   P    S SH              
Sbjct: 60  LTSYVEQGISQNLDVQQAIERIDLAAANVTIAEASALPDLTLSGSHTVSGQKGKLRKQTY 119

Query: 112 LKTNSTGQLDSDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
               STG+L   W +D    +R+ ES+ A LD+AYA VD+AKL  I+ +I SY+DAR+++
Sbjct: 120 TSNTSTGELSLSWLLDFGVYKRNTESAEAALDAAYASVDMAKLAFINDIISSYVDARYYQ 179

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
            R++++   L   ++  EL+  KF  GA +++ +V+ E  ++S  ++IP+L+ +FR++ H
Sbjct: 180 RRLALSQANLKSRRETFELTKSKFAAGAVARMDVVRAEGLVQSTLAEIPSLDANFRISAH 239

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
            I+TLLG PA   +  + K SN  QP     +N+GIPAD+IRNRPDIR  E+ LADS A+
Sbjct: 240 RIATLLGKPAGSMVEEIAKGSN--QPAFRADVNVGIPADIIRNRPDIRKAERDLADSTAQ 297

Query: 292 IGIAKSDLYPSLSLNGSIALT---HDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
           IG+A++ L+PS++L+GSI+ +   ++    G  T WSFGPKL LPI D G +++++  A+
Sbjct: 298 IGVAEAKLFPSITLSGSISPSGGINERGVYGNLTPWSFGPKLKLPILDGGGLRADVDSAK 357

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           S A   Y+ W+  VLNAI++VENAL ++  + + V  L+  VE+ ++++ LS  +Y+ G 
Sbjct: 358 SKATVSYLKWKSRVLNAIEQVENALVAMQREGRTVRALKREVEIAQETLRLSTSSYKDGA 417

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            SLLD+L+ +R+ +  +  L+ A ++ AK Y  L IAIGSGYNP
Sbjct: 418 SSLLDLLEAQRSLSVTQASLARAVQEWAKLYAVLNIAIGSGYNP 461


>gi|224417824|ref|ZP_03655830.1| putative outer membrane channel protein [Helicobacter canadensis
           MIT 98-5491]
 gi|253827164|ref|ZP_04870049.1| putative TolC-like outer membrane protein channel [Helicobacter
           canadensis MIT 98-5491]
 gi|313141365|ref|ZP_07803558.1| cation efflux system protein cusC [Helicobacter canadensis MIT
           98-5491]
 gi|253510570|gb|EES89229.1| putative TolC-like outer membrane protein channel [Helicobacter
           canadensis MIT 98-5491]
 gi|313130396|gb|EFR48013.1| cation efflux system protein cusC [Helicobacter canadensis MIT
           98-5491]
          Length = 466

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 106/463 (22%), Positives = 217/463 (46%), Gaps = 17/463 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           MN +  ++    +L+ GC++ P+Y +P    LP  F +  SK  I+     WW+ F D  
Sbjct: 1   MNKIILVWIGLGLLIGGCSLSPKYEQPKAN-LPKDFGVEYSKETISQT---WWKDFGDEY 56

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP--------NL 112
           LN +V+ AL+ N  +  A ER++ A+ +    R+D +PS  A                + 
Sbjct: 57  LNGIVEEALKNNYDLAVAMERVSQARSSWSYARSDRYPSLSAQGEATRNKKNPRQGEFDN 116

Query: 113 KTNSTGQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
             N +      +++DL+G+ R  + S  A L ++ A  D  +L++I+ ++ SY       
Sbjct: 117 YNNFSLSGILSFELDLWGRARDADRSAYATLLASKANRDTIRLSLIASVVESYFGILTLN 176

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
            ++ I+   L   +++ +    +F  G  S++ + +  +E+ S+ + + +L         
Sbjct: 177 NQVQISQNTLVSREESYQYRKKEFEAGKISEIDMQQARSEMASVRAQLQSLLMERNAAQT 236

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
            +  LLG       +      +   P       +G+P+ L+ NRPDI   E+ L  +   
Sbjct: 237 ALMILLGRDPQGIFNIALPVESQMLPKAPKVP-VGLPSTLLENRPDIEAAEQNLKAANFS 295

Query: 292 IGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
           IG+A++  +P++SL G I       +  F   ++ W++G      + D G+  +N+   +
Sbjct: 296 IGVARAAYFPTISLTGLIGYASPELNELFNNSSSTWNYGGNFVGNVIDFGRTSANVELTK 355

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           S  +E  + + +T+  A  EV ++L + +   + ++ L   VE  ++++ L+ + YR+G 
Sbjct: 356 SQYREMLLNYGQTLRQAFGEVRDSLYNYSMSFERLSSLNEQVEALRRTLVLAELRYREGY 415

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            + L++L  +      E+    A  +   S +++Y A G G++
Sbjct: 416 TNYLEVLTTQSNLFAAELTQQSANLENLSSVINIYKAFGGGWD 458


>gi|237745455|ref|ZP_04575935.1| outer membrane transporter [Oxalobacter formigenes HOxBLS]
 gi|229376806|gb|EEO26897.1| outer membrane transporter [Oxalobacter formigenes HOxBLS]
          Length = 484

 Score =  214 bits (543), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 109/460 (23%), Positives = 207/460 (45%), Gaps = 19/460 (4%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
            +  L   +L GC++ P Y +P  P+        +S     +  + W E F++  L  L+
Sbjct: 6   TLALLAAGILGGCSMAPTYLRPDAPIESQYPDNTSSSATTPVPEIGWNEFFHEPRLRALI 65

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK------------ 113
             A++ N  +  A  RI  A+       AD  P+            +             
Sbjct: 66  AAAIENNRDLRIAALRIEEARALYNVQWADRLPTFQMEGDASRSRTIGGLAPTESMLTQG 125

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
               G   S +++D FG+ + + +++LA   +       A ++++S++  +Y+  R   +
Sbjct: 126 NYRVGLGISAFELDFFGRVKSLTDAALAQYLATEEAQRSAYISLVSEVAKTYLTERAQSK 185

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
           +I +A Q  + YK + EL   ++  GA+S L L + E  ++S    + TL++      + 
Sbjct: 186 QIELARQSYESYKHSYELMQKRYEVGASSALELRQYETLMQSALVSLSTLQRERAQTENA 245

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G    + +  +    +  + ++   I  G+P+DL+ NRPDIR  E+ L  + A I
Sbjct: 246 LVVLIG---GKQIKDLPPPHDLSEDDIMQDIPAGLPSDLLTNRPDIRQYEQLLKSANANI 302

Query: 293 GIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P ++L      T  +    F      W+F P+L LPIFD G+  +N+  AE+
Sbjct: 303 GAARAAFFPRITLTAFAGTTSSSLSGLFEAGTGAWTFLPQLTLPIFDAGRNIANLDVAEA 362

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
                   +++T+  A +EV +ALT+ +   + V      +    + + L+   Y  G  
Sbjct: 363 RKNIAVAEYEKTIQVAFREVADALTARDWLNEQVKAQAAVLNSETERLKLAEARYNNGIA 422

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           S L++ D +R     E  L  A+     + V+LY ++G G
Sbjct: 423 SSLEVFDAQRQQFAAEQSLVDARLLRLVNAVELYRSLGGG 462


>gi|46578479|ref|YP_009287.1| RND efflux system outer membrane lipoprotein [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|46447890|gb|AAS94546.1| RND efflux system, outer membrane protein, NodT family
           [Desulfovibrio vulgaris str. Hildenborough]
 gi|311232407|gb|ADP85261.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfovibrio vulgaris RCH1]
          Length = 504

 Score =  214 bits (543), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 113/468 (24%), Positives = 217/468 (46%), Gaps = 20/468 (4%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M        L   LL+GC +GP+Y +P M L         S +   +   KWW  F D +
Sbjct: 1   MIRRMTAMLLGAALLSGCAIGPDYQRPGMDLPSAWR--AESADAGMVAGEKWWTLFGDAT 58

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST--- 117
           L+ L + AL  N  +  A   ++A++  +    + L PS     S       +       
Sbjct: 59  LDALEEEALAANGDLATAMANVDASRAQLTVATSYLLPSITGQGSSVRQRGSERGQNPPV 118

Query: 118 ----------GQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYID 166
                         + +++DL+G+ R    ++ A L    A     +L V+S++  SY  
Sbjct: 119 EGREVTDLHKASALASFELDLWGKYRRAHEAARAGLLGTEAAYATVRLAVVSQVAQSYFG 178

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
            R    ++ IA Q L   ++++++   +F  G TS+L   + +AE  S  + +  LE++ 
Sbjct: 179 LRAADRQLDIARQTLTSREESLKIREARFNSGLTSELDYRQAQAETASARASVRQLEQAV 238

Query: 227 RMNVHNISTLLGYPATEFLHYMQKQSNNFQPN-LYIPINIGIPADLIRNRPDIRYQEKKL 285
                 +S+LLG    + +    ++  + +   +   I  G+PA L+  RPD+   E  L
Sbjct: 239 AAAETALSSLLGRSPRDIVERSPERGLDIETFAVPPQIPAGLPAGLLARRPDVARAEADL 298

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHDNSF---PGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG+AK+DL P++SL G +     +        +  WS+G    +P+ D G+  +
Sbjct: 299 HYATASIGVAKADLLPAISLTGLMGYESIDLTRLVSSSSGTWSYGASATMPLLDFGRTLA 358

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
           NI  A++  +     +++ V +A +E ++AL +  + +++V      V   ++S++L+ +
Sbjct: 359 NIDMADAKQRAALAAYEQAVRDAFRETQDALVANRKTRQVVDAQATQVAALERSLTLARL 418

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            Y  G  S L++LD ER+  + +++L  A+R    + V +  ++G G+
Sbjct: 419 RYENGYSSYLEVLDAERSLFQAQLNLVEARRNQLDAVVQVCKSLGGGW 466


>gi|103486935|ref|YP_616496.1| RND efflux system, outer membrane lipoprotein, NodT [Sphingopyxis
           alaskensis RB2256]
 gi|98977012|gb|ABF53163.1| RND efflux system, outer membrane lipoprotein, NodT [Sphingopyxis
           alaskensis RB2256]
          Length = 471

 Score =  213 bits (542), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 111/464 (23%), Positives = 199/464 (42%), Gaps = 20/464 (4%)

Query: 3   ILRAIFSLFIVLLAGCT-VGPEYTKPHMPLLPTQFS--IGNSKNLINIDTLKWWESFNDT 59
           + +AI  L    LAGC  + P + +P +       +   G +        + W + F D 
Sbjct: 1   MRKAILLLIATTLAGCVDMAPPHERPPLATAADYPAEFAGGATPGQRATDIAWRDFFADP 60

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK------ 113
            L  L+  A+  N  +  A  +I  A+       AD  P+  AS                
Sbjct: 61  RLEMLIAQAIAHNRDLAVAVAQIEEARGLYRIQAADRLPTVGASADAARTRGPSVTGVGT 120

Query: 114 ----TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
                 S G   + +++D +G+ R++ E++ +   +  A     +L ++  +  +Y  +R
Sbjct: 121 DTTSRYSVGVGVTSFELDFWGRVRNLSEAARSQYLATEAAERTFRLALVRDVASTYFASR 180

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
             +E+I +A   +   K+ + ++  +   G TS L   + E  +   E+ + +L+     
Sbjct: 181 GAEEQIQLAEATVASRKEGLRIARRRLDAGVTSALDYRQSETLLTQAETQLASLKLGKAQ 240

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
             + ++ L G P +E L                    G+P+DL+  RPDI   E++L  +
Sbjct: 241 ADNFLAVLTGGPVSEPLLAPLPLVAQAGAPALT---AGLPSDLLVARPDIVATEERLRAA 297

Query: 289 VAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
            A +G A++  +PS+SL GS        D+ F      W+FGP + LPIFD G+ + N+ 
Sbjct: 298 RANVGAARAAFFPSISLTGSFGFASGALDDLFGDDGMTWTFGPSISLPIFDFGRRQGNLT 357

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
            AE+        ++ TV  A +EV +AL       + V   +      ++   L+   YR
Sbjct: 358 VAEAREDIAVAAYERTVQGAFREVADALAGRRYLAEQVEAQERGTLATRQIADLARKRYR 417

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           +G  + L++LD ER     E  L   +R    + V LY+A+G G
Sbjct: 418 EGVSTYLEVLDAERNLFAAEQTLIELRRAQVDNLVTLYVALGGG 461


>gi|207727491|ref|YP_002255885.1| drug efflux lipoprotein [Ralstonia solanacearum MolK2]
 gi|206590728|emb|CAQ56340.1| drug efflux lipoprotein [Ralstonia solanacearum MolK2]
          Length = 514

 Score =  213 bits (542), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 115/462 (24%), Positives = 208/462 (45%), Gaps = 29/462 (6%)

Query: 14  LLAGCTVGPEYTKPHMPLLPTQFSIGNS-----------KNLINIDTLKWWESFNDTSLN 62
           +L+GC++ P Y +P  P+                     +N      L W E F D  L 
Sbjct: 22  VLSGCSLAPRYERPDAPVAGDYPQAPAGYAVPADTAKPGENAPRATDLGWREFFPDPRLQ 81

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLD- 121
           KL+ +AL+ N  +  A   I AA+       ADL P+  AS ++      ++ S    D 
Sbjct: 82  KLIGLALENNRDLRVAVLNIEAARAQYRLQIADLLPAVNASATYTRSLTPQSISQTGQDI 141

Query: 122 -----------SDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                      S ++++LF       S+ A+  +        ++++IS++  +Y++ R +
Sbjct: 142 NTKQYQLGVGISSYQVNLFSVGDVTSSARASYLATEEGQRATQISLISQVAKAYLNERAY 201

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
            E++ +A Q L   +   +L+  +F  GA+S L L + E  ++S    +  L + +    
Sbjct: 202 AEQLELAQQTLKGREDYYKLAKQRFDVGASSALDLRQNETLVESARVSVAQLTRQYAQAT 261

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  L+G P    L      S+     +   I  G+P+DL+  RPDIR  E+KL  + A
Sbjct: 262 NALVLLVGAPLPADLPAPTTVSSE---KIVADIPPGLPSDLLIQRPDIRQAEQKLIAANA 318

Query: 291 KIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG+A++  +PS+ L  ++        + F      WSF P   LPIF+ G    N+   
Sbjct: 319 NIGVARAAFFPSIGLTSNVGTASTALHDLFKSGTGLWSFVPNATLPIFNWGTNLFNLDLT 378

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           +++ +     +++T+  A +EV +AL +    ++ V   +   +   + ++LS   YR G
Sbjct: 379 KANQKIALANYEKTIQTAFQEVSDALVARGTLEEQVAAQKRFRDATAERLTLSDQRYRNG 438

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
             S LD+LD +R     +  L   +     + +DLY A+G G
Sbjct: 439 VSSFLDVLDAQRDLFSADQTLVQTRLARLTNAIDLYTALGGG 480


>gi|197295434|ref|YP_002153975.1| efflux system outer membrane protein [Burkholderia cenocepacia
           J2315]
 gi|195944913|emb|CAR57525.1| efflux system outer membrane protein [Burkholderia cenocepacia
           J2315]
          Length = 475

 Score =  213 bits (542), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 107/468 (22%), Positives = 195/468 (41%), Gaps = 22/468 (4%)

Query: 3   ILRAIFSLFIV-LLAGCTVGPEYTKPHMPL------LPTQFSIGNSKNLINID---TLKW 52
           + R + +L    +LAGCT+ P Y +P  P+      +P++     +++         L W
Sbjct: 1   MKRTLIALVCTGMLAGCTLDPTYQRPAAPVDNTWSTVPSRSQPKAAQSTAAAPLGADLGW 60

Query: 53  WESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL 112
            + F D  L KL+++AL  N  +  A   +   +      RA++ P+  AS S       
Sbjct: 61  RDFFKDPQLQKLIELALVNNRDMRVAALNVAQYEAQYRIARANVGPAINASGSITRERVA 120

Query: 113 KTNSTGQLD------SDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYI 165
            +             + W+ID FG+ R ++        +  A     ++++I+ +   Y+
Sbjct: 121 GSTGAYGSSSASVGLTSWEIDFFGRLRSLKRQALEQYLATDAARTSTQISLIATVATDYL 180

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
             R  +  + IA   +D  +   +L+      G+ S   + + E  + S  S + +  ++
Sbjct: 181 QLRSDETSLQIAQNTVDADQHTYDLTVNMMKMGSASLQDVRQAENSLASARSSLASYTRA 240

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
              + +N+   +G P  +     Q  S     + +  I  G+P+DL+  RPDI   E  L
Sbjct: 241 VAQDRNNLVAEIGAPLPD--DLPQGPSLMESEHTFADIGEGVPSDLLARRPDIVEAEHTL 298

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG A++  +P + L  S   T     N F      W+F P L +P+FD G  ++
Sbjct: 299 KAANANIGAARAAFFPKIELTASAGTTSGSLSNLFKAGTGAWTFAPTLSVPLFDFGYNRA 358

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            +  A+         +++ +  A KEV NAL         V   +  VE  ++   L+  
Sbjct: 359 TLDVAKVEKDIDVANYEKAIQTAFKEVSNALAGRTTYVTQVAADRDYVESARQYYDLAQA 418

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            YR G  S L +LD +R     +  L         + + LY  +G G+
Sbjct: 419 RYRSGTDSFLTLLDAQRTLYAAQQQLVTDMLAKQSNLITLYKVLGGGW 466


>gi|320353350|ref|YP_004194689.1| NodT family RND efflux system, outer membrane lipoprotein
           [Desulfobulbus propionicus DSM 2032]
 gi|320121852|gb|ADW17398.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfobulbus propionicus DSM 2032]
          Length = 474

 Score =  213 bits (542), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 118/463 (25%), Positives = 217/463 (46%), Gaps = 25/463 (5%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
            I  L I+L+ GCTVGP+Y +P +   P+ + + +S+   ++    WW+ FND  L  L+
Sbjct: 5   WIALLLILLVGGCTVGPDYNRPPID-APSDWRLIDSE-AKDLANTPWWQQFNDPVLTTLI 62

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP--------------N 111
           + AL++N  +  A  RI          RADLFP    S  +                   
Sbjct: 63  ETALRENKELQIAAARIEEYAGRYGMARADLFPQVSGSAEYNRQRVTELGDNRYASGYKT 122

Query: 112 LKTNSTGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                   L + W+ID++G+ R   E++ A L ++        L+++S +   YI+ R  
Sbjct: 123 TTDTFAATLGASWEIDIWGRIRRGTEAARAELLASEEGRRAVVLSLVSSVASGYINLRDL 182

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ I+        ++  L   +F  G  S L L +  ++ +   + IP+LEK+     
Sbjct: 183 DRQLEISRNTATSRGQSYALFKERFAGGIISDLELSQNRSQYEEALASIPSLEKAIAQQE 242

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +S LLG            +  N        +  G+P+DL+  RPDIR  E+ L  + A
Sbjct: 243 NGLSVLLGRNPG-----PIPRGRNIDQLTLPAVVAGLPSDLLERRPDIRQAEQTLIAANA 297

Query: 291 KIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
           +IG+AK+  +PS+SL G+         + F G +  W++   + +P+F  GKI  +++ A
Sbjct: 298 RIGVAKAAYFPSISLTGAFGSASGDLSDLFKGPSKVWNYSAPVTMPLFTAGKIAGSVKEA 357

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E+  Q+  + +Q+ + N  +EV +AL       + +   ++ V+  ++   ++ + Y  G
Sbjct: 358 EAIQQQALLGYQQAIQNGFREVNDALADQQHTTRQLAAQKNQVDSLRQYADIARLRYDNG 417

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
               L +LD ER+    E+  +  +  L  + ++LY A+G G+
Sbjct: 418 YTDYLAVLDAERSLFNAELAYTQTQGALHLALINLYKAMGGGW 460


>gi|300705587|ref|YP_003747190.1| outer membrane protein (drug efflux lipoprotein) [Ralstonia
           solanacearum CFBP2957]
 gi|299073251|emb|CBJ44610.1| putative outer membrane protein (Probable drug efflux lipoprotein)
           [Ralstonia solanacearum CFBP2957]
          Length = 506

 Score =  213 bits (542), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 115/462 (24%), Positives = 208/462 (45%), Gaps = 29/462 (6%)

Query: 14  LLAGCTVGPEYTKPHMPLLPTQFSIGNS-----------KNLINIDTLKWWESFNDTSLN 62
           +L+GC++ P Y +P  P+                     +N      L W E F D  L 
Sbjct: 14  VLSGCSLAPRYERPDAPVAGDYPQAPAGYAVPADTAKPGENAPRATDLGWREFFPDPRLQ 73

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLD- 121
           KL+ +AL+ N  +  A   I AA+       ADL P+  AS ++      ++ S    D 
Sbjct: 74  KLIGLALENNRDLRVAVLNIEAARAQYRLQIADLLPAVNASATYTRSLTPQSISQTGQDI 133

Query: 122 -----------SDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                      S ++++LF       S+ A+  +        ++++IS++  +Y++ R +
Sbjct: 134 NTKQYQLGVGISSYQVNLFSVGDVRSSARASYLATEEGQRATQISLISQVAKAYLNERAY 193

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
            E++ +A Q L   +   +L+  +F  GA+S L L + E  ++S    +  L + +    
Sbjct: 194 AEQLELAQQTLKGREDYYKLAQQRFDVGASSALDLRQNETLVESARVSVAQLTRQYAQAT 253

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  L+G P    L      S+     +   I  G+P+DL+  RPDIR  E+KL  + A
Sbjct: 254 NALVLLVGAPLPADLPTPTTVSSE---KIVADIPPGLPSDLLIQRPDIRQAEQKLIAANA 310

Query: 291 KIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG+A++  +PS+ L  ++        + F      WSF P   LPIF+ G    N+   
Sbjct: 311 NIGVARAAFFPSIGLTSNVGTASTALHDLFKSGTGLWSFVPNATLPIFNWGTNIFNLDLT 370

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           +++ +     +++T+  A +EV +AL +    ++ V   +   +   + ++LS   YR G
Sbjct: 371 KANQKIALANYEKTIQTAFQEVSDALVARGTLEEQVAAQKRFRDATAERLTLSDQRYRNG 430

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
             S LD+LD +R     +  L   +     + +DLY A+G G
Sbjct: 431 VSSFLDVLDAQRDLFSADQTLVQTRLARLTNAIDLYTALGGG 472


>gi|154250988|ref|YP_001411812.1| RND efflux system outer membrane lipoprotein [Parvibaculum
           lavamentivorans DS-1]
 gi|154154938|gb|ABS62155.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Parvibaculum lavamentivorans DS-1]
          Length = 475

 Score =  213 bits (541), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 111/470 (23%), Positives = 208/470 (44%), Gaps = 25/470 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLP-----TQFSIGNSKNLINIDTLKWWES 55
           MN      +L  + L  CT+ P+Y +P  P+         +    +K+ + +  L W + 
Sbjct: 1   MNRFSPALALSFLFLGACTLAPDYVRPAAPIPSGWPTGAAYEDAAAKDGVEVADLGWQDF 60

Query: 56  FNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTN 115
           F    +  L+  AL  N  + +A   +  A+      RADL PS     +          
Sbjct: 61  FLSDEMRNLIAQALANNRDMREAVLNVEQARALYRVQRADLLPSISGDGTMTRERVPGDI 120

Query: 116 STGQL------------DSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIP 162
           S                 + +++DLFG+ R +         +       A++ +I+++  
Sbjct: 121 SGTGQAQTGTSYRVQANIASYELDLFGRVRSLNEQALQEYFATDEARRAAQIALIAEVAN 180

Query: 163 SYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTL 222
           +Y+  R  +  +++  + L   +K++EL  + F +G +SKL LV+ +  +++   +    
Sbjct: 181 AYLTLRADQRLLALTEETLQTQEKSLELVQMTFDRGISSKLDLVQSQTAVETARVNRYAF 240

Query: 223 EKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQE 282
            +   ++ + ++ L+G P  +      +  ++F  +L      G+P+DL+RNRPDIR  E
Sbjct: 241 IRQVALDRNALTLLVGAPIDDDALDRAENIDSFVADLP----AGLPSDLLRNRPDIRQAE 296

Query: 283 KKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGK 339
             L  + A IG A++  +PS++L  +      +    F   +  WSF P++ LPIF  G+
Sbjct: 297 HVLQGANANIGAARAAFFPSITLTAAGGTASGSLSGLFEPGSGAWSFMPQISLPIFQGGR 356

Query: 340 IKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSL 399
             +N+  AE         ++ T+  A +EV +AL         V   Q  V+   +S +L
Sbjct: 357 NLANLEVAEIQKDINIARYEGTIQTAFREVADALAGRGTYDAQVAAQQALVDATDESYAL 416

Query: 400 SMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           +   YR G  S L +LD +R+    E +L   +     + V+LY  +G G
Sbjct: 417 AERRYRSGIDSFLTLLDAQRSLYAAEQELIRTRLARVSNTVNLYKVLGGG 466


>gi|83748930|ref|ZP_00945940.1| Probable outer membrane drug efflux lipoprotein [Ralstonia
           solanacearum UW551]
 gi|207739171|ref|YP_002257564.1| outer membrane drug efflux lipoprotein [Ralstonia solanacearum
           IPO1609]
 gi|83724429|gb|EAP71597.1| Probable outer membrane drug efflux lipoprotein [Ralstonia
           solanacearum UW551]
 gi|206592544|emb|CAQ59450.1| outer membrane drug efflux lipoprotein [Ralstonia solanacearum
           IPO1609]
          Length = 501

 Score =  213 bits (541), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 109/484 (22%), Positives = 203/484 (41%), Gaps = 34/484 (7%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSI-----------------GNSKN 43
           M  L         +LAGCT+ P Y +P  P+                        G+++ 
Sbjct: 1   MTRLSPTVLALAAMLAGCTLMPTYQRPATPVPAAFADASDKSDASDTSGERGNTGGDTRP 60

Query: 44  LINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYAS 103
              +  + W + F D SL +++ +AL  N  +  A   I  A+       A LFP+  AS
Sbjct: 61  AGPVADIGWHDVFTDPSLQRVIGMALANNRDLRVAVLNIEKARAQYRVQDAALFPTVKAS 120

Query: 104 ISHRFIPNLKTNSTGQL------------DSDWKIDLFGQRRHIESSL-ANLDSAYAQVD 150
            S        T S                 S +++DLFG+ R + +       S      
Sbjct: 121 GSENASRTPATLSATGQPLVAHSYSATLGFSAYELDLFGRVRSLNAQALEQYLSTVEARR 180

Query: 151 IAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEA 210
            +++++I+++  +Y+     ++ + +A   L        L+   +  G  S+L+L + + 
Sbjct: 181 SSQISLIAEVATAYLTLAADQDLLKLAQDTLSSQSDTYRLNQRSYELGTASRLTLRQSQT 240

Query: 211 EIKSIESDIPTLEKSFRMNVHNISTLLGYP-ATEFLHYMQKQSNNFQPNLYIPINIGIPA 269
            + S   D+         + + +  L+G     E L      S+    ++   I  G+ +
Sbjct: 241 SVDSARVDVERYTAQVAQDRNALVLLVGADLPAELLPRSLPDSSAATGSVLATIPPGLTS 300

Query: 270 DLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSF 326
           DL++ RPDI   E  L  + A IG A++  +PS+SL  S   +  +    F G +  W+F
Sbjct: 301 DLLQRRPDILQAEHDLKAANANIGAARAAFFPSISLTASAGTSSASLAGLFKGGSGAWNF 360

Query: 327 GPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKL 386
           GP++ LPIFD G  ++N+  A +S       +++ +  A +EV +AL       + +   
Sbjct: 361 GPQIALPIFDGGANRANLDVANTSRDIAVAQYEKAIQTAFREVSDALAQRGTLGRQIEAQ 420

Query: 387 QHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAI 446
           Q  V+    S  L+   +++G  S L++LD +R+    + +L   +     + V  Y  +
Sbjct: 421 QSLVDATADSYQLATARFKRGVDSYLNVLDSQRSLYTAQQNLINTRLSRFTNLVTFYKTL 480

Query: 447 GSGY 450
           G G+
Sbjct: 481 GGGW 484


>gi|300692984|ref|YP_003753979.1| outer membrane protein (probable drug efflux lipoprotein)
           [Ralstonia solanacearum PSI07]
 gi|299080044|emb|CBJ52718.1| putative outer membrane protein (Probable drug efflux lipoprotein)
           [Ralstonia solanacearum PSI07]
          Length = 510

 Score =  213 bits (541), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 114/462 (24%), Positives = 207/462 (44%), Gaps = 29/462 (6%)

Query: 14  LLAGCTVGPEYTKPHMPLLPTQFSIGNS-----------KNLINIDTLKWWESFNDTSLN 62
           +L+GC++ P Y +P  P+                     +N      L W E F D  L 
Sbjct: 18  VLSGCSLAPRYERPTAPVAGDYPQAQAGYSVPADTAKPGENAPRATDLGWREFFPDPRLQ 77

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLD- 121
           KL+ +AL+ N  +  A   I AA+       ADL P   A+ ++      ++ S    D 
Sbjct: 78  KLIGLALENNRDLRVAILNIEAARAQYRLQIADLLPPVNATATYTRSLTPQSISQTGQDI 137

Query: 122 -----------SDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                      S ++++LF       S+ A+  +        ++++IS++  +Y++ R +
Sbjct: 138 NTKQYQLGVGISSYQVNLFSVGDVTSSARASYLATEEGQRATQISLISQVAKAYLNERAY 197

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
            E++ +A Q L   +   +L+  +F  GA S L L + E  ++S    +  L + +    
Sbjct: 198 AEQLELAQQTLKGREDYYKLAKQRFDVGAASALDLRQNETLVESARVSVAQLTRQYAQAT 257

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  L+G P    L      S+     +   I  G+P++L+  RPDIR  E+KL  + A
Sbjct: 258 NALVLLVGAPLPADLPAPTTVSSE---RIVADIPPGLPSELLEQRPDIRQAEQKLIAANA 314

Query: 291 KIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG+A++  +PS+ L  ++        + F      WSF P L LPIF+ G    N+   
Sbjct: 315 NIGVARAAFFPSIGLTSNVGTASTALHDLFKSGTGLWSFVPNLTLPIFNWGTNVFNLDLT 374

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           +++ +     +++T+  A +EV +AL +    ++ V   +   +   + ++LS   YR G
Sbjct: 375 KANQKIALANYEKTIQTAFQEVSDALVARGTLEEQVAAQKRFRDATAERLTLSDQRYRNG 434

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
             S LD+LD +R     +  L   +     + +DLY A+G G
Sbjct: 435 VSSFLDVLDAQRDLFSADQTLVQTRLARLTNAIDLYTALGGG 476


>gi|86749360|ref|YP_485856.1| RND efflux system, outer membrane lipoprotein, NodT
           [Rhodopseudomonas palustris HaA2]
 gi|86572388|gb|ABD06945.1| RND efflux system, outer membrane lipoprotein, NodT
           [Rhodopseudomonas palustris HaA2]
          Length = 518

 Score =  213 bits (541), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 137/463 (29%), Positives = 227/463 (49%), Gaps = 19/463 (4%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL-KWWESFNDTSLNKL 64
           A+  L    L+GC VGP+Y  P + L     +    K    +  L +WW   ND  LN+L
Sbjct: 33  AVLLLCATALSGCAVGPDYVVPGIELPTAWRNARPPKTPPAVPQLSEWWRRLNDQLLNRL 92

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP------------NL 112
           ++ A+  NL +  A  RI  A+         LFP+   S S                   
Sbjct: 93  IEEAVASNLDVASAKARIREARATRRQAIGALFPTLDGSGSATRNQVSASSTSGGSAITT 152

Query: 113 KTNSTGQLDSDWKID-LFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
                   DS W++D     RR++E++   +D A   +    L +I  +   Y  AR ++
Sbjct: 153 YNQFQAGFDSSWELDIFGANRRNVEATTYGVDVAEDDLRATLLTLIGDVTSYYAQARGYQ 212

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
            RI++A +     ++   L+  KF  G++S + + K  A+  S E++IPT E S+  +VH
Sbjct: 213 ARIALARRTAASQRETAALTQRKFDAGSSSAVDVAKAAAQAASTEANIPTFEISYAESVH 272

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
            +  LLG   +     +        P L +P   GIPAD++  RPD+R  E++LA   A 
Sbjct: 273 RLGVLLGREPSALSPLLAGVKPIPAPRLPLPK--GIPADVLVMRPDVRKAERQLAQYTAL 330

Query: 292 IGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
           IG A++ LYPS+SL GS++ T     +        WS GP L +PIF+ G++++ +  +E
Sbjct: 331 IGKAEAALYPSVSLTGSVSTTALKIGDLGKNSTIGWSIGPSLSVPIFNGGQLRAAVEISE 390

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           +   + Y+ W+  VL+A+++VENA+ S+++ +K +  L  +   + ++  LS   Y  G 
Sbjct: 391 AQRDQYYVAWRAAVLSALEDVENAIVSLSQQRKRIGNLSESARRYAEAARLSRSLYETGS 450

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            S LD+LD ER+    E  L   +  +A SY+ L   +G G++
Sbjct: 451 SSFLDVLDAERSLYTAEDSLLDTRVSVATSYIALAKGLGGGWD 493


>gi|148264704|ref|YP_001231410.1| RND efflux system outer membrane lipoprotein [Geobacter
           uraniireducens Rf4]
 gi|146398204|gb|ABQ26837.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Geobacter uraniireducens Rf4]
          Length = 496

 Score =  213 bits (541), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 115/467 (24%), Positives = 214/467 (45%), Gaps = 27/467 (5%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPT-QFSIGNSKNLINIDTLKWWESFNDTSL 61
           + R         L GC +GP+Y +P + +  + Q+   ++++ +N     WW+ F D  L
Sbjct: 1   MRRLFMLALAASLTGCMMGPDYRRPVVDIPQSFQYEDKDARDTVNTP---WWQQFQDPVL 57

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLD 121
           + L+  AL  N ++  A   I  A   +   RA LFP    + S       +TN+T   D
Sbjct: 58  DGLIAEALANNKSVKIAAANIEQAAGVLTQTRAPLFPQVSYAGSASRQRVSETNATPFPD 117

Query: 122 --------------SDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYID 166
                           W++DL+G+ R + ES+ A++ ++        L++++ +   Y+ 
Sbjct: 118 GVSNPFNSLQLFGGVTWELDLWGRVRRLSESARASMFASLEARRGVILSLVASVAGDYLQ 177

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
            R   E++ IA + L  Y ++++L  L+F  G  S+L++ +   + ++  S IP LE   
Sbjct: 178 LRGLDEQLVIAKRNLSAYAESVKLFELQFQYGQISQLNVEQARTQYETAASTIPQLESQI 237

Query: 227 RMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLA 286
               + +S LLG            +       ++  +  G+P+ L+  RPDI   E+ L 
Sbjct: 238 VQLENALSILLGRNPG-----PIARGKTIYELVFPAVPAGLPSQLLERRPDIAQAEQNLI 292

Query: 287 DSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSN 343
            + A IG AK+  +P++SL GS     ++    F G +  WSF      PIF  G I   
Sbjct: 293 AANALIGAAKALYFPTISLTGSYGYESEDLSKLFRGPSRAWSFAGSFTGPIFTAGAISGQ 352

Query: 344 IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
           + ++E+      I+++  + +A  +VENAL    +    +   +  V+  ++   L+ + 
Sbjct: 353 VHQSEAGQDAALISYEAAIQSAFADVENALIIREKLAGQIQAQERLVKASREYERLAKLQ 412

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           Y  G    L +L  ++     E+ L+  +  +  SY +LY A+G G+
Sbjct: 413 YDGGYAPYLTVLSAQQQLFPAELTLAQLRASVFTSYANLYKAMGGGW 459


>gi|223938890|ref|ZP_03630777.1| RND efflux system, outer membrane lipoprotein, NodT family
           [bacterium Ellin514]
 gi|223892443|gb|EEF58917.1| RND efflux system, outer membrane lipoprotein, NodT family
           [bacterium Ellin514]
          Length = 502

 Score =  213 bits (540), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 106/474 (22%), Positives = 208/474 (43%), Gaps = 32/474 (6%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGN------SKNLINIDTLKWWESFNDT 59
                  ++L GC VGP+Y +P    +P  ++         ++   ++    WWE F D 
Sbjct: 17  FALMGATLVLGGCMVGPDYKRPEATRIPATYAGATNHEWKVAEPRAHLPKGNWWEMFGDP 76

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI---------- 109
            LN+L   A   N  +  A  R+  A+      R+ LFP+   S  +             
Sbjct: 77  ELNRLEAEAASANQQLKAAFSRLEEARAITDITRSGLFPNVALSGEYTRQRTSPNQPSVL 136

Query: 110 -------PNLKTNSTGQLDSDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVI-SKLI 161
                  P+   +    L+ ++++DL+G+ R    S    +SA A        +I +++ 
Sbjct: 137 SGNAIGKPSTFNDFLVPLNLNYEVDLWGRVRRSVESARAQESATADDLGTIQLIIQAEVA 196

Query: 162 PSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPT 221
             Y+  R      +I    + +++K+++L+  +   G  S L + + E   ++  + +P 
Sbjct: 197 ADYVSLRSLDTEYAIVRSTIGVFRKSLDLTLDRRAGGIVSDLDVAQAETVYRTARAQLPA 256

Query: 222 LEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQ 281
           +        H ++ L+G PA+ F    +                G+P++L+  RPDI   
Sbjct: 257 IALQRAQFQHALAVLIGKPASSFAIPERALRATPPVIPP-----GLPSELLERRPDIAAT 311

Query: 282 EKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDN---SFPGYNTHWSFGPKLYLPIFDKG 338
           E+++A + A IG+AK+  +P++ LNG   L   N    F   +  WS GP L LPIF+ G
Sbjct: 312 ERRMAAANASIGVAKAAFFPTVRLNGMAGLESVNAGTVFNWSSRFWSVGPSLTLPIFEGG 371

Query: 339 KIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMS 398
            +++N+R  +++  E    +++ VL A ++VE+ L++         +   A++   + + 
Sbjct: 372 ALRANLRFTKATYDETVADYRQIVLTAFRDVEDNLSAQTLLASEYEEQAGALQSANRQLE 431

Query: 399 LSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           ++   Y  G  + L++   +     +E  +   + Q   + V L  A+G G+ P
Sbjct: 432 IANDRYHGGLVTYLEVATAQNLVLGLERTVVQLRGQQLVTAVALVQALGGGWQP 485


>gi|313201427|ref|YP_004040085.1| NodT family RND efflux system outer membrane lipoprotein
           [Methylovorus sp. MP688]
 gi|312440743|gb|ADQ84849.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Methylovorus sp. MP688]
          Length = 471

 Score =  213 bits (540), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 110/467 (23%), Positives = 215/467 (46%), Gaps = 25/467 (5%)

Query: 3   ILRAIFSLFIVLLAGCTV-GPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
            L  I  L  +LL GC + GP+Y +P MP +P +F+           +  WW+ +ND  L
Sbjct: 6   KLTYIAVLAAILLPGCAMMGPDYQRPEMP-VPAKFAEQADATNQAEISRTWWQLYNDPVL 64

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK-------- 113
           N LV  AL  N  I  A  R+  A   +  V A LFP    + S       +        
Sbjct: 65  NDLVAKALANNTDIKLAVARVEEADAYLREVGAALFPQIDLNSSATRSRITQLGATPLPS 124

Query: 114 ------TNSTGQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYID 166
                  N   +L + +++D +G+ R  + S+ A   + +   D   L++   +  +Y+ 
Sbjct: 125 GVDPIRENYNIRLGTSFELDFWGKLRRAKESARAQAMATHYARDTVDLSLQGLVASNYLL 184

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
            R  + +I+++   L   ++++ L+  +   G +S L + + +    ++ + +  L +  
Sbjct: 185 LRSLESQIALSQDSLHSRQESLALTQRRLEGGVSSALDVHQAQVSTSNLTAQLADLVRQR 244

Query: 227 RMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLA 286
            +  H ++ L G      L      ++  Q        +G+P+ L+ +RPD+R  E+ + 
Sbjct: 245 AIVEHQLAVLTG-----DLALTIPAADFNQLPTPPVPPVGLPSSLLESRPDVRQAEQNMI 299

Query: 287 DSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSN 343
            + A IG+AK+ L+P++SL  +         +        W+ G  L LPIFD G++ S 
Sbjct: 300 AANANIGVAKAALFPTISLTANYGGESAELGDILKSAARIWTGGLSLNLPIFDAGRLNSR 359

Query: 344 IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
           + +A +  ++   +++  +  A KEV +AL ++ +  +    L+ + E  KK++ ++   
Sbjct: 360 VDQATAQQKQTLASYESAIQTAFKEVNDALVNLRQQSEREAALEASKESSKKALDIAENR 419

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           Y+ G    LD+LD +R      +    +++    + VDL+ A+G G+
Sbjct: 420 YKAGYSGYLDVLDSQRVYNDAALAYVQSRQARLTASVDLFKALGGGW 466


>gi|328954054|ref|YP_004371388.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfobacca acetoxidans DSM 11109]
 gi|328454378|gb|AEB10207.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfobacca acetoxidans DSM 11109]
          Length = 477

 Score =  212 bits (539), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 113/472 (23%), Positives = 229/472 (48%), Gaps = 27/472 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGN----SKNLINIDTLKWWESF 56
           M I   +  L  +L+ GCT+GP+Y +P  P+ PT    G         ++   LKW+E F
Sbjct: 1   MRI--CLIMLLFMLVCGCTLGPDYQRPGYPVPPTFRGAGPDLSKQPAEVSFGDLKWFEVF 58

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
            D  L +L+ IALQ+N  +  A +R+ AA+E +   R+ LFP+   +     +   +   
Sbjct: 59  KDQKLQELIHIALQENYDVQIAAQRVMAAREQVTIQRSYLFPTLNTNGQLESLRTSERGF 118

Query: 117 TG------------QLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPS 163
           +               D  W++D FG+ R   E++ A   ++          +++ L  +
Sbjct: 119 SVLAPQQERMAGLIFGDLSWELDFFGRIRRATEAARAEFYASEENRKFVIQTLVTDLARA 178

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           YI+ R   +++ I+++ + + +++++L   +F  G  S+  ++  E  +    + +P L+
Sbjct: 179 YIELRALDQQLDISNRTVKVREESLKLVKARFDYGWDSQTPVLMTENLVYGARAVVPDLQ 238

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           ++     + I+TLLG         + +     +  L + I  G+ + L+  RPD+R+ E+
Sbjct: 239 RAIEQQENRITTLLGRNPG----PVSRGKPLLKQKLSVTIPPGMTSALLERRPDVRFAEE 294

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSF-GPKLYLPIFDKGK 339
            L  + A+IG AK+ L+P++ + G          + F  + + W    P +  PIF+ G+
Sbjct: 295 SLVAANARIGEAKALLFPNIRITGVAGWESAALKSLFSAHASFWDVISPGITQPIFNAGR 354

Query: 340 IKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSL 399
           +++N+R  E+  QE  + +++++  A +EV +AL  +   +++  + +  V+   K   L
Sbjct: 355 LRANVRATEALQQEALLNYKKSIQQAFREVSDALVGVRRLREVRLEAEKQVQALTKQTDL 414

Query: 400 SMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +   Y  G    L++LD +R   + E+ L+  +     + + LY A+G G+ 
Sbjct: 415 ANQRYFGGVTPYLEVLDSDRQLFEAELRLTQVQANELLAVIALYRALGGGWQ 466


>gi|289209080|ref|YP_003461146.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Thioalkalivibrio sp. K90mix]
 gi|288944711|gb|ADC72410.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Thioalkalivibrio sp. K90mix]
          Length = 482

 Score =  212 bits (539), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 111/462 (24%), Positives = 210/462 (45%), Gaps = 17/462 (3%)

Query: 7   IFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVK 66
           +      LL GC VGP+Y +P   L                   +WW  + D  L+ LV 
Sbjct: 6   LTVAAAFLLGGCAVGPDYERPDFDLPEDWPEHVLLSAEEQEAWQQWWTRYQDPQLDALVA 65

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL------------KT 114
            AL  NL +    +RI  ++  +    A+  P+  A                        
Sbjct: 66  RALDDNLDVRLQVQRIQESRARLGLAEANRLPTLDAQAEAARERQPEGLSPIPGGGGTDN 125

Query: 115 NSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
             +      +++DL+G+  R  E++ A L  +    +  +LNV++ ++ +Y++ R  +E+
Sbjct: 126 LFSITGILGYELDLWGRLARQEEAAEAFLQQSRFSHEAVRLNVVADVVATYVNLRSAQEQ 185

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
           ++IA + ++  ++ +EL  +++  G T  L L +  AE+++  + IP+L +  +     +
Sbjct: 186 LAIAEKTVESRERTLELEQIRYEGGQTDALVLRQSVAELETTRARIPSLRQQVQTLEGAL 245

Query: 234 STLLGYPATEFLHYMQKQSNNFQP-NLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           + L+G    E L  +           L   +   +P++L+R RPDIR  E +L  S A+I
Sbjct: 246 AVLVGMSPRELLDELDFGDRRLADLELPAHVPAVMPSELLRRRPDIRAAEAELMASTAEI 305

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G+A++D  P L+L G +        + F      W  G  +  P+FD G+ ++ +  AE+
Sbjct: 306 GVAEADRLPRLNLMGFLGTAATETSDLFTRSAETWGVGATVAGPLFDFGRARARVETAEA 365

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
              +    +  T+  A +EV +AL       + V  ++  V+  +++  L+ I Y +G  
Sbjct: 366 LRDQAETRYAMTMTQAFREVRDALVLYEATDERVGAVRRQVQAIQETRDLAEIRYEEGFT 425

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             +++LD ERA    E+ LS A R    +   L+ A+G G++
Sbjct: 426 GFIELLDAERALLDAELALSEALRDRLNATATLFKAMGGGWD 467


>gi|17544728|ref|NP_518130.1| drug efflux lipoprotein [Ralstonia solanacearum GMI1000]
 gi|17427017|emb|CAD13537.1| probable drug efflux lipoprotein [Ralstonia solanacearum GMI1000]
          Length = 514

 Score =  212 bits (539), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 110/462 (23%), Positives = 205/462 (44%), Gaps = 29/462 (6%)

Query: 14  LLAGCTVGPEYTKPHMPLLPTQFSIGNS-----------KNLINIDTLKWWESFNDTSLN 62
           +L+GC++ P Y +   P+                     +       L W E F D  L 
Sbjct: 22  VLSGCSLAPRYERLAAPVAGDYPQAPAGYGVSADTAKPGETAPRATDLGWREFFPDPRLQ 81

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLD- 121
           +L+ ++L+ N  +  A   I AA+       ADL P   A+ ++      ++ S    D 
Sbjct: 82  RLIGLSLENNRDLRVAILNIEAARAQYRQQIADLLPPINATATYTRSLTPQSISQTGQDI 141

Query: 122 -----------SDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                      S+++++LF       S+ A+  +        ++++IS++  +Y++ R +
Sbjct: 142 NTKQYQLGVGISNYQVNLFSVGDVTSSARASYLATEEGQRATQISLISQVAKAYLNERAY 201

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
            E++ +A Q L   +   +L+  +F  GA+S L L + E  ++S    +  L + +    
Sbjct: 202 AEQLELAQQTLKGREDYYKLAKQRFDVGASSALDLRQNETLVESARVSVAQLTRQYAQAT 261

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  L+G P       +   +      +   I  G+P++L+  RPDIR  E+KL  + A
Sbjct: 262 NALVLLVGSPLPAD---LPPPTTVSSEKIVADIPPGLPSELLEQRPDIRQAEQKLVAANA 318

Query: 291 KIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG+A++  +PSL L  ++        + F      WSF P L LPIF+ G    N+   
Sbjct: 319 NIGVARAAFFPSLGLTSNVGTASTALHDLFKSGTGLWSFVPNLTLPIFNWGTNVFNLDLT 378

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           +++ +     +++T+  A +EV +AL +     + V   +   +   + ++LS   YR G
Sbjct: 379 KANQKIAVANYEKTIQTAFQEVSDALVARGTLDEQVAAQKRFRDATAERLTLSDQRYRNG 438

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
             S LD+LD +R     +  L   +     + VDLY A+G G
Sbjct: 439 VSSFLDVLDAQRDLFSADQTLVQTRLARLTNAVDLYTALGGG 480


>gi|330815396|ref|YP_004359101.1| Putative outer membrane protein OprM precursor [Burkholderia
           gladioli BSR3]
 gi|327367789|gb|AEA59145.1| Putative outer membrane protein OprM precursor [Burkholderia
           gladioli BSR3]
          Length = 514

 Score =  212 bits (539), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 111/469 (23%), Positives = 201/469 (42%), Gaps = 29/469 (6%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIG-----------NSKNLINIDTLKWWESF 56
            ++ +    GCT+ P Y +P  P+  +  S G           +S N      + W   F
Sbjct: 24  AAVLLFAATGCTMAPHYQRPAAPVSGSFPSDGVYATQPGADGSHSANGQAAADIGWRNFF 83

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFP-----------SSYASIS 105
            D  L  L++IAL+ N  +  +   I AA+      RA LFP              A +S
Sbjct: 84  ADPRLQALIEIALKNNRDLRVSVLNIEAARAQYQITRAGLFPTLDGTGTGNTQRLPAGVS 143

Query: 106 HRFIPNLKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSY 164
               P +       L + W++DLFG+ + + + +LA   S       A++++IS++   Y
Sbjct: 144 TTGSPLITRTYNVGLSASWELDLFGRIQSLKDQALAQYLSTAQARKAAEISLISQVADQY 203

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           +  +   + + +  + L   + +  L+ L+F  G  S+L L + +  ++   ++     +
Sbjct: 204 LTLQSTDDLLKVTEETLKTAQDSYNLTKLQFDNGTGSELDLRQAQTVVEQALANQQAEAR 263

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
                V+ +  L+G P  + L       +    +L   I  G+P+DL+  RPDI   E+ 
Sbjct: 264 DRAQAVNALVLLIGEPLPDDLPAGLPLDS---QSLLTDIPAGLPSDLLTRRPDIMEAEQT 320

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIK 341
           L  + A IG A++  +P +SL  +           F      WSF P + LPIF+ G   
Sbjct: 321 LLAANANIGAARAAFFPKISLTAAFGTASPTLGGLFKAGTAAWSFAPNIALPIFEGGSNI 380

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           +N+  A    + +   +++ +  A +EV + L +     + +  L    E  ++   LS 
Sbjct: 381 ANLDLAHVQKRIEIANYEKAIQTAFREVSDGLAARGTYDQQIAALARNEEAQQRRYDLSD 440

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           + YR G  S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 441 LRYRNGVDSYLTVLTAQTDLYTAQTSLISARLARWTNLVDLYRALGGGW 489


>gi|170693463|ref|ZP_02884622.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia graminis C4D1M]
 gi|170141618|gb|EDT09787.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia graminis C4D1M]
          Length = 509

 Score =  212 bits (539), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 114/480 (23%), Positives = 210/480 (43%), Gaps = 33/480 (6%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQF----------------SIGNSKNL 44
           M     I     +  AGCT+ P+Y +P  P+                     S   S N 
Sbjct: 1   MQKHSLIAVAVALFAAGCTMAPKYERPAAPVTSNFPTGGVYETQPGATQPGQSGARSANG 60

Query: 45  INIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASI 104
           +    + W + F D  + +L+ IAL+ N  +  +   + A++     VRA LFP+  A+ 
Sbjct: 61  VAAADIGWRDFFVDPRMQRLIDIALKNNRDLRVSVLNMQASQAQFRIVRAGLFPTLDAAA 120

Query: 105 SHRFIPNL----------KTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAK 153
           S                   + +  L++ W+ID FG+ + + + +LA   +       A+
Sbjct: 121 SQSKSRTPENLSVAGRTISNSYSVGLNASWEIDFFGRIQSLKDQALAQYLATAQARKAAE 180

Query: 154 LNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIK 213
           + ++S++   Y+      + + +    L   +++  ++ L+F  G  S+L L + +  ++
Sbjct: 181 IALVSQVANQYLTVLELDDLLKVTQGTLKTAEESYRITKLQFDNGTGSELDLRQAQTVVE 240

Query: 214 SIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIR 273
              +++   E+      + +  LLG P    L      S+    NL   I  G+P+DL+ 
Sbjct: 241 QAGANLQAQERLRAQAENALVLLLGEPLPADLPPGLTLSD---QNLLTDIPAGLPSDLLT 297

Query: 274 NRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKL 330
            RPDI   E+ L  + A IG A++  +P +SL GS    + T    F   +  WSF P +
Sbjct: 298 RRPDIMEAEENLLAANANIGAARAAFFPRVSLTGSFGTLSPTLGGLFKPGSAAWSFAPSI 357

Query: 331 YLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAV 390
            LPIF+ G+ K+N+  A      Q  T+++ +  A +EV + L +     + +  L+   
Sbjct: 358 TLPIFEGGQNKANLDLANIQKNAQIATYEKAIQTAFREVADGLAARGTYDQQIRSLERNA 417

Query: 391 ELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              ++ + LS + Y  G  S L +L  +      +  L  A+ Q  ++ V LY A+G G+
Sbjct: 418 FAEQRRLDLSTLRYTNGVDSYLSVLTAQTDLYSAQQSLITARMQRLQNLVTLYQALGGGW 477


>gi|220903590|ref|YP_002478902.1| NodT family RND efflux system outer membrane lipoprotein
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
 gi|219867889|gb|ACL48224.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
          Length = 531

 Score =  212 bits (539), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 113/473 (23%), Positives = 213/473 (45%), Gaps = 25/473 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M +  A+F L + +L+ C++ P Y +P M +     ++      +N D   WW  FND  
Sbjct: 10  MRLTGAVFVLSVFMLSACSLAPRYERPEMDMPAQWRTVDMGAAPLNTD---WWNRFNDPV 66

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASI---------------- 104
           L  LV  AL+ N  I ++  +I++A   +    ADL PS   S                 
Sbjct: 67  LTALVDEALKNNQDIAESLAKIDSAASQVGIATADLLPSVSGSASSMAQGASEKTPNTMP 126

Query: 105 -SHRFIPNLKTNSTGQLDSDWKIDLFGQRRHIESSLAN-LDSAYAQVDIAKLNVISKLIP 162
                +      +   L + W++DL+G+ R+  + L++ L S     +  +L+V  +   
Sbjct: 127 FDKSGLSRTTATNQAALSASWELDLWGKNRNNYTMLSDVLMSTVIGHEALRLSVAGQTAQ 186

Query: 163 SYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTL 222
           SY        ++  A + L   +    +   ++ QG  ++L   +  AE++   + + T 
Sbjct: 187 SYFALLALDMQLDTARRTLKTREDAFSIYSSRYKQGDITELDWQRARAEVEIARAQVHTS 246

Query: 223 EKSFRMNVHNISTLLGYPATEFLHYMQKQSNNF-QPNLYIPINIGIPADLIRNRPDIRYQ 281
             +       ++ LLG    + +     +            +  G+P+DL++ RPD+R  
Sbjct: 247 TVAVDRAEAGLAVLLGRSPRDIMERGMPRGQAIGMLPSPPVLPEGLPSDLLQRRPDVRAA 306

Query: 282 EKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKG 338
           E  L  + A IG+A++  +PS+SL G +        + F G    WS+G    +P+ D G
Sbjct: 307 EFMLMANNANIGVARAQFFPSVSLTGMLGTVSAAVGSLFTGPAGAWSYGVTGSMPLLDFG 366

Query: 339 KIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMS 398
           +   N++ AE+  +     +++TV  A +++  +LT+  E   IV  +Q  VE  +++ +
Sbjct: 367 RTWYNVKDAEARKKASVAVYRKTVQTAFEDMRTSLTAQREADAIVRSMQIQVESLRRATT 426

Query: 399 LSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           ++ + Y  G    L +LD ER     E+ L+ A R    + V + +A+G G+N
Sbjct: 427 IARLQYDNGYTDYLTVLDAERQLFAAELQLASALRDRLDNVVSVCMALGGGWN 479


>gi|302038761|ref|YP_003799083.1| RND efflux system, outer membrane factor lipoprotein [Candidatus
           Nitrospira defluvii]
 gi|300606825|emb|CBK43158.1| RND efflux system, outer membrane factor lipoprotein [Candidatus
           Nitrospira defluvii]
          Length = 477

 Score =  212 bits (539), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 110/464 (23%), Positives = 205/464 (44%), Gaps = 18/464 (3%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLN 62
           + R    L   LL  C VGP++TKP               N  +I    WWE   D  L 
Sbjct: 1   MRRLALVLSSTLLTACAVGPDFTKPDATTPEAFRMAEAGGNTASIANTPWWELLKDQELQ 60

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTN------- 115
           KL++ AL++N  + +A   +   +  +   + D  P    + +                 
Sbjct: 61  KLIRTALEENKDLQRAAAAVEEFQARLFIAKTDFAPQMNVTTNAPLFGRKTNFLFPGFPN 120

Query: 116 ---STGQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
                 Q +  W+ID++G+ R    ++  +L S         L ++S +  +Y +   F 
Sbjct: 121 PFNYYLQGNLSWEIDIWGRIRRSNEAARGDLLSREENRRAIVLQLVSGVAEAYFELLQFD 180

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
            ++ IA + L  +++++ ++  +  QG  SKL   + EAE  +  +     E+      +
Sbjct: 181 MQLDIARRTLKSWEESVRIAQARLRQGMISKLDADQFEAERANAAAKAAEFERQKVQKEN 240

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
            +S LLG                  P++      G+P++L++ RPDI   E+ LA + A+
Sbjct: 241 QLSVLLGRNPGRIARGHSLTEQVMPPDVPP----GLPSELLQRRPDILQAEQDLAAATAR 296

Query: 292 IGIAKSDLYPSLSLNGSIALTHDNSFP---GYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
           IG+AK+D +P LS+ G + +   +              GP    P+ +   +    + AE
Sbjct: 297 IGMAKADRFPKLSITGILGVASPHLSRLVANETAFGVAGPGFAGPLLNAQILGFQQKAAE 356

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           + A++    ++++VL A KEVE++L +++  ++  T     V+  + ++SL+ + Y+ G 
Sbjct: 357 AQARQAVAQYEQSVLVAFKEVEDSLVAVSTVREQRTAQLQQVDALRSALSLANLRYKGGL 416

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            + LD+L  +R   + E+ L    R    S V LY A+G G+ P
Sbjct: 417 ANYLDVLIAQRNLFEAELALMGTHRLHLVSIVQLYKALGGGWTP 460


>gi|307730861|ref|YP_003908085.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. CCGE1003]
 gi|307585396|gb|ADN58794.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. CCGE1003]
          Length = 518

 Score =  212 bits (538), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 112/480 (23%), Positives = 211/480 (43%), Gaps = 33/480 (6%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQF----------------SIGNSKNL 44
           M     I     +  AGCT+ P+Y +P  P+  T                  +   S N 
Sbjct: 10  MQKHSLIAVAVALFAAGCTMAPKYERPAAPVSSTFPTGGVYATQPGATQPGGAGARSANG 69

Query: 45  INIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASI 104
                + W + F D  + +L++IAL+ N  +  +   + A++     VRA L P+  A+ 
Sbjct: 70  QAAADIGWRDFFVDPRMQRLIEIALKNNRDLRVSVLNMQASQAQFRIVRAGLLPTLDAAA 129

Query: 105 SHRFIPNL----------KTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAK 153
           S                   + +  L++ W+ID FG+ + + + +LA   +       A+
Sbjct: 130 SQSKSRTPKDLSVFGNTISNSYSVGLNASWEIDFFGRIQSLKDQALAQYLATAQARKAAE 189

Query: 154 LNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIK 213
           + ++S++   Y+      + + +    L   +++  ++ L+F  G  S+L L + +  ++
Sbjct: 190 IALVSQVANQYLTVLELDDLLKVTQNTLKTAEESYRITKLQFDNGTGSELDLRQAQTVVE 249

Query: 214 SIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIR 273
              +++ +  +      + +  LLG P    L      S+    NL   I  G+P+DL+ 
Sbjct: 250 QAGANLQSQARLRAQAENALVLLLGEPLPADLPPGLTLSD---QNLLTDIPAGLPSDLLT 306

Query: 274 NRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKL 330
            RPDI   E+ L  + A IG A++  +P +SL GS    + T    F   +  WSF P +
Sbjct: 307 RRPDIMEAEENLLAANANIGAARAAFFPKVSLTGSFGTLSPTLGGLFKPGSAAWSFAPSI 366

Query: 331 YLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAV 390
            LPIF+ G+ K+N+  A      Q  T+++ +  A +EV +AL +     + +  L+   
Sbjct: 367 TLPIFEGGQNKANLDLANIQKNAQIATYEKAIQTAFREVADALAARGTYDQQIQSLERNT 426

Query: 391 ELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              ++ + LS + Y  G  S L +L  +      +  L  A+ +  ++ V LY A+G G+
Sbjct: 427 FAQQRRLDLSNLRYTNGVDSYLSVLTAQTDLYSSQQSLITARMERLQNLVTLYQALGGGW 486


>gi|330807998|ref|YP_004352460.1| outer membrane protein precursor; efflux transporter outer membrane
           factor (OMF) lipoprotein, NodT family [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327376106|gb|AEA67456.1| outer membrane protein precursor; efflux transporter, outer
           membrane factor (OMF) lipoprotein, NodT family
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 485

 Score =  212 bits (538), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 100/471 (21%), Positives = 206/471 (43%), Gaps = 25/471 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGN----SKNLINIDTLKWWESF 56
           M+      ++  V+L+GC++ P+Y +P  P+             +          W + F
Sbjct: 1   MSKSLLSLTIAAVVLSGCSLIPDYQRPETPVAAQYPQGPAYEAANAPGQAAAEQGWKQFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           +D +L +L+++AL+ N  +  A   I+A        RADLFP+  A+ S          S
Sbjct: 61  HDPTLQQLIQVALENNRDLRVAALNIDAYAAQYRIQRADLFPAVSATGSGSRQRVPARAS 120

Query: 117 TGQLDS------------DWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPS 163
                +             +++DLFG+ R + E +L +  +        ++++++ +  +
Sbjct: 121 QSGEAAISSSYSATLGISAYELDLFGRVRSLSEQALQSYFATEEARRSTQISLVANVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  +  KE + +  + L  Y+++ +L+      G +S L L +    +++    +    
Sbjct: 181 YLTWQADKELLKLTQETLGAYEQSFKLTSRSAEVGVSSALDLSQARTAVENARVQLARYT 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    + ++++                 S     +L   +  G+P+DL++ RPDI   E+
Sbjct: 241 RQVAQDENSLTL-----LLGTGLPANLSSQPLNDDLLSEVPAGLPSDLLQRRPDILQAER 295

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  +      +    F G +  W+F P++ LPIF+ G +
Sbjct: 296 NLLAANANIGAARAAFFPSISLTANAGTLSPDLSGLFKGGSGTWTFAPQINLPIFNAGSL 355

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++++  A+         +++++  A +EV + L +     + +      V  ++    L+
Sbjct: 356 RASLDYAKIQKDINVAQYEKSIQTAFQEVSDGLAARQTYNEQLQAQTDFVAANQDYYRLA 415

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
              YR G  S L  LD +R     +  L   +     S V+LY A+G G+N
Sbjct: 416 ERRYRIGVDSNLTFLDAQRQLFSAQQSLITDRLAQLTSEVNLYKALGGGWN 466


>gi|237752859|ref|ZP_04583339.1| cation efflux system protein cusC [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229375126|gb|EEO25217.1| cation efflux system protein cusC [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 474

 Score =  212 bits (538), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 108/458 (23%), Positives = 205/458 (44%), Gaps = 15/458 (3%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
           +  ++  +   GC++ P+Y+KP   L       G   + +     KWWE F DT LN  V
Sbjct: 11  SFVAILALGFGGCSLSPKYSKPTTNLP--DIKEGLQNSEVLEIKEKWWEDFGDTQLNVFV 68

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF--------IPNLKTNST 117
           + AL  N  +L A ERI  A+      R+D +PS  A                    N +
Sbjct: 69  EEALVNNYDLLVAMERIEQARAQWGYARSDRYPSLSAQGEATRNRKNLNLGQRENYNNFS 128

Query: 118 GQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISI 176
                 +++DL+G+ R  + S  A L +  A  D+ +L++++ ++ SY        ++ I
Sbjct: 129 LSAVLSFELDLWGRARDADRSALAKLLAIKANGDMVRLSLVANIMQSYFGVLTLNNQVQI 188

Query: 177 AHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL 236
           +   L    +N E    +F  G  S++ + + ++E+ S+++ + +L             L
Sbjct: 189 SQNTLKSRTENYEYRKKEFEAGKISEIDMQQAKSEMASVQAQLQSLLMEQNSAQSAFLIL 248

Query: 237 LGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
           LG                   +       G+P+ +++ RPDI   E+ L  +   IG+A+
Sbjct: 249 LGRDGKGMFENKIPTKPQALVSAPSIK-AGLPSSILQKRPDIEAAEQNLKAANFSIGVAR 307

Query: 297 SDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQE 353
           S  +P++SL G            F   N+ W+FG      + D G+  +N+  A+S  +E
Sbjct: 308 SVYFPTISLTGLFGYASPQLNELFRTSNSTWNFGGNFIGNLLDFGRTSANVDLAKSQYRE 367

Query: 354 QYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLD 413
             +T+ +T+  A  EV  +L ++    + +  L+  VE  ++++ L+ + Y +G  S L+
Sbjct: 368 MLLTYGQTLRTAFGEVRESLFNVQMTNQRLNSLKEQVEALQRTLELANLRYAEGYVSYLE 427

Query: 414 ILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +L  + A    E++   A+ +   + + LY A G G++
Sbjct: 428 VLSTQSALFAAELEQEGARLESLSATISLYKAFGGGWD 465


>gi|295677552|ref|YP_003606076.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. CCGE1002]
 gi|295437395|gb|ADG16565.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. CCGE1002]
          Length = 506

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 111/475 (23%), Positives = 208/475 (43%), Gaps = 28/475 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIG-----------NSKNLINIDT 49
           M     I     +L  GCT+ P Y +P  P+  T  + G            S N      
Sbjct: 1   MQKHSLIAVAVALLATGCTLAPHYQRPAAPVTATFPTGGVYDQQPGAQGERSANGQAAAD 60

Query: 50  LKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI 109
           + W   F D  L +L++IAL+ N  +  +   + A+      VRA LFP+  A+ S    
Sbjct: 61  IGWRNFFVDPRLQQLIEIALKNNRDLRVSVLNMQASAAQYRIVRAGLFPTLDAAASQSRS 120

Query: 110 PNL----------KTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVIS 158
                            +  L++ W+ID FG+ + + + +LA           A++ +++
Sbjct: 121 RTPKDLTFTGVTISNTYSVGLNASWEIDFFGRVQSLKDQALATYLGTAQARKAAEIALVA 180

Query: 159 KLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESD 218
           ++   Y+      + + +    L   +++  ++ L+F  G  S+L L + +  +++  +D
Sbjct: 181 QVANQYMTVLELDDLLKVTQNTLKTAQESFRITKLQFDNGTGSELDLRQAQTVVETASAD 240

Query: 219 IPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDI 278
           + T  +      + +  L+G P    L      ++    +L   I  G+P+DL+  RPDI
Sbjct: 241 LQTQTRLRAQADNALVLLIGEPLPADLPTGLPLND---QSLLTDIPAGLPSDLLTRRPDI 297

Query: 279 RYQEKKLADSVAKIGIAKSDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIF 335
              E+ L  + A IG A++  +P ++L GS    + T    F   +  WSF P + LPIF
Sbjct: 298 MEAEENLLAANANIGAARAAFFPRVTLTGSAGTLSPTLGGLFKPGSAAWSFAPSITLPIF 357

Query: 336 DKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKK 395
           + G+  +N+  A      Q  T+++ +  A +EV + L +     + +  L+  V   ++
Sbjct: 358 EGGQNMANLDLANIEKNVQIATYEKAIQTAFREVADGLAARGTYDEQIAALERDVAAEQR 417

Query: 396 SMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            + LS + Y  G  S L +L  + +    +  L  A+    ++ V LY A+G G+
Sbjct: 418 RLDLSTLRYTNGVDSYLAVLTAQTSLYVAQQALVTARMGRLQNLVTLYQALGGGW 472


>gi|189424457|ref|YP_001951634.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Geobacter lovleyi SZ]
 gi|189420716|gb|ACD95114.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Geobacter lovleyi SZ]
          Length = 461

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 114/455 (25%), Positives = 222/455 (48%), Gaps = 14/455 (3%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLN 62
           +   +F   ++L+ GC+VGP+Y +P +   P Q+++   K   ++   +WW+ F D  L+
Sbjct: 1   MRNFMFVTMLLLVCGCSVGPDYVRPDV-KAPDQWNV-EYKAAADLANTQWWKLFGDKVLD 58

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYA---SISHRFIPNLKTNSTGQ 119
            L++ A++ NL +  AT +++     + + R+  FP   A     +     +   +    
Sbjct: 59  DLIETAVRGNLDLKSATAKVDQYLGVLDTTRSQYFPQISAGFNPGATHTGSSTTQSYQAT 118

Query: 120 LDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAH 178
           +++ W++DL+G+ R   E++ A +  + A      + V+S +   YI  R    ++ IA 
Sbjct: 119 VNATWELDLWGKIRRSSEAAQAQIVGSEAGRRAVIMTVVSNVASGYITLRGMDRQLEIAR 178

Query: 179 QILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLG 238
                Y ++++L  L+F  G  S+L L + E+  ++    IP+ E   R   + IS LLG
Sbjct: 179 DTEKAYAESLKLFQLRFKYGTISQLELSQAESNYEAARQAIPSYESLVRQQENLISLLLG 238

Query: 239 YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSD 298
                       +       +   I  G+P+ L+  RPDI   E+ L  + A+IG+AK+ 
Sbjct: 239 RAPG-----PIPRGKTIDELIPPGIPAGLPSLLLERRPDIIQAEQNLIAANAEIGVAKAA 293

Query: 299 LYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQY 355
            +P +SL G++ ++  +    F      WS G +L  P+F+ G+    +++AE+  Q+  
Sbjct: 294 YFPKISLTGALGVSSGDISRLFVPGAGIWSAGAQLAQPLFNFGQTAGQVKQAEAQQQQAL 353

Query: 356 ITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDIL 415
             +Q+T+L A +EVE+AL    + ++ +   +  V        L+ + +  G  S L +L
Sbjct: 354 YQYQQTILTAFREVEDALIKTTKGREQLEAQRRQVASLSDYDRLARLQFEAGTSSYLQVL 413

Query: 416 DIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           D +R+    ++D +     L  S + +Y A+G G+
Sbjct: 414 DADRSLFTGKLDKTKTHYDLLVSLISVYKAMGGGW 448


>gi|239833861|ref|ZP_04682189.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Ochrobactrum intermedium LMG 3301]
 gi|239821924|gb|EEQ93493.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Ochrobactrum intermedium LMG 3301]
          Length = 545

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 125/455 (27%), Positives = 231/455 (50%), Gaps = 14/455 (3%)

Query: 6   AIFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKL 64
            +    + +LA C TVGP+Y  P++ + P  ++      +  +    WW+   D  L++L
Sbjct: 61  TVLGSILPMLAACVTVGPDYQTPNV-VTPAGWNSRADSRIPQL--GDWWKKLKDPVLDQL 117

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQ----L 120
           +   +  +  +  A  ++  A+ N  S    L+P      S++      T +T Q     
Sbjct: 118 IADGIAGSPDVATAKAKVRQARANYTSAGGALYPKLDGDGSYKRSDTPATFATNQSSMGF 177

Query: 121 DSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQ 179
           ++ W++DLFG  +  +E++  N++SA  Q+  A + +I  +  +Y   R  +  I+IA +
Sbjct: 178 NTTWELDLFGGNKRGVEAAYYNVESANEQLRAALVTLIGDIATNYARLRGAQADIAIAQR 237

Query: 180 ILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGY 239
                ++ + L+  +   G  S++ L+  E +    ES +P L  ++   ++ +S L G 
Sbjct: 238 NAASQRQTVALTRSQLEAGQISQVDLLNAETQASRTESQVPGLRINYAQYLNQLSVLTGR 297

Query: 240 PATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDL 299
            ++     + K      P +   I+ G+PADL+ +RPD+R  E+  A S A +G  ++ L
Sbjct: 298 SSSSLASVLDK--PRPVPAIPGKISAGLPADLLLSRPDVRAAERDYASSNASVGQKQALL 355

Query: 300 YPSLSLNGSIALTHDNSFPGYN---THWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYI 356
           YPS+SL G+I     N           W+FGP L +PIF  G++ +++  A ++  + +I
Sbjct: 356 YPSVSLTGAINTGGANFGDLGKLSTISWNFGPSLTVPIFQGGRLSADVDAARAARDQSFI 415

Query: 357 TWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILD 416
            +++ +L A+ EVENA  S+N+++  V +LQ  V   +K   L++  YR G  S +D+L 
Sbjct: 416 AYRKVILTALSEVENASVSLNQNRLRVAQLQKIVSNSRKINELTLEQYRAGTKSFVDVLT 475

Query: 417 IERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            +R     E +LS A+ +L  +YV L  A+G G+N
Sbjct: 476 AQRDLLGAETELSQARTELVLNYVALQKALGGGWN 510


>gi|118591601|ref|ZP_01548998.1| RND efflux system, outer membrane lipoprotein, NodT [Stappia
           aggregata IAM 12614]
 gi|118435929|gb|EAV42573.1| RND efflux system, outer membrane lipoprotein, NodT [Stappia
           aggregata IAM 12614]
          Length = 501

 Score =  211 bits (537), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 131/451 (29%), Positives = 225/451 (49%), Gaps = 11/451 (2%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIA 68
            +   LL+ C+VGP+Y +P + +     +              WW    D  LN L+ +A
Sbjct: 29  LMAATLLSACSVGPDYQRPDISVPGKWRNATGETPASVPQLANWWTQLGDAQLNSLIALA 88

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI-----PNLKTNSTGQLDSD 123
           +Q NL +  A  ++  A+ +     + LFPS   +            ++ T   G  D+ 
Sbjct: 89  VQNNLDVRTAKAKVREARASYKQASSSLFPSLDGAAGVTRSKSSGSDSVGTLWNGGFDAA 148

Query: 124 WKID-LFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILD 182
           W+ID     RR  E++   LD+A   +  + L +I  L  +Y++AR  ++R+ +A     
Sbjct: 149 WEIDIFGANRRAREAAKYGLDAAEEDLRASLLTLIGDLATNYVEARGLQQRLKLAQDTAR 208

Query: 183 LYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPAT 242
             + + +L   +F  G++S L +   E +  S E++IP L+ +   ++H +S L G   T
Sbjct: 209 SQQSSADLIRKRFQAGSSSGLDVANAEGQAASTEANIPALKTALAASMHRLSVLTGQQPT 268

Query: 243 EFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPS 302
                +   +    P L   I +GIPA ++  RPD+R  E++LA + AKIG A +  YPS
Sbjct: 269 ALTDQLLASNRIPTPKLP--IPVGIPASILLTRPDVRLAERQLAQATAKIGQATAARYPS 326

Query: 303 LSLNGSIALTHDNSFP---GYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQ 359
           +SL GSI     +        +  W+FGP L +PIF+ GK+ + +  AE+   + ++ +Q
Sbjct: 327 VSLTGSIGTAAADFGDLGKNSSISWAFGPSLSVPIFNAGKLAAGVEIAEAQRDQYFLAYQ 386

Query: 360 ETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIER 419
            +VL A+++VENAL    +++K V   + + E +K +  LS   Y+ G  S LD LD ER
Sbjct: 387 ASVLTALEDVENALVGFTQERKRVASQRRSAESYKSAAELSRSLYQTGAASFLDALDAER 446

Query: 420 ATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +T   +  L  ++ +L   Y+ L  A+G G+
Sbjct: 447 STYSAQDTLIQSRVRLTTYYIALQKALGGGW 477


>gi|225692172|gb|ACO06753.1| EmhC [Pseudomonas fluorescens]
          Length = 485

 Score =  211 bits (536), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 99/471 (21%), Positives = 204/471 (43%), Gaps = 25/471 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGN----SKNLINIDTLKWWESF 56
           M+      ++  V+L+GC++ P+Y +P  P+             +          W + F
Sbjct: 1   MSKSLLSLTIAAVVLSGCSLIPDYQRPEAPVAAQYPQGPAYESANAPGQAAAEQGWKQFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           +D +L +L+++AL+ N  +  A   I+A        RADLFP+  A+ S          S
Sbjct: 61  HDPALQQLIQVALENNRDLRVAALNIDAYAAQYRIQRADLFPAVSATGSGSRQRVPARAS 120

Query: 117 TGQL------------DSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPS 163
                            S +++DLFG+ R + E +L +  +        ++++++ +  +
Sbjct: 121 QSGEAGISSSYSATLGISAYELDLFGRVRSLSEQALQSYFATEEARRSTQISLVANVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  +  KE + +  + L  Y ++++L+      G  S L L +    +++    +    
Sbjct: 181 YLTWQADKELLKLTQETLGAYDQSLKLTSRSAEVGVASALDLSQARTAVENARVQLARYT 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    + ++++                 +     +L   +  G+P++L++ RPDI   E+
Sbjct: 241 RQVAQDENSLTL-----LLGTSLPANLNTQPLSDDLLSEVPAGLPSELLQRRPDILQAER 295

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  +      +    F G +  W+F P++ LPIF+ G +
Sbjct: 296 NLLAANANIGAARAAFFPSISLTANAGTLSPDLSGLFKGGSGTWTFAPQINLPIFNAGSL 355

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++++  A+         +++ +  A +EV + L +     + +      V  ++    L+
Sbjct: 356 RASLDYAKIQKDINVANYEKAIQTAFQEVSDGLAARRTYNEQLQAQTAYVASNQDYYRLA 415

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
              YR G  S L  LD +R     +  L   +     S V+LY A+G G+N
Sbjct: 416 ERRYRIGVDSNLTFLDAQRQLFSAQQSLITDRLAQLTSEVNLYKALGGGWN 466


>gi|317484498|ref|ZP_07943407.1| NodT family efflux transporter [Bilophila wadsworthia 3_1_6]
 gi|316924216|gb|EFV45393.1| NodT family efflux transporter [Bilophila wadsworthia 3_1_6]
          Length = 458

 Score =  211 bits (536), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 116/463 (25%), Positives = 217/463 (46%), Gaps = 19/463 (4%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M I   +  L ++ LAGC+  P+Y +P M L       G  + L      +WW+ F+D++
Sbjct: 1   MRIF--VVGLMMLGLAGCSFAPDYQRPQMELPQAWKDPGKGEQL----DEQWWKRFDDST 54

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKT------ 114
           LN LV+ AL  N  I  A  R++ A+  +   RA+L P               T      
Sbjct: 55  LNALVQEALIANRDIAAAVARVDYARAQLGVARAELLPLLSGQAQGTQTWVDNTKITNGS 114

Query: 115 --NSTGQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
               +    + W++DL+G+ R+ + +++  +    A     +L++ ++   +Y   R   
Sbjct: 115 QSPFSAGFGATWELDLWGKLRNAKEAAMYQVLGTEAAQRGMRLSIAAQTSNAYFLLRSLD 174

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
            ++S A + +      + +   ++ QG  S+L L + + E+++ ++ +     S      
Sbjct: 175 LQLSTAERTVKTRTDALRIYTARYEQGLISELDLSRAKTEVETAKTALYQTRISRDAAES 234

Query: 232 NISTLLGYPATEFLH-YMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
            +  LLG    + +   +Q+            I  G+P+DL+  RPDI+  E  +  + A
Sbjct: 235 ALEALLGRSPKDIMDGTVQRGMTLESIPTPPVIPAGVPSDLLERRPDIQQAEMSVKSANA 294

Query: 291 KIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG+AK+  +P++SL G   +               WS+G    +P+ D G++K  +  A
Sbjct: 295 NIGVAKAAWFPAISLTGLFGVVSPELHTLMSNPLQTWSYGGAASVPLLDFGRVKYGVEAA 354

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E+  +E   T+++TV  A KE+ +ALT   E   +V  L+  V+  + S+ L+   Y  G
Sbjct: 355 EAKQRESLATYEKTVQGAFKEMRDALTRQQEMSNVVASLERMVKELRLSVELANTRYDNG 414

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             S L++LD ER+    E+ L+ A+ +   S V++ +A+G G+
Sbjct: 415 YSSYLEVLDAERSLFDSEMQLAAARSERLSSIVNVCLALGGGW 457


>gi|192290998|ref|YP_001991603.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhodopseudomonas palustris TIE-1]
 gi|192284747|gb|ACF01128.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhodopseudomonas palustris TIE-1]
          Length = 501

 Score =  211 bits (536), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 130/473 (27%), Positives = 226/473 (47%), Gaps = 31/473 (6%)

Query: 7   IFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVK 66
           +  L  V+L GC VGP+Y  P +   P Q+S             +WW    D +L++LV 
Sbjct: 2   LMILVAVMLGGCAVGPDYRTPLL-ATPAQWSGAGVATPAAPVLPRWWARLRDPTLDRLVV 60

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFP------------------------SSYA 102
            A+  NL +  A+ R+  A+ +       L P                        +   
Sbjct: 61  EAVDGNLDVATASARVREARASYRQAVGALLPTIANTESARLAKGTGVASAAPGRPNLGG 120

Query: 103 SISHRFIPNLKTNSTGQLDSDWKIDLFGQRRHIESSLAN-LDSAYAQVDIAKLNVISKLI 161
             S               D+ W++DLFG  R    + A  +D++   +    L ++  + 
Sbjct: 121 PSSVVGSDGTSGLYQAGFDASWELDLFGANRRAVEAAAYGIDASDENLRAVLLTLVGDVA 180

Query: 162 PSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPT 221
            SY++AR ++ RI++A +      +  +++  +   G  S + L     +  +  + IPT
Sbjct: 181 SSYVEARGYQARIALARRTATSQDETTKITRNRLAAGTGSAVDLATATGQAAATRAAIPT 240

Query: 222 LEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQ 281
           LE ++   VH +S L G P +     + +      P L +P   GIPAD++  RPD+R  
Sbjct: 241 LETAYAQTVHRLSVLTGRPPSALSALLARPKPIPAPKLPVP--AGIPADVLLTRPDVRLA 298

Query: 282 EKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKG 338
           E++ A S A+IG A++ LYPS+SL G+IA +     +     +  WS GP L +PIF+ G
Sbjct: 299 ERRYAQSTARIGQAEAALYPSVSLAGNIATSGTKLGDLGRNSSISWSLGPTLTVPIFNGG 358

Query: 339 KIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMS 398
           K+++ +  AE+   +Q++ +Q +VL A+K+VE+AL S++ +      L  +   ++++ S
Sbjct: 359 KLRAAVEIAEAQRDQQFLAYQASVLTALKDVEDALVSLSNEHSRSRILATSTTAYRQAAS 418

Query: 399 LSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           LS   YR G  S LD+L  ER+    E  L  ++ ++   Y+ L  A+G G++
Sbjct: 419 LSQSLYRSGSSSFLDVLTAERSLYSAEDALLQSRVKIVSDYIALNKALGGGWD 471


>gi|104783333|ref|YP_609831.1| multidrug/solvent efflux outer membrane protein TtgC [Pseudomonas
           entomophila L48]
 gi|95112320|emb|CAK17047.1| multidrug/solvent efflux outer membrane protein TtgC, RND family
           [Pseudomonas entomophila L48]
          Length = 481

 Score =  211 bits (536), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 97/470 (20%), Positives = 200/470 (42%), Gaps = 24/470 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL----INIDTLKWWESF 56
           M       ++   +L GC++ P+Y  P  P+                 +      W + F
Sbjct: 1   MTKSLLSLAVTAFILGGCSLIPDYQAPEAPVAAQWPQGPAYSPTESANVAAAEQGWRQFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           +D +L +LV+ +L+ N  +  A   I+A +      RADLFP+  A+ S          S
Sbjct: 61  HDPALQQLVQTSLENNRDLRVAALNIDAYRAQYRIQRADLFPAVSANGSGSRQRVPANMS 120

Query: 117 TGQL------------DSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPS 163
                            S +++DLFG+ R +         S+       ++++++ +  +
Sbjct: 121 QTGEANITSQYSATLGVSAYELDLFGRVRSLTEQALETYLSSEQARRSTQISLVASVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y   +  +  + +  + L  Y+++  L+      G  S L L +    ++     +   +
Sbjct: 181 YYTWQADQALLKLTEETLKTYEESYNLTRRSNEVGVASALDLSQARTAVEGARVKLSQYQ 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    ++++++ L+G      L    + + +    +      G+P+D+++ RPDI+  E 
Sbjct: 241 RLVAQDLNSLTVLVGTGVPANLPKPLELNADQLAEVP----AGLPSDILQRRPDIQEAEH 296

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  +      +    F G +  W F P++ LPIF+ G +
Sbjct: 297 LLKAANANIGAARAAFFPSISLTANAGTLSPDMGGLFKGGSGTWLFQPQINLPIFNAGSL 356

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           K+++  ++         +++T+  A +EV + L +    ++ +   +  V  ++    L+
Sbjct: 357 KASLDYSKIQKDINVAKYEKTIQTAFQEVADGLAARKTFEEQLQAQRDLVAANQDYYRLA 416

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              YR G  S L  LD +R     +  L   +     S V+LY A+G G+
Sbjct: 417 ERRYRIGIDSNLTFLDAQRNLFSAQQALISDRLSQLVSEVNLYKALGGGW 466


>gi|253999404|ref|YP_003051467.1| NodT family RND efflux system outer membrane lipoprotein
           [Methylovorus sp. SIP3-4]
 gi|253986083|gb|ACT50940.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Methylovorus sp. SIP3-4]
          Length = 471

 Score =  211 bits (536), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 110/467 (23%), Positives = 215/467 (46%), Gaps = 25/467 (5%)

Query: 3   ILRAIFSLFIVLLAGCTV-GPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
            L  I  L  +LL GC + GP+Y +P MP +P +F+           +  WW+ +ND  L
Sbjct: 6   KLTYIAVLAAILLPGCAMMGPDYQRPEMP-VPAKFAEQADATNQAEISRTWWQLYNDPVL 64

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK-------- 113
           N LV  AL  N  I  A  R+  A   +  V A LFP    + S       +        
Sbjct: 65  NDLVAKALANNTDIKLAVARVEEADAYLREVGAALFPQIDLNSSAARSRITQLGATPLPS 124

Query: 114 ------TNSTGQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYID 166
                  N   +L + +++D +G+ R  + S+ A   + +   D   L++   +  +Y+ 
Sbjct: 125 GVDPIRENYNIRLGTSFELDFWGKLRRAKESARAQAMATHYARDTVDLSLQGLVASNYLL 184

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
            R  + +I+++   L   ++++ L+  +   G +S L + + +    ++ + +  L +  
Sbjct: 185 LRSLESQIALSQDSLHSRQESLALTQRRLEGGVSSALDVHQAQVSTSNLTAQLADLVRQR 244

Query: 227 RMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLA 286
            +  H ++ L G      L      ++  Q        +G+P+ L+ +RPD+R  E+ + 
Sbjct: 245 AIVEHQLAVLTG-----DLALTIPAADFNQLPTPPVPPVGLPSSLLESRPDVRQAEQNMI 299

Query: 287 DSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSN 343
            + A IG+AK+ L+P++SL  +         +        W+ G  L LPIFD G++ S 
Sbjct: 300 AANANIGVAKAALFPTISLTANYGGESAELGDILKSAARIWTGGLSLNLPIFDAGRLNSR 359

Query: 344 IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
           + +A +  ++   +++  +  A KEV +AL ++ +  +    L+ + E  KK++ ++   
Sbjct: 360 VDQATAQQKQTLASYESAIQTAFKEVNDALVNLRQQSEREAALEASKESSKKALDIAENR 419

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           Y+ G    LD+LD +R      +    +++    + VDL+ A+G G+
Sbjct: 420 YKAGYSGYLDVLDSQRVYNDAALAYVQSRQARLTASVDLFKALGGGW 466


>gi|171321879|ref|ZP_02910775.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia ambifaria MEX-5]
 gi|171092827|gb|EDT38092.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia ambifaria MEX-5]
          Length = 507

 Score =  211 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 108/477 (22%), Positives = 207/477 (43%), Gaps = 30/477 (6%)

Query: 1   MNILRAIFSLFIVLLA-GCTVGPEYTKPHMPLLPTQ-----------FSIGNSKNLINID 48
           M    A+ ++ + LLA GCT+ P Y +P  P+                +   S N     
Sbjct: 1   MMQKHALTAIAVALLATGCTMAPHYKRPDAPVAQAYPADGVYATQPGAAGARSANGQAAT 60

Query: 49  TLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS--- 105
            + W E F D  L +L++IAL+ N  +  A   I AA+      RA LFP+   + +   
Sbjct: 61  AIGWREFFVDPRLQRLIEIALKNNRDLRVAVLNIEAARAQYQITRAGLFPTLDGTGTGNI 120

Query: 106 --------HRFIPNLKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNV 156
                       P +       L + W++DLFG+ + + + +LA   S        ++++
Sbjct: 121 QRVPQGLSQTGAPYISRAYNVGLSASWELDLFGRVQSLKDQALAQYLSTSYARQATEISL 180

Query: 157 ISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE 216
           +S++   Y+      + + +    L   + + +L+ L+F  G  S+L L + +  ++   
Sbjct: 181 VSQVADQYLTLLSTDDLLKVTEDTLKTAQASYDLTKLQFDNGTGSELDLRQAQTVVEQAL 240

Query: 217 SDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRP 276
           S+     ++    ++ +  L+G P  + L            NL   +  G+P+DL+  RP
Sbjct: 241 SNQQAQARARAQALNALVLLIGEPLPDDLPAGMPLDA---QNLLTDVPAGLPSDLLTRRP 297

Query: 277 DIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLP 333
           D+   E+ L  + A IG A++  +P +SL G+           F      WSF P++ +P
Sbjct: 298 DVMQAEQTLLAANANIGAARAAFFPRISLTGAFGTGSPTLGGLFKAGTAAWSFAPQITMP 357

Query: 334 IFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELH 393
           IF+ G+  +N+  A    + +   +++ + +A +EV + L +     + +  L+      
Sbjct: 358 IFEGGQNIANLNLANVQKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQ 417

Query: 394 KKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           ++   LS + Y+ G  S L +L  +      +  L  A+     + V LY A+G G+
Sbjct: 418 QRRFDLSDLRYKNGVDSYLSVLTAQTDLYSAQQSLINARLARWTNLVTLYRALGGGW 474


>gi|229588908|ref|YP_002871027.1| outer membrane protein [Pseudomonas fluorescens SBW25]
 gi|229360774|emb|CAY47632.1| outer membrane protein precursor [Pseudomonas fluorescens SBW25]
          Length = 485

 Score =  211 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 97/471 (20%), Positives = 196/471 (41%), Gaps = 25/471 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGN----SKNLINIDTLKWWESF 56
           M+      ++   +L+GC++ P+Y +P  P+                        W + F
Sbjct: 1   MSKSLLSLAVTAFVLSGCSLIPDYQRPEAPVAAQFPQGPAYSSAQAPSQAAAEQGWKQFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           +D +L +L++ AL  N  +  A   I+A        RADLFP+  A+ S          S
Sbjct: 61  HDPALQQLIQTALVNNRDLRVAALNIDAYAAQYRIQRADLFPAVSANGSGSRQRVPARAS 120

Query: 117 TGQL------------DSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPS 163
                            S +++DLFG+ R +         +        ++++++ +  +
Sbjct: 121 QTGEANITSQYSATLGISSYELDLFGRVRSLSEEALQKYFATEEARRSTQISLVASVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  +  KE + +    L  ++++ +L+      G  S L L +    +++    +    
Sbjct: 181 YLTWQADKELLKLTQDTLGAFEQSFKLTSRSNEVGVASALDLSQARTSVENARVQLARYT 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    + ++++                 S     +L   +  G+P+DL++ RPDI   E 
Sbjct: 241 RQVAQDENSLTL-----LLGTGLPANIASKPLSDDLLSEVPAGLPSDLLQRRPDILQAEY 295

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  +      +    F G +  WSF P++ +PIF+ G +
Sbjct: 296 NLKAANANIGAARAAFFPSISLTANAGTLSPDLGGLFKGGSGTWSFAPQINIPIFNAGSL 355

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++++  ++   +     +++ +    +EV + L S    K+ +   +  V  ++    L+
Sbjct: 356 RASLDYSKIQKEINVANYEKAIQTGFQEVSDGLASRETYKQQLEAQRGFVAANQDYYRLA 415

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
              YR G  S L  LD +R     +  L   +     S V+LY A+G G+N
Sbjct: 416 ERRYRIGVDSNLTFLDAQRQLFSAQQSLITDRLAQLTSEVNLYKALGGGWN 466


>gi|30249100|ref|NP_841170.1| Outer membrane efflux protein [Nitrosomonas europaea ATCC 19718]
 gi|30138717|emb|CAD85022.1| Outer membrane efflux protein [Nitrosomonas europaea ATCC 19718]
          Length = 470

 Score =  211 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 100/460 (21%), Positives = 211/460 (45%), Gaps = 19/460 (4%)

Query: 5   RAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKL 64
           ++  S  ++LL+GC++ PEY++P  PL  +     +  N ++     W + F D  L  L
Sbjct: 12  KSAVSALVLLLSGCSLIPEYSRPPAPLPASY--TADDTNAMDAAPESWQQYFTDPVLQNL 69

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP---------NLKTN 115
           + IAL+QN  +  A  RI  A+      R+   P+  A+ S+             ++   
Sbjct: 70  INIALEQNRDLRIAALRIEEARAQYDIQRSAKLPTIDATGSYDRSRLIFAKGETFDVDMY 129

Query: 116 STGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
             G   S+++ID FG+ + + E+ L +  +       A+ ++I+++  +Y+D R   ER 
Sbjct: 130 RVGIGISNFEIDFFGRIKSLSEAVLEDYLATREAQQTARTSLIAEVAAAYVDERALSERQ 189

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
            +A + L   + +      +F  G  + + L   + +++S  + +  L++     ++ + 
Sbjct: 190 LLAEKTLAAREASYTRIRRRFDAGIDTAIDLKAAKMQMESARASVSALDREHTRAINTLL 249

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
            L+G  +      +          +      G+P+DL+  RPDIR  E KL  + A IG 
Sbjct: 250 LLMGDQSVTLPGGIAALDTLAFSPIP----AGLPSDLLERRPDIRAAEHKLKAANANIGA 305

Query: 295 AKSDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           A++ L+P L L  +I                 W+F P++  PIF   + ++N+  + +  
Sbjct: 306 ARAALFPRLQLTTNIGLVNEHFTKLLSNGINAWAFTPQIIFPIFTHKRNQANLNVSRARM 365

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           +     +++ +  A +EV + L +  + +K +    +A +  ++ + L    Y +G  + 
Sbjct: 366 EIAVAEYEKAIQTAFREVADTLLAREQIEKQINAQSNATDADRERLKLVTRRYEKGVANY 425

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           L++LD +R+    E  L   ++    + ++L+ A+G  ++
Sbjct: 426 LELLDAQRSLFDSEQALVQLRQLSLSNAINLFKALGGEWS 465


>gi|221211375|ref|ZP_03584354.1| outer membrane protein OprM [Burkholderia multivorans CGD1]
 gi|221168736|gb|EEE01204.1| outer membrane protein OprM [Burkholderia multivorans CGD1]
          Length = 507

 Score =  211 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 110/476 (23%), Positives = 206/476 (43%), Gaps = 29/476 (6%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIG-----------NSKNLINIDT 49
           M           +L AGCT+ P YT+P  P+     S G            S N      
Sbjct: 2   MQKHALTAIAVALLAAGCTLAPHYTRPDAPVAQAFPSGGVYATQPGAAGARSANGQAATA 61

Query: 50  LKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS---- 105
           + W E F D  L +L++IAL+ N  +  +   I AA+      RA LFP+   + +    
Sbjct: 62  IGWREFFVDPRLQRLIEIALKNNRDLRVSVLNIEAARAQYQITRAGLFPTLDGTGTGNIQ 121

Query: 106 -------HRFIPNLKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVI 157
                      P +       L + W++DLFG+ + + + +LA   S       A+++++
Sbjct: 122 RVPQGVSQTGAPYISRVYNVGLSASWELDLFGRVQSLKDQALAQYLSTAYARQAAEISLV 181

Query: 158 SKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIES 217
           S++   Y+      + + +    L   + + +L+ L+F  G  S+L L + +  ++   +
Sbjct: 182 SQVADQYLTLLSTDDLLKVTEDTLKTAQASYDLTKLQFDNGTGSELELRQAQTVVEQALA 241

Query: 218 DIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPD 277
           +     ++    ++ +  L+G P  + L            NL   +  G+P+DL+  RPD
Sbjct: 242 NQQAQARARAQALNALVLLIGEPLPDDLPPGLPLDA---QNLLADVPAGLPSDLLTRRPD 298

Query: 278 IRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPI 334
           I   E+ L  + A IG A++  +P +SL G+           F      WSF P++ +PI
Sbjct: 299 IMQAEQTLLAANANIGAARAAFFPRISLTGAFGTASPTLGGLFKAGTAAWSFAPRITMPI 358

Query: 335 FDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHK 394
           F+ G+  +N+  A    + +   +++ + +A +EV + L +     + +  L+      +
Sbjct: 359 FEGGQNIANLNLANVQKRIEIANYEKAIQSAFREVADGLAARGTYDQQIAALERNTHAQQ 418

Query: 395 KSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +   LS + Y+ G  S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 419 RRFDLSDLRYKNGVDSYLSVLTAQTDLYTAQQALINARLARWTNLVDLYRALGGGW 474


>gi|237747652|ref|ZP_04578132.1| drug efflux lipoprotein [Oxalobacter formigenes OXCC13]
 gi|229379014|gb|EEO29105.1| drug efflux lipoprotein [Oxalobacter formigenes OXCC13]
          Length = 483

 Score =  211 bits (535), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 110/463 (23%), Positives = 212/463 (45%), Gaps = 17/463 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL-INIDTLKWWESFNDT 59
           M     +  L   +L+ C++ P Y +P  P+        +  +    +  + W E F++ 
Sbjct: 1   MIKKLTLVLLAAGVLSSCSMAPNYVRPDAPIESQFPGNADDASAKTPVTQIGWNEFFHEP 60

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKT----- 114
            L  L+  A++ N  +  A  RI  A+       AD  P+  A  +      + T     
Sbjct: 61  RLKALIAAAIENNRDLRVAALRIEEARALYGIQWADRLPNFEAQGAGTRQRTVGTTGGMV 120

Query: 115 ----NSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                + G   + +++D FG+ + + +++LA   +       A ++++S++  +Y+  R 
Sbjct: 121 TQGNYTVGLGLAAFELDFFGRVKSLSDAALAEYLATEEAQRAAYISLVSEVAKTYLTERA 180

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
              +I +A +  + YK++ EL   ++  GA+S L L + E  ++S    + TL++     
Sbjct: 181 QARQIELAKESYESYKRSYELMQKRYEVGASSALELRQYETLMQSALVSLSTLQRQRAQT 240

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            + +  L+G    + +  +    +  + ++   I  G+P+DLI NRPDIR  E+ L  + 
Sbjct: 241 ENALVVLIG---GKQIKDLPAAHDLSEDDIMQDIPAGLPSDLINNRPDIRQYEQLLKSAN 297

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           A IG A++  +P ++L G            F   +  W+F P+L LPIFD G+  SN+  
Sbjct: 298 ANIGAARAAFFPRITLTGFAGTASPTLSGLFDAGSGAWTFMPQLTLPIFDAGRNISNLDL 357

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
           AE+        +++TV  A +EV +AL + +   + V      ++   + + LS   Y  
Sbjct: 358 AEARKNIAVAQYEKTVQVAFREVADALMARDWLNEQVKAQAAVLKSETERLKLSEARYNN 417

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           G  S L++ D +R     +  L  A+     + V+LY ++G G
Sbjct: 418 GIASSLEVFDSQRQQFAAQQSLVDARLLRLINTVELYRSLGGG 460


>gi|209520689|ref|ZP_03269440.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. H160]
 gi|209498889|gb|EDZ98993.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. H160]
          Length = 504

 Score =  211 bits (535), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 108/459 (23%), Positives = 207/459 (45%), Gaps = 28/459 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQ-----------FSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
           GCT+ P Y +P  P+  T             + G S +      + W   F D  L +L+
Sbjct: 17  GCTLAPHYERPAAPVTATFPTGGVYDQQPGATGGRSASGQAAADIGWRNFFVDPRLQQLI 76

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL----------KTN 115
           +IAL+ N  +  +   + A+      VRA LFP+  A+ S                    
Sbjct: 77  EIALKNNRDLRVSVLNMQASAAQYRIVRAGLFPTLNAAASQSRSRTPKDLTATGITITNT 136

Query: 116 STGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
            +  L++ W+ID FG+ + + + +LA           A+++++S++   Y+      + +
Sbjct: 137 YSVGLNASWEIDFFGRVQSLKDQALATYLGTAQARKAAEISLVSQVANQYMTVLELDDLL 196

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
            +    L   +++  ++ L+F  G  S+L L + +  +++  +++ +  +      + + 
Sbjct: 197 KVTQNTLVTAQESYRITKLQFDNGTGSELDLRQSQTVVETASANLQSQMRLRAQADNALV 256

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
            L+G P    L      S+    +L   I  G+P+DL+  RPDI   E+ L  + A IG 
Sbjct: 257 LLIGEPLPADLSPGLPLSD---QSLLTDIPAGLPSDLLTRRPDIMEAEENLLAANANIGA 313

Query: 295 AKSDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           A++  +P ++L GS    + T    F   +  WSF P + LPIF+ G+  +N+  A    
Sbjct: 314 ARAAFFPKVTLTGSAGTLSPTLGGLFKPGSAAWSFAPSITLPIFEGGQNIANLNLANIEK 373

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
             Q  T+++ +  A +EV + L +     + +  L+  V   ++ + LS + Y+ G  S 
Sbjct: 374 NVQIATYEKAIQTAFREVADGLAARGTYDEQIAALERDVAAEQRRLDLSTLRYKNGVDSY 433

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           L +L  + A    +  L  A+ +  ++ V LY A+G G+
Sbjct: 434 LSVLTAQTALYVAQQALVTARMERLQNLVTLYQALGGGW 472


>gi|118578771|ref|YP_900021.1| RND efflux system outer membrane lipoprotein [Pelobacter
           propionicus DSM 2379]
 gi|118501481|gb|ABK97963.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Pelobacter propionicus DSM 2379]
          Length = 474

 Score =  210 bits (534), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 112/460 (24%), Positives = 206/460 (44%), Gaps = 26/460 (5%)

Query: 12  IVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINID------TLKWWESFNDTSLNKLV 65
           ++ LAGC++ P YT+P  P+     S    K   +         LKW + F +  L KL+
Sbjct: 17  LLFLAGCSMAPNYTRPEAPVPQAWPSGPAYKGAASQALEPEAVQLKWEQFFINPQLRKLI 76

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL----- 120
           K+AL  N  +  AT  +  ++      RADL PS   + +          S+        
Sbjct: 77  KLALDNNRDLRIATLNVEKSRAQYRIQRADLLPSINGNGNATMERTPSDLSSSGEAITSH 136

Query: 121 -------DSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                   S +++DLFG+ + + + +L    S    V   +L++++++  +Y+     +E
Sbjct: 137 SYTLNLGVSSYEVDLFGRVQSLKDQALEQFLSTEQAVRSVRLSLVAEVANNYLTLAADRE 196

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
           R+ +A + L+  + +  L   +F+ GA+S+L L + +  + S   D+         + + 
Sbjct: 197 RLKLARETLESQRVSYNLIKSRFSAGASSELDLRQAQTSVDSARVDVARYTSQVAQDENL 256

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           ++ ++G P    L     ++      L      G+P+++++ RPDI   E  L  + A I
Sbjct: 257 LALVVGGPVPAELLPSGFEAAGMMRELSS----GVPSEVLQRRPDIMEAEHLLKGANANI 312

Query: 293 GIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P ++LN SI  + D     F   +  W F P+  LPIFD G+ K+ +  AE 
Sbjct: 313 GAARAAFFPRITLNTSIGTSSDQLSGLFSPGSFAWGFAPQFTLPIFDFGRNKAGLTVAER 372

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
                   +++++ +A +EV +AL       + +   Q  V+   +S  LS   Y  G  
Sbjct: 373 DRDIYLAQYEKSIQSAFREVADALAVNGTITEQLDAQQSLVQATSESYRLSQARYMGGIS 432

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           S LD+L  +R+    +  L         + V LY  +G G
Sbjct: 433 SYLDVLVSQRSLYTTQQSLIGVNLTKLSNLVTLYKVLGGG 472


>gi|53804056|ref|YP_114045.1| multidrug efflux system outer membrane subunit [Methylococcus
           capsulatus str. Bath]
 gi|53757817|gb|AAU92108.1| multidrug efflux system outer membrane subunit [Methylococcus
           capsulatus str. Bath]
          Length = 520

 Score =  210 bits (534), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 132/473 (27%), Positives = 228/473 (48%), Gaps = 27/473 (5%)

Query: 2   NILRAIFSLFIVLLAGCT-VGPEYTKPHMPLLPTQFSIGNSKNLINIDT--LKWWESFND 58
            ILR   SL   +   C+ VGP+Y +P    +P ++           +T    WW++F D
Sbjct: 37  RILRLFASLLGAVFTACSPVGPDYRRPDT-TMPERWHEAEPPPAAPSETVGADWWKAFGD 95

Query: 59  TSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS-- 116
             LN+L++ A+  NL + Q   RI AA+E  +   A+  P      S     N    S  
Sbjct: 96  PVLNRLIREAMVANLDLKQTYTRIRAAREQRIVAIANGLPIVSNKESVSRRLNNAGQSGA 155

Query: 117 ----------------TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISK 159
                               D  W+IDLFG  RR IE++ ANL++         + ++  
Sbjct: 156 GGQPGGVGFGNNIDIFQLGFDVQWEIDLFGGIRRSIEAAEANLEAEVENSRAVLVTLLGD 215

Query: 160 LIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDI 219
           +  +YI+ R  +  ++++   L L  +   L  +++  G +  L  V+ EA     ++ +
Sbjct: 216 VARAYIEMRSNQHLLNVSQANLKLQLETARLMRIRYQAGLSDSLEAVQAEALAAQTQAQL 275

Query: 220 PTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIR 279
           P  E + +  +H +  LLG P       +  +     P+    I + +P++L+R RPDIR
Sbjct: 276 PVYETARKQAMHQLELLLGKPPGALQTLLDPE--QPVPSAPDRILLDLPSELLRRRPDIR 333

Query: 280 YQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGY--NTHWSFGPKLYLPIFDK 337
             E++LA + A++G+A +DLYP  ++   +   +         +  WS    L  PIF+ 
Sbjct: 334 LAERQLAAATAQVGVATADLYPKFNIAAFLGFQNMKITDVTALSKSWSAAGTLTTPIFNW 393

Query: 338 GKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSM 397
           G+I++NI   ++  ++ ++ +Q  VL A+K+VEN+L +  ++K     L+ AVE ++ ++
Sbjct: 394 GRIRANIDAKKAQQEQSFLAYQSAVLGALKDVENSLVAYAQEKDRRAALEQAVESNRLAL 453

Query: 398 SLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            LS   YR G  S L++LD ERA    E DL  ++  +A   V LY A+G G+
Sbjct: 454 KLSKERYRSGLTSFLNVLDSERAVYSAESDLVRSQASVAADLVSLYKALGGGW 506


>gi|161523870|ref|YP_001578882.1| RND efflux system outer membrane lipoprotein [Burkholderia
           multivorans ATCC 17616]
 gi|189351369|ref|YP_001946997.1| RND efflux system outer membrane lipoprotein [Burkholderia
           multivorans ATCC 17616]
 gi|160341299|gb|ABX14385.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia multivorans ATCC 17616]
 gi|189335391|dbj|BAG44461.1| RND efflux system outer membrane lipoprotein [Burkholderia
           multivorans ATCC 17616]
          Length = 507

 Score =  210 bits (534), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 110/476 (23%), Positives = 206/476 (43%), Gaps = 29/476 (6%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIG-----------NSKNLINIDT 49
           M           +L AGCT+ P YT+P  P+     S G            S N      
Sbjct: 2   MQKHALTAIAVALLAAGCTLAPHYTRPDAPVAQAFPSGGVYATQPGAAGARSANGQAATA 61

Query: 50  LKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS---- 105
           + W E F D  L +L++IAL+ N  +  +   I AA+      RA LFP+   + +    
Sbjct: 62  IGWREFFVDPRLQRLIEIALKNNRDLRVSVLNIEAARAQYQITRAGLFPTLDGTGTGNIQ 121

Query: 106 -------HRFIPNLKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVI 157
                      P +       L + W++DLFG+ + + + +LA   S       A+++++
Sbjct: 122 RVPQGVSQTGAPYISRVYNVGLSASWELDLFGRVQSLKDQALAQYLSTAYARQAAEISLV 181

Query: 158 SKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIES 217
           S++   Y+      + + +    L   + + +L+ L+F  G  S+L L + +  ++   +
Sbjct: 182 SQVADQYLTLLSTDDLLKVTEDTLKTAQASYDLTKLQFDNGTGSELELRQAQTVVEQALA 241

Query: 218 DIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPD 277
           +     ++    ++ +  L+G P  + L            NL   +  G+P+DL+  RPD
Sbjct: 242 NQQAQARARAQALNALVLLIGEPLPDDLPPGLPLDA---QNLLADVPAGLPSDLLTRRPD 298

Query: 278 IRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPI 334
           I   E+ L  + A IG A++  +P +SL G+           F      WSF P++ +PI
Sbjct: 299 IMQAEQTLLAANANIGAARAAFFPRISLTGAFGTASPTLGGLFKAGTAAWSFAPQITMPI 358

Query: 335 FDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHK 394
           F+ G+  +N+  A    + +   +++ + +A +EV + L +     + +  L+      +
Sbjct: 359 FEGGQNIANLNLANVQKRIEIANYEKAIQSAFREVADGLAARGTYDQQIAALERNTHAQQ 418

Query: 395 KSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +   LS + Y+ G  S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 419 RRFDLSDLRYKNGVDSYLSVLTAQTDLYTAQQALINARLARWTNLVDLYRALGGGW 474


>gi|302038779|ref|YP_003799101.1| RND efflux system, outer membrane factor lipoprotein [Candidatus
           Nitrospira defluvii]
 gi|300606843|emb|CBK43176.1| RND efflux system, outer membrane factor lipoprotein [Candidatus
           Nitrospira defluvii]
          Length = 481

 Score =  210 bits (534), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 102/466 (21%), Positives = 213/466 (45%), Gaps = 20/466 (4%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M +L  + S   VLL  C +GP+Y++P + +          +   +   L WW+   D  
Sbjct: 1   MRMLALLIS--SVLLGACAIGPDYSRPDLAVPDRFRMAATQQETESFANLPWWDLLQDEQ 58

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTN----- 115
           L +L+++AL +N  + +A   +   +  +L  + D  P +  + +               
Sbjct: 59  LRRLIRVALAENKDLKRAVASVEDFQARMLIAKMDFAPKADLTSNAPLFGRKANFLFPGF 118

Query: 116 -----STGQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                   Q +  W+ID++G+ R    ++  +L S         L ++S +  +Y D   
Sbjct: 119 PNPFNYYLQGNLSWEIDIWGRIRRSNEAARGDLLSREEARRAVVLQLVSGVAEAYFDMLQ 178

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
           F  ++++A + L  + +++ ++  +  +G  SK+   +  AE  +  +    L +     
Sbjct: 179 FDMQLAVAQRTLKSWDESVRIAEARLREGMISKIDADQFAAERANAAARAAELSRQMVQK 238

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            + +S LLG    +    + +  +     +   +  G+P++L++ RPD+   E++LA + 
Sbjct: 239 ENQLSVLLGRVPGQ----IPRGRSLTDQVMPPEVPAGLPSELLQRRPDLVQAEQELAAAT 294

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHDNSFP---GYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           A+IG+AK+D +P LS+ G + +                  GP L  P+ +   +      
Sbjct: 295 ARIGVAKADRFPKLSITGILGVASPQLSRLVANETAFGVAGPGLTGPLLNAQILGFQQDA 354

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
           AE+ ++E    +++++L A +EVE+AL ++   ++  T     V+  + ++ L+ + Y+ 
Sbjct: 355 AEAQSREALARYEQSLLVAFREVEDALVAVRTVREQRTAQVEQVDALRSALRLANLRYKG 414

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           G  + LD+L  +R     E+ L+   R    S V LY A+G G++P
Sbjct: 415 GLANYLDVLVAQRNLFDAELALTSTHRLQLVSVVQLYKALGGGWSP 460


>gi|91785070|ref|YP_560276.1| RND efflux system outer membrane lipoprotein [Burkholderia
           xenovorans LB400]
 gi|91689024|gb|ABE32224.1| RND efflux system, outer membrane lipoprotein, NodT subfamily
           [Burkholderia xenovorans LB400]
          Length = 515

 Score =  210 bits (534), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 107/486 (22%), Positives = 207/486 (42%), Gaps = 39/486 (8%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLL----------------------PTQFSI 38
           M     I     +  AGCT+ P+Y +P  P+                       P     
Sbjct: 1   MQKHSLIAVAVALFAAGCTMAPKYERPAAPVTATFPTGGVYDTQPGATQPGQQQPGTTGA 60

Query: 39  GNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFP 98
             + +      + W + F D  + +L++IAL+ N  +  +   + A+      VRA L P
Sbjct: 61  ARTASGQAAADIGWRDFFVDPRMQRLIEIALKNNRDLRVSVLNMQASAAQFRIVRAGLLP 120

Query: 99  SSYASISHRFIPNL----------KTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYA 147
           +  AS S                   + +  L++ W+ID FG+ + + + +LA   +   
Sbjct: 121 TLDASASQTKQRTPKDLSFFDQTISNSYSVGLNASWEIDFFGRIQSLKDQALAQYLATAQ 180

Query: 148 QVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVK 207
               A++ ++S++   Y+      + + +    L   +++  ++ L+F  G  S+L L +
Sbjct: 181 ARKAAEITLVSQVANQYMTVLELDDLLKVTENTLKTSQESYRIAKLQFDNGTGSELDLRQ 240

Query: 208 LEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGI 267
            +  ++   +++   ++      + +  LLG P  +    +         NL   I  G+
Sbjct: 241 SQTVVEQALANLQQQQRLRAQADNALVLLLGEPLPDD---LPPGMTLDNQNLLTDIPAGL 297

Query: 268 PADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHW 324
           P+DL+  RPDI   E+ L  + A IG A++  +P +SL GS      +    F   +  W
Sbjct: 298 PSDLLTRRPDIMEAEENLLAANANIGAARAAFFPKVSLTGSFGTLSPSLGGLFKPGSAAW 357

Query: 325 SFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVT 384
           SF P + LPIF+ G+  +N+  A    + Q  T+++ +  A +EV +AL +     + + 
Sbjct: 358 SFAPSITLPIFEGGQNLANLDLANIQKKVQIATYEKAIQTAFREVADALAARGTYDQQIQ 417

Query: 385 KLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYI 444
            L+      ++ + LS + Y  G  S L +L  +      +  L  A+ +  ++ V LY 
Sbjct: 418 ALERNTFAEQRRLDLSNLRYTNGVDSYLSVLTAQTDLYSSQQLLVTARMERLQNLVTLYQ 477

Query: 445 AIGSGY 450
           A+G G+
Sbjct: 478 ALGGGW 483


>gi|187734619|ref|YP_001876731.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Akkermansia muciniphila ATCC BAA-835]
 gi|187424671|gb|ACD03950.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Akkermansia muciniphila ATCC BAA-835]
          Length = 457

 Score =  210 bits (534), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 121/458 (26%), Positives = 219/458 (47%), Gaps = 14/458 (3%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLN 62
             + +  L    L  C VGP++  P    LP  +      +  + D   WW  F D  LN
Sbjct: 4   TFKHLPLLAACFLGSCMVGPDFRTP-TNDLPATWEANRPPHSSDKDLRSWWNIFGDPQLN 62

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLD- 121
           +LV  +L  N  +  A  RI  A+E +   +A L PS+ AS      P+    S+   + 
Sbjct: 63  RLVSTSLNNNPDMKVALLRIREAREKLRVSQASLLPSADASAGWSLSPDRGFRSSTSQNF 122

Query: 122 -----SDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERIS 175
                + W++DLFG  R  IE+S A+L S  A     +  +++ +  +Y D     E++ 
Sbjct: 123 SLGASTSWELDLFGGNRRSIEASRASLMSTEASAGAVRTALLADVATAYFDWITACEQLR 182

Query: 176 IAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIST 235
           IA + L++ +  + ++  ++      +L + +  + + S ES IP LE     + + ++ 
Sbjct: 183 IAREQLEIQRSTLTIAEKRYKTEFAPRLDVEQATSTVASTESRIPQLEAQVASSKNQLAV 242

Query: 236 LLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIA 295
           LLG   +     + K S   +      + +G+P++L+R RPD+   E  L  +VA +G+A
Sbjct: 243 LLGTYNSRVELTLPKASVFEK---TPTVPVGLPSELLRRRPDVIAAEADLHAAVANVGVA 299

Query: 296 KSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQ 352
            +DLYP  SL GS++    +    F   N  WS G  L  P+F  G +++ +R  +++A+
Sbjct: 300 VADLYPRFSLTGSLSSRGGDFGQLFRENNNAWSLGGNLLQPLFRGGALRATVRAQKAAAE 359

Query: 353 EQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLL 412
           +   T+++T++ A+ EVE+AL +       +  L      ++++  LS   Y  G    L
Sbjct: 360 QAAETYRKTLITAVSEVEDALIAYGSYTSQMQYLHKENNANREAFQLSRTLYINGETDFL 419

Query: 413 DILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +++  +R+    E  L   K+ + K+ V L  A+G G+
Sbjct: 420 NVITAQRSWLSSEESLVTMKQNIRKAVVQLARALGGGW 457


>gi|172061568|ref|YP_001809220.1| RND efflux system outer membrane lipoprotein [Burkholderia
           ambifaria MC40-6]
 gi|171994085|gb|ACB65004.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia ambifaria MC40-6]
          Length = 507

 Score =  210 bits (534), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 110/477 (23%), Positives = 208/477 (43%), Gaps = 30/477 (6%)

Query: 1   MNILRAIFSLFIVLLA-GCTVGPEYTKPHMPLLPTQ-----------FSIGNSKNLINID 48
           M    A+ ++ + LLA GCT+ P Y +P  P+                +   S N     
Sbjct: 1   MMQKHALTAIAVALLATGCTMAPHYKRPDAPVAQAYPADGVYATQPGAAGARSANGQAAT 60

Query: 49  TLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS--- 105
            + W E F D  L +L++IAL+ N  +  A   I AA+      RA LFP+   + +   
Sbjct: 61  AIGWREFFVDPRLQRLIEIALKNNRDLRVAVLNIEAARAQYQITRAGLFPTLDGTGTGSI 120

Query: 106 --------HRFIPNLKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNV 156
                       P +       L + W++DLFG+ + + + +LA   S        ++++
Sbjct: 121 QRVPQGLSQTGAPYISRAYNVGLSASWELDLFGRVQSLKDQALAQYLSTSYARQATEISL 180

Query: 157 ISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE 216
           +S++   Y+      + + +    L   + + +L+ L+F  G  S+L L + +  ++   
Sbjct: 181 VSQVADQYLTLLSTDDLLKVTENTLKTAQASYDLTKLQFDNGTGSELELRQAQTVVEQAL 240

Query: 217 SDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRP 276
           S+     ++    ++ +  L+G P  + L            NL   +  G+P+DL+  RP
Sbjct: 241 SNQQAQARARAQALNALVLLIGEPLPDDLPAGMPLDA---QNLLTDVPAGLPSDLLTRRP 297

Query: 277 DIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLP 333
           D+   E+ L  + A IG A++  +P +SL G+           F      WSF P++ +P
Sbjct: 298 DVMQAEQTLLAANANIGAARAAFFPRISLTGAFGTGSPTLGGLFKAGTAAWSFAPQITMP 357

Query: 334 IFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELH 393
           IF+ G+  +N+  A    + +   +++ + +A +EV + L +     + +  LQ      
Sbjct: 358 IFEGGQNIANLNLANVQKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALQRNEHAQ 417

Query: 394 KKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           ++   LS + Y+ G  S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 418 QRRFDLSDLRYKNGVDSYLSVLTAQTDLYTAQQSLINARLARWTNLVDLYRALGGGW 474


>gi|83747152|ref|ZP_00944195.1| Drug efflux lipoprotein (FUSA/NODT family) [Ralstonia solanacearum
           UW551]
 gi|207741903|ref|YP_002258295.1| drug efflux lipoprotein [Ralstonia solanacearum IPO1609]
 gi|83726127|gb|EAP73262.1| Drug efflux lipoprotein (FUSA/NODT family) [Ralstonia solanacearum
           UW551]
 gi|206593289|emb|CAQ60216.1| drug efflux lipoprotein [Ralstonia solanacearum IPO1609]
          Length = 514

 Score =  210 bits (534), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 114/462 (24%), Positives = 207/462 (44%), Gaps = 29/462 (6%)

Query: 14  LLAGCTVGPEYTKPHMPLLPTQFSIGNS-----------KNLINIDTLKWWESFNDTSLN 62
           +L+GC++ P Y +P  P+                     +N      L W E F D  L 
Sbjct: 22  VLSGCSLAPRYERPDAPVAGDYPQAPAGYAVPADTAKPGENAPRATDLGWREFFPDPRLQ 81

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLD- 121
           KL+ +AL+ N  +  A   I AA+       ADL P+  AS ++      ++ S    D 
Sbjct: 82  KLIGLALENNRDLRVAVLNIEAARAQYRLQIADLLPAVNASATYTRSLTPQSISQTGQDI 141

Query: 122 -----------SDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                      S ++++LF       S+ A+  +        ++++IS++  +Y++ R +
Sbjct: 142 NTKQYQLGVGISSYQVNLFSVGDVTSSARASYLATEEGQRATQISLISQVAKAYLNERAY 201

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
            E++ +A Q L   +   +L+  +F  GA+S L L + E  ++S    +  L + +    
Sbjct: 202 AEQLELAQQTLKGREDYYKLAKQRFDVGASSALDLRQNETLVESARVSVAQLTRQYAQAT 261

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  L+  P    L      S+     +   I  G+P+DL+  RPDIR  E+KL  + A
Sbjct: 262 NALVLLVSAPLPADLPAPTTVSSE---KIVADIPPGLPSDLLIQRPDIRQAEQKLIAANA 318

Query: 291 KIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG+A++  +PS+ L  ++        + F      WSF P   LPIF+ G    N+   
Sbjct: 319 NIGVARAAFFPSIGLTSNVGTASTALHDLFKSGTGLWSFVPNATLPIFNWGTNLFNLDLT 378

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           +++ +     +++T+  A +EV +AL +    ++ V   +   +   + ++LS   YR G
Sbjct: 379 KANQKIALANYEKTIQTAFQEVSDALVARGTLEEQVAAQKRFRDATAERLTLSDQRYRNG 438

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
             S LD+LD +R     +  L   +     + +DLY A+G G
Sbjct: 439 VSSFLDVLDAQRDLFSADQTLVQTRLARLTNAIDLYTALGGG 480


>gi|313202328|ref|YP_004040986.1| NodT family RND efflux system outer membrane lipoprotein
           [Methylovorus sp. MP688]
 gi|312441644|gb|ADQ85750.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Methylovorus sp. MP688]
          Length = 467

 Score =  210 bits (534), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 109/468 (23%), Positives = 212/468 (45%), Gaps = 22/468 (4%)

Query: 1   MNILRAIFSLFIVLLAGCT-VGPEYTKPHMPLLPTQFSIGNS--KNLINIDTLKWWESFN 57
           MN       +  ++LAGC  + P+Y +P  P+     +  ++  K       L W + F 
Sbjct: 1   MNKYSYPLGIAALMLAGCMNMQPKYERPAAPIPAQWPATADAVQKQATAPAVLGWEQFFT 60

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST 117
           D  L KL++ AL+ N  +  +T  I  A+      RADLFP   A+ S          ST
Sbjct: 61  DPDLKKLIRQALENNRDLRVSTLNIEKARAQYQIQRADLFPKINATGSGSNQRTPAAAST 120

Query: 118 GQL------------DSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSY 164
                           S +++D FG+ R +         S       A++ +++++  +Y
Sbjct: 121 TGTTLLTHQYSANLGFSSYELDFFGRVRSLRDQAVYQYLSTEEAKRSAQITLVAEVANAY 180

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           +      E + +A Q L   +++ +++  +   G+ ++L+L + E  ++S  +D+     
Sbjct: 181 LTMVADMESLELARQTLRTQRESYDMTKRQLEFGSVTELTLRQAETSVESARADVAKYMT 240

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
               + + +  L+G      L  M+      Q  +      G+P+ +++NRPD+   E+ 
Sbjct: 241 QVDQDRNALVLLVGTAPEVNLDEMRSLKAVSQTAILPD---GLPSTVLQNRPDVLEAERD 297

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIK 341
           L    A IG A++  +P++SL  S  +  +   + F G N  WSF P++ LPIF+ G  K
Sbjct: 298 LQGYNANIGAARAAFFPTISLTASAGVASNELGSLFNGSNRAWSFAPQIVLPIFNAGLNK 357

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           +N++ AE +       +++ +  A KEV ++L      ++ ++     V   ++S +LS 
Sbjct: 358 ANLKVAEVNRDISVAQYEKAIQTAFKEVSDSLAQRATLEEQLSAQTALVNATERSFTLSR 417

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           + + +G  + L +LD +R+    + +L   +     + V LY  +G G
Sbjct: 418 LRFEKGLDNYLTVLDAQRSYYSAQQNLITVRLSDVSNQVTLYKVLGGG 465


>gi|332524604|ref|ZP_08400807.1| RND efflux system outer membrane lipoprotein [Rubrivivax
           benzoatilyticus JA2]
 gi|332107916|gb|EGJ09140.1| RND efflux system outer membrane lipoprotein [Rubrivivax
           benzoatilyticus JA2]
          Length = 477

 Score =  210 bits (534), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 113/460 (24%), Positives = 210/460 (45%), Gaps = 14/460 (3%)

Query: 2   NILRAIFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIG--NSKNLINIDTLKWWESFND 58
            I   +  +   +LAGC T+ P+Y +P  P+       G   +   +    L W + F D
Sbjct: 5   RIFPGLTLVAAAVLAGCGTLAPDYQRPAAPVAGAFPEAGGTTAPGAVAAADLPWQQFFRD 64

Query: 59  TSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF----IPNLKT 114
             L +LV IAL  N  +  A   I  A+      RADLFP+    +S            T
Sbjct: 65  ERLKRLVGIALANNRDLRVAVLNIEQARAQYGVQRADLFPTLGVGVSGNRVSTDSGINST 124

Query: 115 NSTGQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
              G   S +++DLFG+ R +  ++LA+  +        ++ +I+ +   Y+  +   E 
Sbjct: 125 YQAGLAVSSYELDLFGRVRSLNNAALASYLATEEARKAVQIGLIASVANGYLALQADDEL 184

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
           + +  + L    ++++L+ L+F  GA+S+L L + ++  ++  +    L +    + + +
Sbjct: 185 LRVTRETLATRAESLKLTQLRFDVGASSQLDLRQAQSLYEAARATHAQLLRQRAQDENAL 244

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
             LLG P    L      S          +  G+P+ ++  RPD+   E++L  + A+IG
Sbjct: 245 VLLLGQPLPGDLPAALPLSEQA---ALPELPAGLPSQVLTRRPDVLQAEQQLIAANARIG 301

Query: 294 IAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESS 350
            A++  +P ++L  +           F G +T W+F P+L +PIFD G+ ++N+  A + 
Sbjct: 302 AARAAFFPQITLTATAGSASSELSGLFKGGSTGWTFAPQLLMPIFDAGRNRANLDSANAG 361

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
                  + + V  A +EV +AL       + +  LQ  V+  +  + L+ + YR G  S
Sbjct: 362 RDIAVAQYDKAVQAAFREVADALAGRATLGEQLAALQAQVKAEQGRVELAELRYRNGAAS 421

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            LD+LD +R+    +      +   A++ V LY  +G G+
Sbjct: 422 YLDLLDAQRSLFAAQQSEVQVRALQAQNLVTLYRVLGGGW 461


>gi|226941844|ref|YP_002796918.1| OprM [Laribacter hongkongensis HLHK9]
 gi|226716771|gb|ACO75909.1| OprM [Laribacter hongkongensis HLHK9]
          Length = 481

 Score =  210 bits (534), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 124/468 (26%), Positives = 224/468 (47%), Gaps = 19/468 (4%)

Query: 1   MNILRAIFSLFIVLL-AGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDT 59
           M    AI  + + LL  GC +GP+Y +P M L  +  +   S  L    +  WW  FND 
Sbjct: 2   MRRHFAIAPVALALLMTGCAIGPDYQRPVMELPDSYGTPAGSPEL--RISRDWWTQFNDP 59

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQ 119
           +LN L   AL  N  +  A  RI  A+  + S  ADL P   A        N   +ST  
Sbjct: 60  ALNALEDRALNYNRDLAAAVARIEQAQAQLTSATADLLPQLNAGADATRGRNSLYSSTTG 119

Query: 120 LD-----------SDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
            +           + +++DL+G+ RR+ E++LA+L ++ A  D   L+V S +  +Y   
Sbjct: 120 TNPVMDSYQASLAASFELDLWGKLRRNREAALASLRASEAARDTVALSVTSSVADAYFQL 179

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
           R + E++ I+ + L   ++ +++   ++  G  S+L   + EAE  +    +P  E++  
Sbjct: 180 RTYDEQLDISRRTLKSREEALQIYAKRYHGGLISELDYRQAEAETATARVAVPRYEQAVS 239

Query: 228 MNVHNISTLLGYPATEFLHY-MQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLA 286
                +  L+G    E     + +     +  +   +  G P+ L+  RPD+   E++L 
Sbjct: 240 QAETALKVLVGANPREVFEAEVPRGEELSRIVVPPVLPDGTPSTLLLARPDLVSAEQQLV 299

Query: 287 DSVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSN 343
            + A+IG+A++  +PS+SL G++          F G    W++G  L +PIF+ GK  + 
Sbjct: 300 AANARIGVARAAYFPSISLTGAVGSASLALGELFTGPAALWNYGGALAMPIFNWGKTGAG 359

Query: 344 IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
           ++ A +  +E    ++  V NA ++  +ALT+  +  + +      V   +++  L+ + 
Sbjct: 360 VKAATAQQKEALANYELAVQNAFRDTRDALTAQQKSAEQLAAQDTQVNALQRTAHLARLR 419

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           Y  G  S LD+LD ER+    E+D + A+     + V +Y A+G GY+
Sbjct: 420 YENGYSSYLDVLDAERSLFSSELDRANARLARLNAAVSVYRALGGGYD 467


>gi|221200195|ref|ZP_03573238.1| outer membrane protein OprM [Burkholderia multivorans CGD2M]
 gi|221206652|ref|ZP_03579664.1| outer membrane protein OprM [Burkholderia multivorans CGD2]
 gi|221173307|gb|EEE05742.1| outer membrane protein OprM [Burkholderia multivorans CGD2]
 gi|221180434|gb|EEE12838.1| outer membrane protein OprM [Burkholderia multivorans CGD2M]
          Length = 507

 Score =  210 bits (533), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 110/476 (23%), Positives = 206/476 (43%), Gaps = 29/476 (6%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIG-----------NSKNLINIDT 49
           M           +L AGCT+ P YT+P  P+     S G            S N      
Sbjct: 2   MQKHALTAIAVALLAAGCTLAPHYTRPDAPVAQAFPSGGVYATQPGAAGARSANGQAATA 61

Query: 50  LKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS---- 105
           + W E F D  L +L++IAL+ N  +  +   I AA+      RA LFP+   + +    
Sbjct: 62  IGWREFFVDPRLQRLIEIALKNNRDLRVSVLNIEAARAQYQITRAGLFPTLDGTGTGNIQ 121

Query: 106 -------HRFIPNLKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVI 157
                      P +       L + W++DLFG+ + + + +LA   S       A+++++
Sbjct: 122 RTPQGVSQTGAPYISRVYNVGLSASWELDLFGRVQSLKDQALAQYLSTAYARQAAEISLV 181

Query: 158 SKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIES 217
           S++   Y+      + + +    L   + + +L+ L+F  G  S+L L + +  ++   +
Sbjct: 182 SQVADQYLTLLSTDDLLKVTEDTLKTAQASYDLTKLQFDNGTGSELELRQAQTVVEQALA 241

Query: 218 DIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPD 277
           +     ++    ++ +  L+G P  + L            NL   +  G+P+DL+  RPD
Sbjct: 242 NQQAQARARAQALNALVLLIGEPLPDDLPPGLPLDA---QNLLADVPAGLPSDLLTRRPD 298

Query: 278 IRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPI 334
           I   E+ L  + A IG A++  +P +SL G+           F      WSF P++ +PI
Sbjct: 299 IMQAEQTLLAANANIGAARAAFFPRISLTGAFGTASPTLGGLFKAGTAAWSFAPQITMPI 358

Query: 335 FDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHK 394
           F+ G+  +N+  A    + +   +++ + +A +EV + L +     + +  L+      +
Sbjct: 359 FEGGQNIANLNLANVQKRIEIANYEKAIQSAFREVADGLAARGTYDQQIAALERNTHAQQ 418

Query: 395 KSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +   LS + Y+ G  S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 419 RRFDLSDLRYKNGVDSYLSVLTAQTDLYTAQQALINARLARWTNLVDLYRALGGGW 474


>gi|107023544|ref|YP_621871.1| RND efflux system, outer membrane lipoprotein, NodT [Burkholderia
           cenocepacia AU 1054]
 gi|116690627|ref|YP_836250.1| RND efflux system outer membrane lipoprotein [Burkholderia
           cenocepacia HI2424]
 gi|105893733|gb|ABF76898.1| RND efflux system, outer membrane lipoprotein, NodT [Burkholderia
           cenocepacia AU 1054]
 gi|116648716|gb|ABK09357.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia cenocepacia HI2424]
          Length = 507

 Score =  210 bits (533), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 107/476 (22%), Positives = 203/476 (42%), Gaps = 29/476 (6%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIG-----------NSKNLINIDT 49
           M           +   GCT+ P Y +P  P+     + G            S N      
Sbjct: 2   MQKHALTAIAVALFATGCTMAPHYKRPDAPVAQAYPAGGVYATQPGAAGARSANGQAATA 61

Query: 50  LKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFP----------- 98
           + W E F D  L +L++IAL+ N  +  +   I AA+      RA LFP           
Sbjct: 62  IGWREFFVDPRLQRLIEIALKNNRDLRVSVLNIEAARAQYQITRAGLFPTLDGTGTGNIQ 121

Query: 99  SSYASISHRFIPNLKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVI 157
              A +S    P +       L + W++DLFG+ + + + +LA   S       ++++++
Sbjct: 122 RLPAGVSTTRAPLISRTYNVGLSASWELDLFGRVQSLKDQALAQYLSTAYARQASEISLV 181

Query: 158 SKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIES 217
           S++   Y+      + + +    L   + + +L+ L+F  G  S+L L + +  +++  +
Sbjct: 182 SQVADQYLTLLSTDDLLKVTEDTLKTAQASYDLTKLQFDNGTGSELELRQAQTVVETALA 241

Query: 218 DIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPD 277
           +     ++    ++ +  L+G P  + L            NL   +  G+P+DL+  RPD
Sbjct: 242 NQQAQARARAQALNALVLLIGEPLPDDLPAGMPLDA---QNLLTDVPAGLPSDLLTRRPD 298

Query: 278 IRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPI 334
           +   E+ L  + A IG A++  +P +SL G+           F      WSF P + LPI
Sbjct: 299 VMQAEQTLLAANANIGAARAAFFPKISLTGAFGTASPTLGGLFKAGTAAWSFAPSIALPI 358

Query: 335 FDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHK 394
           F+ G+  +N+  A    + +   +++ + +A +EV + L +     + +  L+      +
Sbjct: 359 FEGGQNIANLDLAHVQKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQ 418

Query: 395 KSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +   LS + Y+ G  S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 419 RRFDLSDLRYKNGVDSYLSVLTAQTDLYSAQQSLISARLARWTNLVDLYRALGGGW 474


>gi|222056600|ref|YP_002538962.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Geobacter sp. FRC-32]
 gi|221565889|gb|ACM21861.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Geobacter sp. FRC-32]
          Length = 504

 Score =  210 bits (533), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 119/467 (25%), Positives = 223/467 (47%), Gaps = 19/467 (4%)

Query: 3   ILRAIFSLFIVLLAGC-TVGPEYTKPHMPLLPTQ----FSIGNSKNLINIDTLKWWESFN 57
           ++R +  +  + LAGC TVGP+Y KP + +         +   +K     D  +WW + N
Sbjct: 28  LVRWLIIIATLALAGCVTVGPDYVKPELDVPANWNRLDQANSETKAAATGDLSRWWLALN 87

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST 117
           D  L+ L+  ALQ +  +  A  R+  A+       A L+P+  AS S R   + +    
Sbjct: 88  DPLLSGLIDDALQASPDLRSAKARLREARARGAVASAGLYPAVTASGSARRNRSSEELGG 147

Query: 118 GQLDSDWKIDLFGQR---------RHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
           G   + ++ D   Q          R IE++ A+++S+ A ++  +++++++   +Y++ R
Sbjct: 148 GSTQNLFRADFDAQWELDLFGGVRRGIEATRADVESSVASLENTRVSLVAETAQNYVEVR 207

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
             + R+ IA   L    + ++L+  +   G  S   + +  +  +   + IP LE S   
Sbjct: 208 TLQLRLGIARDNLVSQTETLQLTDWRAQAGLVSSQDVDQARSNREQTRARIPGLEISLAE 267

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
             H +  LLG         +        P++ + I +GIPA+ +R RPD+R  E+KLA  
Sbjct: 268 AEHRLEVLLGKTPGTLQGRLAVAGEL--PSVPMQIAVGIPAETLRQRPDVRAAERKLAAE 325

Query: 289 VAKIGIAKSDLYPSLSLNGSIALTHDNSF---PGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
            A+IG A++  YPS S++GSI                  S    +  PIF+ GK+++ + 
Sbjct: 326 TARIGAAEAARYPSFSISGSIGFEALTVGALGSSGAATSSLLAGITAPIFNAGKLRNQVV 385

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
             ++  ++  + ++++VL A++EVENAL + + +++    L +A E  + +   +   Y 
Sbjct: 386 IQDAVREQALVAYEQSVLTALQEVENALVAFSRNRESSEALTNAAESARNAARSARQRYS 445

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            G      +LD ER    VE  L+  +     + + LY A+G G++P
Sbjct: 446 AGLIDFQSVLDTERTVLSVEDSLASTRANQVAALIRLYKALGGGWSP 492


>gi|206561157|ref|YP_002231922.1| efflux system outer membrane protein [Burkholderia cenocepacia
           J2315]
 gi|198037199|emb|CAR53120.1| efflux system outer membrane protein [Burkholderia cenocepacia
           J2315]
          Length = 507

 Score =  210 bits (533), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 105/476 (22%), Positives = 202/476 (42%), Gaps = 29/476 (6%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIG-----------NSKNLINIDT 49
           M           +   GCT+ P Y +P  P+     + G            S N      
Sbjct: 2   MQKHALTAIAVALFATGCTMAPHYKRPDAPVAQAYPASGVYATQPGAAGARSANGQAATA 61

Query: 50  LKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI 109
           + W E F D  L +L++IAL+ N  +  +   I AA+      RA LFP+   + +    
Sbjct: 62  IGWREFFVDPRLQRLIEIALKNNRDLRVSVLNIEAARAQYQITRAGLFPTLDGTGTGNRQ 121

Query: 110 PNLK-----------TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVI 157
                          T     L + W++DLFG+ + + + +LA   S       ++++++
Sbjct: 122 RLPNSLTAVPGRNITTTYNVGLSASWELDLFGRVQSLKDQALAQYLSTSYARQASEISLV 181

Query: 158 SKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIES 217
           S++   Y+      + + +    L   + + +L+ L+F  G  S+L L + +  +++  +
Sbjct: 182 SQVADQYLTLLSTDDLLKVTEDTLKTAQASYDLTKLQFDNGTGSELELRQAQTVVETALA 241

Query: 218 DIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPD 277
           +     ++    ++ +  L+G P  + L            NL   +  G+P+DL+  RPD
Sbjct: 242 NQQAQARARAQALNALVLLIGEPLPDDLPAGMPLDA---QNLLTDVPAGLPSDLLTRRPD 298

Query: 278 IRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPI 334
           +   E+ L  + A IG A++  +P +SL G+           F      WSF P + LPI
Sbjct: 299 VMQAEQTLLAANANIGAARAAFFPKISLTGAFGTASPTLGGLFKAGTAAWSFAPSIALPI 358

Query: 335 FDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHK 394
           F+ G+  +N+  A    + +   +++ + +A +EV + L +     + +  L+      +
Sbjct: 359 FEGGQNIANLDLANVQKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQ 418

Query: 395 KSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +   LS + Y+ G  S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 419 RRFDLSDLRYKNGVDSYLSVLTAQTDLYAAQQSLISARLARWTNLVDLYRALGGGW 474


>gi|404773|gb|AAA74435.1| outer membrane protein [Pseudomonas aeruginosa]
          Length = 477

 Score =  210 bits (533), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 99/470 (21%), Positives = 194/470 (41%), Gaps = 25/470 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQ-----FSIGNSKNLINIDTLKWWES 55
           M       ++  V+L+GC++ P+Y +P  P+         +        +    + W E 
Sbjct: 1   MKRSFLSLAVAAVVLSGCSLIPDYQRPEAPVAAAYPQGQAYGQNTGAAAVPAADIGWREF 60

Query: 56  FNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTN 115
           F D  L +L+ +AL+ N  +  A   + A +      RADLFP      S          
Sbjct: 61  FRDPQLQQLIGVALENNRDLRVAALNVEAFRAQYRIQRADLFPRIGVDGSGTRQRLPGDL 120

Query: 116 STGQLDS------------DWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIP 162
           ST    +             W++DLFG+ R +   +L    +       A+  +++ +  
Sbjct: 121 STTGSPAISSQYGVTLGTTAWELDLFGRLRSLRDQALEQYLATEQAQRSAQTTLVASVAT 180

Query: 163 SYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTL 222
           +Y+  +  + ++ +    L  Y+K+ +L+   +  G  S L L + +  ++   + +   
Sbjct: 181 AYLTLKADQAQLQLTKDTLGTYQKSFDLTQRSYDVGVASALDLRQAQTAVEGARATLAQY 240

Query: 223 EKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQE 282
            +    + + +  LLG      +     Q       L   +  G+P+DL++ RPDI   E
Sbjct: 241 TRLVAQDQNALVLLLG----SGIPANLPQGLGLDQTLLTEVPAGLPSDLLQRRPDILEAE 296

Query: 283 KKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGK 339
            +L  + A IG A++  +PS+SL  +           F   +  W F P + LPIF  G 
Sbjct: 297 HQLMAANASIGAARAAFFPSISLTANAGTMSRQLSGLFDAGSGSWLFQPSINLPIFTAGS 356

Query: 340 IKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSL 399
           +++++  A+         +++ +  A +EV + L +     + +   +  V+   +   L
Sbjct: 357 LRASLDYAKIQKDINVAQYEKAIQTAFQEVADGLAARGTFTEQLQAQRDLVKASDEYYQL 416

Query: 400 SMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           +   YR G  + L +LD +R+    +  L   +     S V+LY A+  G
Sbjct: 417 ADKRYRTGVDNYLTLLDAQRSLFTAQQQLITDRLNQLTSEVNLYKALWGG 466


>gi|330808825|ref|YP_004353287.1| transporter outer membrane lipoprotein [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327376933|gb|AEA68283.1| putative transporter, outer membrane lipoprotein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 474

 Score =  210 bits (533), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 102/471 (21%), Positives = 199/471 (42%), Gaps = 24/471 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK----WWESF 56
           M       ++   +L+GC++ PEY +P  P+          +     D       W E F
Sbjct: 1   MTRSLIGLAISAAVLSGCSLIPEYQRPQAPVAAQYPQGPAYQATNAADQAAVEQGWREFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           +D +L +L++ AL  N  +  A   + A +      RADLFP+  A+ S          +
Sbjct: 61  HDPALQRLIQTALINNRDLKVAALNVEAYRAQYRIQRADLFPAIGANASGTRQRLPSAQT 120

Query: 117 TGQL------------DSDWKIDLFGQRRHIESSLANLDSAYAQ-VDIAKLNVISKLIPS 163
                            S +++DLFG+   +         + AQ     +++++S +  +
Sbjct: 121 QSGQASISSQYDVNLGISSYELDLFGRIASLSQQALETYLSTAQARRSTQISIVSSVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  +  +E + +    L  Y++++ L+      G  S L L +    ++   + +   +
Sbjct: 181 YLTWQADRELLKLTENTLGAYEESLRLTARSNQVGVASALDLAQARTSVQGARASLANYQ 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    + + +  LLG      L     +  +   +L   +  G+P+DL+  RPDI   E 
Sbjct: 241 RRVAEDENALVLLLG----TGLPADLPEPQSLYGDLLANVPAGLPSDLLARRPDILAAEH 296

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  +   +  N    F   +  W+F P + LPIF+ G +
Sbjct: 297 SLLAANANIGAARAAFFPSISLTANAGTSSANLDGLFKSGSGSWTFTPTISLPIFNAGAL 356

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++++  +E         +++ +  A +EV + LT+       +      V   +    L+
Sbjct: 357 RASLNYSEIQKDIGVANYEKAIQTAFQEVSDGLTARKTYVDQLQAQSDLVNASQDYYRLA 416

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
              YR G  S L  LD +R+    +  L   +    ++ V+LY A+G G++
Sbjct: 417 ERRYRIGVDSNLTFLDAQRSLFSNQQRLINDRLAQLQAEVNLYRALGGGWD 467


>gi|300693756|ref|YP_003749729.1| outer membrane drug efflux lipoprotein [Ralstonia solanacearum
           PSI07]
 gi|299075793|emb|CBJ35099.1| outer membrane drug efflux lipoprotein [Ralstonia solanacearum
           PSI07]
          Length = 492

 Score =  210 bits (533), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 111/475 (23%), Positives = 204/475 (42%), Gaps = 25/475 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSI--------GNSKNLINIDTLKW 52
           M            +LAGCT+ P Y +P  P+                 ++  + +  L W
Sbjct: 1   MIRFSPTVLALAAMLAGCTLMPTYQQPATPVPAAFADASGNRDNTGDGARAPVAVADLGW 60

Query: 53  WESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL 112
            + F D SL +++++AL  N  +  A   I  A+       A LFP+  AS S       
Sbjct: 61  RDVFTDPSLQRVIEMALANNRDLRVAILNIERARAQYRVQDAALFPTVKASGSESSSRTP 120

Query: 113 ------------KTNSTGQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISK 159
                        T S     S +++DLFG+ R +   +L  + S       +++++I++
Sbjct: 121 AALSATGQPLVSHTYSATLGFSAYELDLFGRVRSLNTQALEQVLSTVEVRRSSQISLIAE 180

Query: 160 LIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDI 219
           +  +Y+     ++ + +A   L        L+   +  GA SKL+L + +  + S   D+
Sbjct: 181 VATAYLTMAADQDLLKLAQDTLSSQSDTYRLNQRSYELGAASKLTLRQSQTSVDSARVDV 240

Query: 220 PTLEKSFRMNVHNISTLLGYP-ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDI 278
                    + + +  L+G     E L      S+    +L   I  G+ +DL++ RPDI
Sbjct: 241 ERYTAQVAQDRNALVLLVGAEVPAELLPRSLPDSSAAAGSLLATIPPGLTSDLLQRRPDI 300

Query: 279 RYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIF 335
              E  L  + A IG A++  +PS+SL  S   +  +    F G +  W+FGP++ LPIF
Sbjct: 301 LQAEHDLKAANANIGAARAAFFPSISLTASAGTSSASLAGLFKGGSGVWNFGPQISLPIF 360

Query: 336 DKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKK 395
           D G  ++N+  A +S       +++ +  A +EV +AL   +   + +   Q  V+    
Sbjct: 361 DGGANRANLDIANTSRDIAVAQYEKAIQTAFREVSDALAQRSTLGRQLEAQQSLVDATAD 420

Query: 396 SMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S  L+   +++G  S L +LD +R+    + +    +     + V  Y  +G G+
Sbjct: 421 SYQLATARFKRGVDSYLTVLDSQRSLYTAQQNRINTRLSRFTNLVTFYKTLGGGW 475


>gi|319409385|emb|CBI83029.1| putative outer membrane protein [Bartonella schoenbuchensis R1]
          Length = 482

 Score =  210 bits (533), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 133/469 (28%), Positives = 231/469 (49%), Gaps = 18/469 (3%)

Query: 1   MNILRAI--------FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKW 52
           M+ L+ I        F    ++L+GC VGP+Y K    +           +  ++    W
Sbjct: 1   MSTLKWIASKNLYYSFLCVFLMLSGCAVGPDYHKTSFSVPAVWGRKSAQISDHSVALAGW 60

Query: 53  WESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL 112
           W  FND  LN+L+  A+  N  +  A  R+  A+ ++      L PS   SIS       
Sbjct: 61  WRRFNDPVLNELIDDAISGNNNVAVAKARVREARASVGQTAGYLAPSVSGSISGNRFSEQ 120

Query: 113 K----TNSTGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
                +   G  D+ W++DLFG  +  +E++   LDS    +    + ++  +  +Y++ 
Sbjct: 121 PDVSLSQYRGGFDASWELDLFGGHKRAVEAARYGLDSTVEDMRATMVTLLGDVATNYVEM 180

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
           R +++++ IA +I+   +K  EL   K   G  S+L     +A++ + E+DI  +E S  
Sbjct: 181 RGWQQKLLIARRIVVSQRKTFELMRTKLAAGEASELDFSNAQAQMANTEADIFQIEASLA 240

Query: 228 MNVHNISTLLGYPATEFLHYMQKQS--NNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
           M++H +S L G   T    ++QK +      P    PI +GIPAD++  RPD+R  E++ 
Sbjct: 241 MSIHRLSVLTGRVPTALEAFLQKSAKKEGAIPQPQWPIPVGIPADILLTRPDLRRAERQY 300

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYN---THWSFGPKLYLPIFDKGKIKS 342
           A + A+IG  ++D YPSL+L G I+ T              WSFGP L  P FD G+  +
Sbjct: 301 AQATARIGQREADRYPSLTLTGRISTTATQIGHLGESSTIGWSFGPGLQFPFFDGGQRAA 360

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
           ++  A +   + +IT++  VL A+++VENAL  + ++ + + KL  A     +S+ LS +
Sbjct: 361 SVEMARAQRDQAFITYRAEVLGALEDVENALVRLYKEHQRLEKLTVANTAALRSLKLSQL 420

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            +  G  S  + LD  R+    ++ L  +   +A  Y+ L  A+G G++
Sbjct: 421 LFENGDISFFEFLDARRSYYSAQMALKNSYVNVALQYIALMKALGGGWD 469


>gi|254000371|ref|YP_003052434.1| NodT family RND efflux system outer membrane lipoprotein
           [Methylovorus sp. SIP3-4]
 gi|253987050|gb|ACT51907.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Methylovorus sp. SIP3-4]
          Length = 467

 Score =  210 bits (533), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 108/468 (23%), Positives = 211/468 (45%), Gaps = 22/468 (4%)

Query: 1   MNILRAIFSLFIVLLAGCT-VGPEYTKPHMPLLPTQFSIGNS--KNLINIDTLKWWESFN 57
           MN       +  ++LAGC  + P+Y +P  P+     +  ++  K       + W + F 
Sbjct: 1   MNKHSYPLGIAALMLAGCMNMQPKYERPAAPIPAQWPATADAVQKQATAPAVVGWEQFFT 60

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST 117
           D  L KL++ AL+ N  +  +T  I  A+      RADLFP   A+ S          ST
Sbjct: 61  DPDLKKLIRQALENNRDLRVSTLNIEKARAQYQIQRADLFPKINATGSGTNQRTPAAAST 120

Query: 118 GQL------------DSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSY 164
                           S +++D FG+ R +         S       A++ +++++  +Y
Sbjct: 121 TGSTLLTHQYSANLGFSSYELDFFGRVRSLRDQAVYQYLSTEEAKRSAQITLVAEVANAY 180

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           +      E + +A Q L   +++ +++  +   G+ ++L+L + E  ++S  +D+     
Sbjct: 181 LTMVADMESLELARQTLRTQRESYDMTKRQLEFGSVTELTLRQAETSVESARADVAKYMT 240

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
               + + +  L+G      L  M+      Q         G+P+ +++NRPD+   E+ 
Sbjct: 241 QVDQDRNALVLLVGTAPEVNLDEMRSLKAVSQTATLPD---GLPSTVLQNRPDVLEAERD 297

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIK 341
           L    A IG A++  +P++SL  S  +  +   + F G N  WSF P++ LPIF+ G  K
Sbjct: 298 LQGYNANIGAARAAFFPTISLTASAGVASNELGSLFNGSNRAWSFAPQIVLPIFNAGLNK 357

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           +N++ AE +       +++ +  A KEV ++L      ++ ++     V   ++S +LS 
Sbjct: 358 ANLKVAEVNRDISVAQYEKAIQTAFKEVSDSLAQRATLEEQLSAQTALVNATERSFTLSR 417

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           + + +G  + L +LD +R+    + +L   +     + V LY  +G G
Sbjct: 418 LRFEKGLDNYLTVLDAQRSYYSAQQNLITVRLSDVSNQVTLYKVLGGG 465


>gi|197120966|ref|YP_002132917.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Anaeromyxobacter sp. K]
 gi|196170815|gb|ACG71788.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Anaeromyxobacter sp. K]
          Length = 501

 Score =  209 bits (532), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 106/450 (23%), Positives = 197/450 (43%), Gaps = 19/450 (4%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTIL 76
           GCT+ P Y +P  P+                  L W + F D  L  ++  AL++N  + 
Sbjct: 19  GCTLAPRYQRPAAPVAAEFAGGAEPAAGPAAADLGWRDVFQDPGLQAVIDQALRENRDLR 78

Query: 77  QATERINAAKENILSVRADLFPSSYASISHRFIPNL------------KTNSTGQLDSDW 124
            A   +  A+      R+ L P+  A+ S                    T S G   + +
Sbjct: 79  VAALNVELARAQYGIQRSYLLPTVGATGSGSRARTAKDLSFTGEPSVGNTFSAGVGLTSF 138

Query: 125 KIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDL 183
           +IDLFG+ R +   +L    +       A L ++S++   Y+ +R  + ++++A Q L  
Sbjct: 139 EIDLFGRVRSLRNQALEQYLATEEAHRSAHLALVSEVAVQYLASRALQSQVALAEQTLQT 198

Query: 184 YKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATE 243
            +++ +L+   F  G TS+L     EA++++   ++    +      + +  L G P  +
Sbjct: 199 VQQSYDLAKRTFEAGRTSELDFRTAEAQVETARVNLSAYRQQLAQAENALVLLAGGPLPK 258

Query: 244 FLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSL 303
            L                    G+P+DL++ RPDI   E +L  + A IG A++  +PS+
Sbjct: 259 DLPAATPLEQQPPVAELP---AGLPSDLLQRRPDILSAEHQLKAANASIGAARAAFFPSI 315

Query: 304 SLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQE 360
           SL  S+        N F   +  W+F P++ LPIF  G+ K+N+  A    Q +  ++++
Sbjct: 316 SLTASVGTASTELSNLFTVGSGTWAFSPRIDLPIFTGGRNKANLDAANVRKQIEIASYEK 375

Query: 361 TVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERA 420
            +  A +EV +AL +     + +      VE  ++   +S + YR+G  S L++L  +R 
Sbjct: 376 AIQAAFREVADALVARGRLDEQLEAQTRRVEAEQRRYDISELRYRKGVDSYLNVLTAQRD 435

Query: 421 TAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
               +  L   +     + + LY A+G G+
Sbjct: 436 LYGAQQQLIQTRLARFSNSIGLYRALGGGW 465


>gi|134296812|ref|YP_001120547.1| RND efflux system outer membrane lipoprotein [Burkholderia
           vietnamiensis G4]
 gi|134139969|gb|ABO55712.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia vietnamiensis G4]
          Length = 507

 Score =  209 bits (532), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 112/477 (23%), Positives = 210/477 (44%), Gaps = 30/477 (6%)

Query: 1   MNILRAIFSLFIVLLA-GCTVGPEYTKPHMPLLPTQFSIG-----------NSKNLINID 48
           M    A+ ++ + LLA GCT+ P YT+P  P+     + G            S N     
Sbjct: 1   MMQKHALTAIAVALLATGCTMAPHYTRPDAPVAQAYPAGGVYATQPAAAGTRSANGQAAS 60

Query: 49  TLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSS-------- 100
            + W E F D  L +L++IAL  N  +  A   I A++      RA LFP+         
Sbjct: 61  AIGWREFFADPRLQRLIEIALNNNRDLRVAVLNIEASRAQYQITRAGLFPTLDGTGSGNI 120

Query: 101 ---YASISHRFIPNLKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNV 156
               A +S    P +    +  L + W++DLFG+ + + + +LA   S        ++++
Sbjct: 121 QRYPAGVSTTRQPLITRTYSVGLSASWELDLFGRVQSLKDQALAQYLSTSYARQATEISL 180

Query: 157 ISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE 216
           +S++   Y+     ++ + +    L   + + +L+ L+F  G  S+L L + +  ++   
Sbjct: 181 VSQVADQYLTLLSTEDLLKVTENTLKTAQASYDLTKLQFDNGTGSELDLRQAQTVVEQAL 240

Query: 217 SDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRP 276
           ++     ++    V+ +  L+G P  + L            NL   +  G+P+DL+  RP
Sbjct: 241 ANQQAQARARAQAVNALVLLIGEPLPDDLPAGMSLDA---QNLLTDVPAGLPSDLLTRRP 297

Query: 277 DIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLP 333
           D+   E+ L  + A IG A++  +P +SL  +           F      WSF P+L +P
Sbjct: 298 DVMQAEQTLLAANANIGAARAAFFPRISLTAAFGTASPTLGGLFKAGTAAWSFAPQLTMP 357

Query: 334 IFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELH 393
           IF+ G+  +N+  A    + +   +++ + +A +EV + L +       +  L+      
Sbjct: 358 IFEGGQNIANLNLANVQKRIEIANYEKAIQSAFREVSDGLAARGTYDLQIAALERNEHAQ 417

Query: 394 KKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           ++   LS + Y+ G  S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 418 QRRFDLSDLRYKNGVDSYLSVLTAQTDLYSAQQSLISARLARWTNLVDLYRALGGGW 474


>gi|115352705|ref|YP_774544.1| RND efflux system outer membrane lipoprotein [Burkholderia
           ambifaria AMMD]
 gi|115282693|gb|ABI88210.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia ambifaria AMMD]
          Length = 507

 Score =  209 bits (532), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 110/477 (23%), Positives = 208/477 (43%), Gaps = 30/477 (6%)

Query: 1   MNILRAIFSLFIVLLA-GCTVGPEYTKPHMPLLPTQ-----------FSIGNSKNLINID 48
           M    A+ ++ + LLA GCT+ P Y +P  P+                +   S N     
Sbjct: 1   MMQKHALTAIAVALLATGCTMAPHYKRPDAPVAQAYPADGVYATQPGAAGARSANGQAAT 60

Query: 49  TLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS--- 105
            + W E F D  L +L++IAL+ N  +  A   I AA+      RA LFP+   + +   
Sbjct: 61  AIGWREFFVDPRLQRLIEIALKNNRDLRVAVLNIEAARAQYQITRAGLFPTLDGTGTGTI 120

Query: 106 --------HRFIPNLKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNV 156
                       P +       L + W++DLFG+ + + + +LA   S        ++++
Sbjct: 121 QRVPQGLSQTGAPYISRAYNVGLSASWELDLFGRVQSLKDQALAQYLSTSYARQATEISL 180

Query: 157 ISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE 216
           +S++   Y+      + + +    L   + + +L+ L+F  G  S+L L + +  ++   
Sbjct: 181 VSQVADQYLTLLSTDDLLKVTENTLKTAQASYDLTKLQFDNGTGSELELRQAQTVVEQAL 240

Query: 217 SDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRP 276
           S+     ++    ++ +  L+G P  + L            NL   +  G+P+DL+  RP
Sbjct: 241 SNQQAQARARAQALNALVLLIGEPLPDDLPAGMPLDA---QNLLTDVPAGLPSDLLTRRP 297

Query: 277 DIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLP 333
           D+   E+ L  + A IG A++  +P +SL G+           F      WSF P++ +P
Sbjct: 298 DVMQAEQTLLAANANIGAARAAFFPRISLTGAFGTGSPTLGGLFKAGTAAWSFAPQITMP 357

Query: 334 IFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELH 393
           IF+ G+  +N+  A    + +   +++ + +A +EV + L +     + +  LQ      
Sbjct: 358 IFEGGQNIANLNLANVQKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALQRNEHAQ 417

Query: 394 KKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           ++   LS + Y+ G  S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 418 QRRFDLSDLRYKNGVDSYLSVLTAQTDLYTAQQTLINARLARWTNLVDLYRALGGGW 474


>gi|296155956|ref|ZP_06838795.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. Ch1-1]
 gi|295893462|gb|EFG73241.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. Ch1-1]
          Length = 486

 Score =  209 bits (532), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 116/461 (25%), Positives = 206/461 (44%), Gaps = 25/461 (5%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKI 67
                + L+GC +GP+Y +P +   P  F   +S     +DT  WW  F D  LN+L+  
Sbjct: 13  ALGLCLCLSGCLMGPDYVRPSIET-PATFRFSDSTQAQIVDTA-WWAQFGDPVLNELIST 70

Query: 68  ALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP--------------NLK 113
           AL QN  +  A  R++  +   ++ R+ LFP   A  +                      
Sbjct: 71  ALAQNRDLKIAAARVDEFRGQFVTTRSQLFPQISAGFNAGRQRVSPLAQSSLPAGIGTDY 130

Query: 114 TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
           T+    L   W+ID FG+ RR  E++ ANL ++        L +++ +  SYI+ R   +
Sbjct: 131 TSFNATLPISWEIDAFGRVRRQTEAARANLLASEEGQRATLLTLVASVATSYINLRSLDQ 190

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
           ++ IA         ++++  L+F  G  S++ L + ++E ++  +DIP +E         
Sbjct: 191 QLEIARATAASRAGSVKVFELRFKGGQISQVELAQSQSEYEASLADIPAIEAQIGQQEDA 250

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +S LLG      L                 +  G+P++L+  RPD+   E+ L  + A I
Sbjct: 251 LSVLLGRNPGPILR-----GRTLDELQSPSVPAGLPSELLARRPDVLQAEQNLVAANALI 305

Query: 293 GIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL G +  +       F G    W+F   L  PIF  G I   + +A++
Sbjct: 306 GAARALYFPQISLTGLLGSSSTQLSRLFSGPANTWAFAGALTQPIFSAGNIAGQVEQAQA 365

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             Q+    +Q+ V +A +EV +AL  + +  + +   +  V+       L+   Y  G  
Sbjct: 366 RQQQTLYAYQKAVQSAFQEVSDALLGVGKSCERLVAQERQVDALNAYARLARQRYEGGYT 425

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S +++LD ER+    ++  +  +     S V LY A+G G+
Sbjct: 426 SYMEVLDAERSLFSAQLAYAQTRGNEYTSLVTLYKALGGGW 466


>gi|317406702|gb|EFV86865.1| efflux system outer membrane component [Achromobacter xylosoxidans
           C54]
          Length = 495

 Score =  209 bits (532), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 105/487 (21%), Positives = 198/487 (40%), Gaps = 40/487 (8%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIG--------------------- 39
           M    A+ +   V LAGC++ P+Y +P  P+                             
Sbjct: 5   MFKQTALSAFVAVALAGCSLAPDYKRPDAPVSGNWPDQPKVQYGAYATPMTLGTQPASAV 64

Query: 40  NSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS 99
             +       L W E F D  L +L+++AL  N  +  A +R+  A+      R   +PS
Sbjct: 65  APQAGTPAADLGWREFFRDPRLQRLIELALVNNRDLRVAVQRVEEARAQYGVQRGAQWPS 124

Query: 100 SYASISHRFIPNL------------KTNSTGQLDSDWKIDLFGQRRHIESSLANLDSAYA 147
             A I  +                  +   G   + ++IDLFG+ R +  +      +  
Sbjct: 125 IGAGIQGQRQRFPENMRQPGAGSVTSSYQAGIGLTTFEIDLFGRLRSLSEAAYQQYLSTE 184

Query: 148 QVD-IAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLV 206
           Q      + +I  +  SY + R  + ++ +  + L   +++  L   +F  G  S+L L 
Sbjct: 185 QAQKSTHITLIGAVAQSYFNLRAAQVQLELTQRTLASRQESYNLVKRRFDGGVASELDLN 244

Query: 207 KLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIG 266
           + ++ + +  +D+  L +     V+ +  LLG P  E    +   +   +  L   +  G
Sbjct: 245 QSKSLLDTASADLAQLARVQAQAVNALVLLLGTPLPED---LPPPATFGRDQLLATVPAG 301

Query: 267 IPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTH 323
           +P+DL+  RPDI   E  L  + A IG A++  +P++SL G   +   +    F G   +
Sbjct: 302 LPSDLLERRPDILAAENNLKSANANIGAARAAFFPTISLTGLFGVASPSLDTLFKGGQGY 361

Query: 324 WSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIV 383
           WSF P +  P+F  G I+  +  A++        +++T+  A +EV +AL         +
Sbjct: 362 WSFSPSITTPLFAGGSIREGLNLAKARDNIAVAQYEQTIQQAFREVSDALAGEATYGAQL 421

Query: 384 TKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLY 443
              +   +   +++ LS + Y  G  S L +   +      ++ L         + V+LY
Sbjct: 422 DAQRALQDSSARTLELSNLRYTNGIDSYLQVQTAQVDFFNAQLALVQTGLAALINRVELY 481

Query: 444 IAIGSGY 450
            A+G G+
Sbjct: 482 KALGGGW 488


>gi|170697628|ref|ZP_02888717.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia ambifaria IOP40-10]
 gi|170137515|gb|EDT05754.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia ambifaria IOP40-10]
          Length = 507

 Score =  209 bits (532), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 110/477 (23%), Positives = 208/477 (43%), Gaps = 30/477 (6%)

Query: 1   MNILRAIFSLFIVLLA-GCTVGPEYTKPHMPLLPTQ-----------FSIGNSKNLINID 48
           M    A+ ++ + LLA GCT+ P Y +P  P+                +   S N     
Sbjct: 1   MMQKHALTAIAVALLATGCTMAPHYKRPDAPVAQAYPADGVYATQPGAAGARSANGQAAT 60

Query: 49  TLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS--- 105
            + W E F D  L +L++IAL+ N  +  A   I AA+      RA LFP+   + +   
Sbjct: 61  AIGWREFFVDPRLQRLIEIALKNNRDLRVAVLNIEAARAQYQITRAGLFPTLDGTGTGNI 120

Query: 106 --------HRFIPNLKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNV 156
                       P +       L + W++DLFG+ + + + +LA   S        ++++
Sbjct: 121 QRVPQGLSQTGAPYISRAYNVGLSASWELDLFGRVQSLKDQALAQYLSTSYARQATEISL 180

Query: 157 ISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE 216
           +S++   Y+      + + +    L   + + +L+ L+F  G  S+L L + +  ++   
Sbjct: 181 VSQVADQYLTLLSTDDLLKVTENTLKTAQASYDLTKLQFDNGTGSELELRQAQTVVEQAL 240

Query: 217 SDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRP 276
           S+     ++    ++ +  L+G P  + L            NL   +  G+P+DL+  RP
Sbjct: 241 SNQQAQARARAQALNALVLLIGEPLPDDLPAGMPLDA---QNLLTDVPAGLPSDLLTRRP 297

Query: 277 DIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLP 333
           D+   E+ L  + A IG A++  +P +SL G+           F      WSF P++ +P
Sbjct: 298 DVMQAEQTLLAANANIGAARAAFFPRISLTGAFGTGSPTLGGLFKAGTAAWSFAPQITMP 357

Query: 334 IFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELH 393
           IF+ G+  +N+  A    + +   +++ + +A +EV + L +     + +  LQ      
Sbjct: 358 IFEGGQNIANLNLANVQKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALQRNEHAQ 417

Query: 394 KKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           ++   LS + Y+ G  S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 418 QRRFDLSDLRYKNGVDSYLSVLTAQTDLYTAQQTLINARLARWTNLVDLYRALGGGW 474


>gi|170734961|ref|YP_001774075.1| RND efflux system outer membrane lipoprotein [Burkholderia
           cenocepacia MC0-3]
 gi|169820999|gb|ACA95580.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia cenocepacia MC0-3]
          Length = 475

 Score =  209 bits (531), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 105/468 (22%), Positives = 190/468 (40%), Gaps = 22/468 (4%)

Query: 3   ILRAIFSLFIV-LLAGCTVGPEYTKPHMPL---------LPTQFSIGNSKNLINIDTLKW 52
           + R + +L    +LAGCT+ P Y +P  P+         L    +  ++        L W
Sbjct: 1   MKRTLIALVCAGVLAGCTLDPTYQRPAAPVDNTWSTVPPLAQPKAAQSTAAAPPGADLGW 60

Query: 53  WESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL 112
            + F D  L KL+++AL  N  +  A   +   +      RA++ P+  AS S       
Sbjct: 61  RDFFKDPRLQKLIELALANNRDMRVAALNVAQYEAQYRIARANVGPAINASGSVTRERVA 120

Query: 113 KTNSTGQLD------SDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYI 165
            + S           + W+ID FG+ R ++        +  A     ++++I+ +   Y+
Sbjct: 121 GSTSAYSSSSASVGLTSWEIDFFGRLRSLKRQALEQYLATDAARTSTQISLIATVATDYL 180

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
                +  + I    +D  +   +L+      G+ S   + + E  + S  S + +  ++
Sbjct: 181 QLLSDETSLQITQNTVDADQHTYDLTVNMMKMGSASLQDVRQAENSLASARSSLASYTRA 240

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
              + +N+   +G P  +     Q  S     N +  I  G+P+DL+  RPDI   E  L
Sbjct: 241 VAQDRNNLVAEIGAPLPD--DLPQGPSLMESENTFADIGEGVPSDLLARRPDIVEAEHTL 298

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG A++  +P + L  S   T     + F      W+F P L +P+FD G  ++
Sbjct: 299 KAANANIGAARAAFFPKIELTASAGTTSGSLSSLFKAGTGAWTFAPTLSVPLFDFGYNRA 358

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            +  A+         +++ +  A KEV NAL         V   +  V   ++   L+  
Sbjct: 359 TLDVAKVEKDIDIANYEKAIQTAFKEVSNALAGRTTYVTQVAADRDYVNSAQQYYDLAQA 418

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            YR G  S L +LD +R     +  L         + + LY  +G G+
Sbjct: 419 RYRSGTDSFLTLLDAQRTLYAAQQQLVTDMLAKQSNLITLYKVLGGGW 466


>gi|116750235|ref|YP_846922.1| RND efflux system outer membrane lipoprotein [Syntrophobacter
           fumaroxidans MPOB]
 gi|116699299|gb|ABK18487.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Syntrophobacter fumaroxidans MPOB]
          Length = 497

 Score =  209 bits (531), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 127/476 (26%), Positives = 227/476 (47%), Gaps = 33/476 (6%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMP-------LLPTQFSIGNSKNLINIDTLKWWESFND 58
            +      LLAGC VGP++ +P          +        +         + WW++F+D
Sbjct: 20  LLLPAVWFLLAGCMVGPDFHRPKSDPPGAYTGVTAGATREPSVTTGEPARLIDWWKAFDD 79

Query: 59  TSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP-------- 110
             L  L++ A+  NL + QA  RI  A+       + LFP   A  S+ +          
Sbjct: 80  PVLTSLIERAITANLDVRQAQARIRQARATRGVAASGLFPEIDAGASYNYSRGSPGTVSS 139

Query: 111 ------------NLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVI 157
                         +       D+ W++D FG  RR+IE+S A+L +A        +++ 
Sbjct: 140 SGGGTTAAGAAATPRELFQVGFDASWELDFFGGTRRNIEASDADLKAAVEDRRDVLVSMA 199

Query: 158 SKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIES 217
           +++   Y+  R  + ++ IA + L   K    ++  ++  G  S L +   +A+  + E+
Sbjct: 200 AEVGTEYVTLRGLQAQLLIARKNLASQKHTAGITRKRWQAGFVSALDVANADAQASTTEA 259

Query: 218 DIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPD 277
            IP LE S R  ++++  LL  P    L  +          +   + +G+P+DLIR RPD
Sbjct: 260 QIPILESSIRATIYSLGLLLAQPPAALLDELSDDGPIPP--IPPEVPVGLPSDLIRRRPD 317

Query: 278 IRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSF---PGYNTHWSFGPKLYLPI 334
           IR  E ++  + A+IG+A +DL+P  +L GS+ L   +        N  WS GP +  PI
Sbjct: 318 IRRTEAQVHAATARIGVATADLFPKFALTGSMGLMSADLNTLANLSNRFWSLGPTVSWPI 377

Query: 335 FDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHK 394
           F  G+I+ NI    +  ++  + + +T+L A+K+VE ALT+  ++++    L  AV  ++
Sbjct: 378 FTAGRIQCNIEVQNAVQEQTLLAYDKTILTALKDVETALTAYAKEQEHNRSLTEAVAHNR 437

Query: 395 KSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           K++ LSM  Y  G+   L++L+ +R+    E  L+++ R L  + + LY A+G G+
Sbjct: 438 KAVDLSMRLYLVGKIDFLNVLNAQRSLYLTEEGLALSNRTLTTNLIALYKALGGGW 493


>gi|163857572|ref|YP_001631870.1| outer membrane efflux protein [Bordetella petrii DSM 12804]
 gi|163261300|emb|CAP43602.1| probable outer membrane efflux protein [Bordetella petrii]
          Length = 500

 Score =  209 bits (531), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 102/488 (20%), Positives = 203/488 (41%), Gaps = 40/488 (8%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIG--------------------- 39
           M    A+ +    +LAGC++ P+Y +P  P+     +                       
Sbjct: 5   MYKRTALSACVAAVLAGCSLAPDYHRPESPVPGDWPAQPKVQYGGYDQPTSLSEQSAQAV 64

Query: 40  NSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS 99
             +  +    + W + F D  L  L++++L  N  +  A +R+  A+      R   +PS
Sbjct: 65  APQGAVPAADIGWRDFFRDPRLQALIELSLVNNRDLRMAVQRVEEARAQYGVQRGAQWPS 124

Query: 100 SYASISHRFIPNLKTNS------------TGQLDSDWKIDLFGQRRHI-ESSLANLDSAY 146
             A I           S             G   + ++IDLFG+ R++ E++     +  
Sbjct: 125 IGAGIEGTRQRVPANMSPTGSDTVGNTFQAGIGLTSFEIDLFGRLRNLSEAAYQQYLATE 184

Query: 147 AQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLV 206
                  + ++  +  +Y   R  + ++ +  + L   +++  L   +F  G  S+L L 
Sbjct: 185 QAQRSVHITLVGAVAQAYFTQRAAEVQLDLTRKTLASRQESYNLVKRRFDGGVASELELN 244

Query: 207 KLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIG 266
           + +A + S  +D+  L +    +++ ++ L+G P       +   +   +  L   +  G
Sbjct: 245 QSKALLDSASADLAQLARVRAQSINALTVLVGVPLPAD---LPAPAEFGRDQLLATVPAG 301

Query: 267 IPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTH 323
           +P+DL+  RPDI   E +L  + A IG A++  +P++SL G +     +    F G    
Sbjct: 302 LPSDLLERRPDIMAAENQLKAANANIGAARAAFFPTISLTGMLGFASTSMGSLFEGGQRA 361

Query: 324 WSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIV 383
           W+F P +  PIF  G I+  +  A++        +++T+  A +EV +AL         +
Sbjct: 362 WNFTPSITTPIFAGGSIREGLNLAKARDNIAVAQYEQTIQQAFREVSDALAGEATYGAQL 421

Query: 384 TKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLY 443
             L+       +++ LS + Y  G  S L +   +      ++ L  A  +   + V+LY
Sbjct: 422 DALRSLQASTARTLELSNLRYTSGIDSYLQVQTAQVDFFSAQLGLVQAGLEALNNRVELY 481

Query: 444 IAIGSGYN 451
            A+G G+N
Sbjct: 482 KALGGGWN 489


>gi|83718331|ref|YP_439482.1| RND efflux system outer membrane lipoprotein [Burkholderia
           thailandensis E264]
 gi|83652156|gb|ABC36220.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia thailandensis E264]
          Length = 543

 Score =  209 bits (531), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 106/461 (22%), Positives = 202/461 (43%), Gaps = 30/461 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIG------------NSKNLINIDTLKWWESFNDTSLNKL 64
           GCT+ P Y +P  P+     + G             S N      + W E F D  L +L
Sbjct: 51  GCTLAPRYERPAAPVSGAFPTDGVYAAQPGAAAGARSANGQAAVDIGWREFFVDPRLQRL 110

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSS-----------YASISHRFIPNLK 113
           ++IAL+ N  +  +   + A++      RA LFP+             A +S    P + 
Sbjct: 111 IEIALKNNRDLRVSVLNVEASRAQYRITRAGLFPTLDGTGTGTIQRTPAGVSVTGQPLIS 170

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                 + + W++DLFG+ + + + +LA   +       A++++++ +   Y+      +
Sbjct: 171 RTYNVGVSASWELDLFGRVQSLKDQALAQYFATAQARKAAEISLVASVADQYLTLLSTDD 230

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + I    L   + + +L+ L+F  G  S+L L + +  +++  ++     ++    V+ 
Sbjct: 231 LLQITENTLKTARASYDLTKLQFDNGTGSELDLRQAQTVVETALANQQAQARARAQAVNA 290

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G P  + L      +     NL   I  G+P+DL+  RPDI   E+ L  + A I
Sbjct: 291 LVLLIGEPLPDDLPAGLPLNA---QNLLTDIPAGLPSDLLTRRPDIMQAEETLRAANANI 347

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL G+           F      WSF P + LPIF+ G+  +N+  A  
Sbjct: 348 GAARAAFFPKISLTGAFGTASPTLGGLFKAGTAAWSFAPSIALPIFEGGQNIANLDLAHV 407

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             + +   +++ + +A +EV + L +     + +  L+      ++   LS + Y+ G  
Sbjct: 408 QKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRYDLSDLRYKNGVD 467

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 468 SYLSVLTAQTDLYSAQQQLISARLARWTNLVDLYRALGGGW 508


>gi|312959496|ref|ZP_07774013.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           fluorescens WH6]
 gi|311286213|gb|EFQ64777.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           fluorescens WH6]
          Length = 485

 Score =  209 bits (530), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 96/471 (20%), Positives = 195/471 (41%), Gaps = 25/471 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGN----SKNLINIDTLKWWESF 56
           M+      ++   +L+GC++ P+Y +P  P+                        W + F
Sbjct: 1   MSKSLLSLAVTAFVLSGCSLIPDYQRPEAPVAAQFPQGPAYSSAQAPNQTAAEQGWKQFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL---- 112
           +D +L +L++ AL  N  +  A   I+A        RADLFP+  A+ +           
Sbjct: 61  HDPALQQLIQTALVNNRDLRVAALNIDAYAAQYQIQRADLFPAVSATGNGSRSRTPAKLS 120

Query: 113 --------KTNSTGQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPS 163
                      S G   S +++DLFG+ R +         +        ++++++ +  +
Sbjct: 121 QSGQATIASQYSAGLGISSYELDLFGRVRSLSEEALQKYFATEEARRSTQISLVASVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  +  KE + +    L  Y+++ +L+      G  S L L +    +++    +    
Sbjct: 181 YLTWQADKELLKLTQDTLGAYEQSFKLTSRSNEVGVASALDLSQARTSVENARVALARYT 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    + ++++                 S     +L   +  G+P+DL++ RPDI   E 
Sbjct: 241 RQVAQDENSLTL-----LLGTGLPANIASKPLSDDLLSEVPAGLPSDLLQRRPDIVQAEY 295

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  S           F G +  WSF P++ +PIF+ G +
Sbjct: 296 NLKAANANIGAARAAFFPSISLTASAGTASPTLGGLFKGGSGTWSFAPQINIPIFNAGSL 355

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++++  ++   +     +++ +    +EV + L +    K+ +   +     ++    L+
Sbjct: 356 RASLDYSKIQKEINVANYEKAIQTGFQEVSDGLAARETYKQQLDAQRGFAAANQDYYRLA 415

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
              YR G  S L  LD +R     +  L   +     + V+LY A+G G+N
Sbjct: 416 ERRYRIGVDSNLTFLDAQRQLFSAQQSLITDRLAQLTAEVNLYKALGGGWN 466


>gi|186475248|ref|YP_001856718.1| RND efflux system outer membrane lipoprotein [Burkholderia phymatum
           STM815]
 gi|184191707|gb|ACC69672.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia phymatum STM815]
          Length = 505

 Score =  209 bits (530), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 108/476 (22%), Positives = 206/476 (43%), Gaps = 29/476 (6%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLL------------PTQFSIGNSKNLINID 48
           M+    +     +   GCT+ P Y +P  P+             P   +   S N     
Sbjct: 1   MHKYSLMAVAVALFATGCTMEPTYHQPAAPVSGTFPSDGVYATQPVPGAGARSANGQPAV 60

Query: 49  TLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF 108
            + W + F D  L +L++IAL+ N  +  +   I A++      RA LFP+  AS S   
Sbjct: 61  EIGWRDFFVDQRLQRLIEIALKNNRDLRVSVLNIEASRAQYQIARAALFPALDASASQTK 120

Query: 109 IPNL----------KTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVI 157
                             +  L++ W+ID FG+ R + + +LA   +       A++ ++
Sbjct: 121 QRTPKNLSVFGNTISNEYSVGLNASWEIDFFGRIRSLKDQALAQYLATAQARKAAEIALV 180

Query: 158 SKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIES 217
           + +   Y+    + + + +    L   +++  ++ L++  G  S+L L + +  ++   +
Sbjct: 181 ASVADQYMTVLAYDDLLKVTENTLKSAQESYRITKLQYDTGTGSELDLRQAQTVVEQATA 240

Query: 218 DIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPD 277
           ++ +  +      + +  L+G P    +            NL   I  G+P+DL+  RPD
Sbjct: 241 NLQSQARLRAQAENALVLLVGEPLPSDM---PSGLILDDQNLLTDIPAGLPSDLLTRRPD 297

Query: 278 IRYQEKKLADSVAKIGIAKSDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPI 334
           I   E+ L  + A IG A++  +P +SL GS    + T    F   +  WSF P + LPI
Sbjct: 298 IMEAEQNLLAANANIGAARAAFFPKVSLTGSFGTLSPTLGGLFKPGSAAWSFAPTITLPI 357

Query: 335 FDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHK 394
           F+ G+  +N+  A      Q   +++ +  A +EV + L +     + +  L+      +
Sbjct: 358 FEGGQNIANLDLANVEKNIQIAQYEKAIQTAFREVADGLAARGTYDEQIKALERDTFAEQ 417

Query: 395 KSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           + + LS + YR G  S L +L  + +    +  L  A+ +   + VDLY A+G G+
Sbjct: 418 RRLDLSDLRYRNGVDSYLAVLTAQTSLYSAQQLLITARMERLTNLVDLYKALGGGW 473


>gi|257142607|ref|ZP_05590869.1| RND efflux system outer membrane lipoprotein [Burkholderia
           thailandensis E264]
          Length = 547

 Score =  209 bits (530), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 106/461 (22%), Positives = 202/461 (43%), Gaps = 30/461 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIG------------NSKNLINIDTLKWWESFNDTSLNKL 64
           GCT+ P Y +P  P+     + G             S N      + W E F D  L +L
Sbjct: 55  GCTLAPRYERPAAPVSGAFPTDGVYAAQPGAAAGARSANGQAAVDIGWREFFVDPRLQRL 114

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSS-----------YASISHRFIPNLK 113
           ++IAL+ N  +  +   + A++      RA LFP+             A +S    P + 
Sbjct: 115 IEIALKNNRDLRVSVLNVEASRAQYRITRAGLFPTLDGTGTGTIQRTPAGVSVTGQPLIS 174

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                 + + W++DLFG+ + + + +LA   +       A++++++ +   Y+      +
Sbjct: 175 RTYNVGVSASWELDLFGRVQSLKDQALAQYFATAQARKAAEISLVASVADQYLTLLSTDD 234

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + I    L   + + +L+ L+F  G  S+L L + +  +++  ++     ++    V+ 
Sbjct: 235 LLQITENTLKTARASYDLTKLQFDNGTGSELDLRQAQTVVETALANQQAQARARAQAVNA 294

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G P  + L      +     NL   I  G+P+DL+  RPDI   E+ L  + A I
Sbjct: 295 LVLLIGEPLPDDLPAGMPLNA---QNLLTDIPAGLPSDLLTRRPDIMQAEETLRAANANI 351

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL G+           F      WSF P + LPIF+ G+  +N+  A  
Sbjct: 352 GAARAAFFPKISLTGAFGTASPTLGGLFKAGTAAWSFAPSIALPIFEGGQNIANLDLAHV 411

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             + +   +++ + +A +EV + L +     + +  L+      ++   LS + Y+ G  
Sbjct: 412 QKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRYDLSDLRYKNGVD 471

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 472 SYLSVLTAQTDLYSAQQQLISARLARWTNLVDLYRALGGGW 512


>gi|322832671|ref|YP_004212698.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rahnella sp. Y9602]
 gi|321167872|gb|ADW73571.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rahnella sp. Y9602]
          Length = 560

 Score =  209 bits (530), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 117/480 (24%), Positives = 227/480 (47%), Gaps = 46/480 (9%)

Query: 16  AGCTVGPEYTKPHMPLLPTQF--------SIGNSKNLINIDTLKWWESFNDTSLNKLVKI 67
           A C+VGP+Y KP+ P+ P+ +          G S  L +     WW++FND  L+ L+  
Sbjct: 54  AACSVGPDYQKPN-PVTPSAYNDMTQPKDKDGASIALPSEPNPLWWKAFNDPQLDSLITR 112

Query: 68  ALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP----------------- 110
           A+  N+++ QA  RI  A+E +        PS   S                        
Sbjct: 113 AIAGNISLQQAVLRIAGAREQVKQAEGAWLPSVQGSAKMTRQQLGLKGILDSSGASQQLD 172

Query: 111 --------------NLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLN 155
                                G  D+ W++DLFG  RR +E++ A   S+  Q + A ++
Sbjct: 173 DLGPEASGAISTATRPVNLYQGNFDASWELDLFGGTRRQVEAANAQTQSSIEQRNDALVS 232

Query: 156 VISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSI 215
           + +++  +Y+  R  +   +     +D+ ++ ++L+  +   G + +L +    A++ S+
Sbjct: 233 LEAEVARAYLQLRGAQSVTAAIQTQIDVAQQTLDLTQNRQQNGLSPQLDVENARAQLGSL 292

Query: 216 ESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNR 275
            + +P  +   R  ++ ++ LLG          +  +    P L   + +G+P+ L R R
Sbjct: 293 RAQLPQYQAQERQAMNGLAVLLGQTPGS--LDAELSAPKPMPALPAAVPVGVPSQLARRR 350

Query: 276 PDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSF---PGYNTHWSFGPKLYL 332
           PD+R  E  L  + A IG++ + ++PS+SL G   + + +        +  +SFGP++ L
Sbjct: 351 PDVRKAEADLHAATANIGVSVAQMFPSISLTGQFGMRNTDVSYLDNWSSHFYSFGPQISL 410

Query: 333 PIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVEL 392
           PIF  G++ S++  + +      + +++TVL A+++V+NAL +   D+  V+ L    + 
Sbjct: 411 PIFQGGRLVSSVHLSRAQQANAALNYRQTVLTALQDVDNALVNYRTDQDQVSGLDQTTKA 470

Query: 393 HKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            + +  L+  +YRQG  + +++LD +R  A+     + AK + +   V LY A+G G+ P
Sbjct: 471 LQTAFDLASDSYRQGLSTFINVLDAQRQLAQAHQQSAEAKVKTSTDLVSLYKALGGGWEP 530


>gi|153010881|ref|YP_001372095.1| RND efflux system outer membrane lipoprotein [Ochrobactrum anthropi
           ATCC 49188]
 gi|151562769|gb|ABS16266.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Ochrobactrum anthropi ATCC 49188]
          Length = 493

 Score =  209 bits (530), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 131/455 (28%), Positives = 230/455 (50%), Gaps = 14/455 (3%)

Query: 6   AIFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKL 64
            +    + LLA C TVGP+Y KP++ L P  ++    K    +    WW++  D  L++L
Sbjct: 9   TVLGSILPLLAACVTVGPDYQKPNV-LTPAGWNSKADKRAPQL--GDWWKNLKDPVLDQL 65

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKT----NSTGQL 120
           +   +  +  +  A  ++   + N  S    L+P    S S     +  T     S+   
Sbjct: 66  IADGIAGSPDVATAKAKVRQTRANYTSAGGALYPQLDGSGSFTRSDSGTTLASNQSSMGF 125

Query: 121 DSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQ 179
            + W++DLFG  R  +E++  N++SA  Q+  A + +I  +  +Y + R  +  I+IA +
Sbjct: 126 KTQWELDLFGGNRRGVEAAYYNVESANEQLRAALITLIGDIATNYANLRGAQANIAIAQR 185

Query: 180 ILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGY 239
                ++ + L+  +   G  S++ L+  E +  S E+ IP L  S+   ++ +S L G 
Sbjct: 186 NAASQRQTVALTRSQLEAGQISQVDLLSAETQAASTEAQIPGLRISYAQYLNQLSVLTGR 245

Query: 240 PATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDL 299
            ++     + K      P +   I+ G+PADL+ +RPDIR  E+  A S A IG  ++ L
Sbjct: 246 SSSALASVLDKSRP--IPAIPRKISAGLPADLLLSRPDIRAAERDYASSTASIGQKQALL 303

Query: 300 YPSLSLNGSIALTHDNSFPGYN---THWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYI 356
           YPS+SL G+I     N           W+FGP L +P+F  G++ +++  A ++  + +I
Sbjct: 304 YPSVSLTGNINTGGANFGDLGKLSTISWAFGPSLSVPVFHGGQLNADVDAARAARDQAFI 363

Query: 357 TWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILD 416
            +++ +L A+ EVENA  S+N+++    +LQ  V   +K   L++  YR G  S +D+L 
Sbjct: 364 AYRKIILTALSEVENASVSLNQNRLRTAQLQKIVGNSRKINELTLEQYRAGTKSFVDVLT 423

Query: 417 IERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            +R     E +LS A+  L  +YV L  A+G G+N
Sbjct: 424 AQRDLLSAETNLSQARTDLVLNYVALQKALGGGWN 458


>gi|77457505|ref|YP_347010.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           fluorescens Pf0-1]
 gi|77381508|gb|ABA73021.1| outer membrane protein precursor [Pseudomonas fluorescens Pf0-1]
          Length = 486

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 101/471 (21%), Positives = 208/471 (44%), Gaps = 24/471 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGN----SKNLINIDTLKWWESF 56
           M+      ++   +L+GC++ P+Y +P  P+                        W + F
Sbjct: 1   MSKSLLSIAVAAFVLSGCSLIPDYQQPEAPVAAQFPQGPAYSPAQAPAQAAAEQGWKQFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           +D +L +L+++AL+ N  +  A   I+A        RADLFP+  A+ S          S
Sbjct: 61  HDPALQQLIQVALENNRDLRVAALNIDAYAAQYRIQRADLFPAVSANASGSRQRVPARAS 120

Query: 117 TGQLDS------------DWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPS 163
                +             +++DLFG+ R + E +L    +        ++++++ +  +
Sbjct: 121 QTGEAAISSSYSATVGISAYELDLFGRVRSLSEQALQQYFATEEARRSTQISLVASVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  +  KE + +    L  ++++ +L+      G  S L L +    +++  + +    
Sbjct: 181 YLTWQADKELLKLTQDTLGAFEESYKLTSRSNEVGVASALDLAQSRTSVENARAQLARYT 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    + ++++ LLG      L   +  S++   ++      G+P+DL++ RPDI   E 
Sbjct: 241 RQVAQDENSLTLLLGTGIPANLQAAKPLSDDLLADVP----AGLPSDLLQRRPDILQAEY 296

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  +      +    F G +  W F P++ LPIF+ G +
Sbjct: 297 NLKAANANIGAARAAFFPSISLTANAGSLSPDLSGLFKGGSGTWLFQPQINLPIFNAGSL 356

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++++  A+         +++++  A +EV + L +     + +   +  V+ ++    L+
Sbjct: 357 RASLDYAKIQKDIGVANYEKSIQTAFQEVADGLAARQTYTEQLQAQRDFVQANQDYYRLA 416

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
              YR G  S L  LD +R     +  L   +     S V+LY A+G G+N
Sbjct: 417 ERRYRIGVDSNLTFLDAQRQLFSAQQSLITDRLAQLTSAVNLYKALGGGWN 467


>gi|107028348|ref|YP_625443.1| RND efflux system, outer membrane lipoprotein, NodT [Burkholderia
           cenocepacia AU 1054]
 gi|116686344|ref|YP_839591.1| RND efflux system outer membrane lipoprotein [Burkholderia
           cenocepacia HI2424]
 gi|105897512|gb|ABF80470.1| RND efflux system, outer membrane lipoprotein, NodT [Burkholderia
           cenocepacia AU 1054]
 gi|116652059|gb|ABK12698.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia cenocepacia HI2424]
          Length = 475

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 109/468 (23%), Positives = 193/468 (41%), Gaps = 22/468 (4%)

Query: 3   ILRAIFSLFIV-LLAGCTVGPEYTKPHMPL------LPTQFSIGNSKNLINID---TLKW 52
           + R + +L    +LAGCT+ P Y +P  P+      +P       +++         L W
Sbjct: 1   MKRTLIALVCTGVLAGCTLDPTYQRPAAPVDDTWSTVPALAQPKAAQSTAAAPLGADLGW 60

Query: 53  WESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL 112
            + F D  L KL+++AL  N  +  A   +   +      RA++ P+  AS S       
Sbjct: 61  RDFFKDPRLQKLIELALANNRDMRVAALNVAQYEAQYRIARANVGPAINASGSVTRERVA 120

Query: 113 KTNSTGQLD------SDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYI 165
            + S           + W+ID FG+ R ++        +  A     ++++I+ +   Y+
Sbjct: 121 GSTSAYSSSSASVGLTSWEIDFFGRLRSLKRQALEQYLATDAARTSTQISLIATVATDYL 180

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
             R  +  + IA   +D  +   +L+      G+ S   + + E  + S  S + +  ++
Sbjct: 181 QLRSDETSLQIAQNTVDADQHTYDLTVSMMKMGSASLQDVRQAENSLASARSSLASYTRA 240

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
              + +N+   +G P  +     Q  S     N +  I  G+P+DL+  RPDI   E  L
Sbjct: 241 VAQDRNNLVAEIGAPLPD--DLPQGASLMESENTFADIGEGVPSDLLARRPDIVEAEHTL 298

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG A++  +P + L  S   T     N F      W+F P + +PIFD G  ++
Sbjct: 299 KAANANIGAARAAFFPKIELTASAGTTSGSLSNLFKAGTGAWTFAPSISVPIFDFGYNRA 358

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            +  A+         +++ +  A KEV NAL         V   +  V   ++   L+  
Sbjct: 359 TLDVAKVEKDIDIANYEKAIQTAFKEVSNALAGRTTYVTQVAADRDYVNSAQQYYDLAQA 418

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            YR G  S L +LD +R     +  L         + V LY  +G G+
Sbjct: 419 RYRSGTDSFLTLLDAQRTLYAAQQQLVTDMLAKQSNLVTLYKVLGGGW 466


>gi|83718989|ref|YP_441238.1| RND efflux system outer membrane lipoprotein [Burkholderia
           thailandensis E264]
 gi|83652814|gb|ABC36877.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia thailandensis E264]
          Length = 519

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 106/461 (22%), Positives = 202/461 (43%), Gaps = 30/461 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIG------------NSKNLINIDTLKWWESFNDTSLNKL 64
           GCT+ P Y +P  P+     + G             S N      + W E F D  L +L
Sbjct: 18  GCTLAPRYERPAAPVSGAFPTDGVYAAQPGAAAGARSANGQAAVDIGWREFFVDPRLQRL 77

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSS-----------YASISHRFIPNLK 113
           ++IAL+ N  +  +   + A++      RA LFP+             A +S    P + 
Sbjct: 78  IEIALKNNRDLRVSVLNVEASRAQYRITRAGLFPTLDGTGTGTIQRTPAGVSVTGQPLIS 137

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                 + + W++DLFG+ + + + +LA   +       A++++++ +   Y+      +
Sbjct: 138 RTYNVGVSASWELDLFGRVQSLKDQALAQYFATAQARKAAEISLVASVADQYLTLLSTDD 197

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + I    L   + + +L+ L+F  G  S+L L + +  +++  ++     ++    V+ 
Sbjct: 198 LLQITENTLKTARASYDLTKLQFDNGTGSELDLRQAQTVVETALANQQAQARARAQAVNA 257

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G P  + L      +     NL   I  G+P+DL+  RPDI   E+ L  + A I
Sbjct: 258 LVLLIGEPLPDDLPAGLPLNA---QNLLTDIPAGLPSDLLTRRPDIMQAEETLRAANANI 314

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL G+           F      WSF P + LPIF+ G+  +N+  A  
Sbjct: 315 GAARAAFFPKISLTGAFGTASPTLGGLFKAGTAAWSFAPSIALPIFEGGQNIANLDLAHV 374

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             + +   +++ + +A +EV + L +     + +  L+      ++   LS + Y+ G  
Sbjct: 375 QKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRYDLSDLRYKNGVD 434

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 435 SYLSVLTAQTDLYSAQQQLISARLARWTNLVDLYRALGGGW 475


>gi|170733971|ref|YP_001765918.1| RND efflux system outer membrane lipoprotein [Burkholderia
           cenocepacia MC0-3]
 gi|169817213|gb|ACA91796.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia cenocepacia MC0-3]
          Length = 507

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 106/476 (22%), Positives = 203/476 (42%), Gaps = 29/476 (6%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQ-----------FSIGNSKNLINIDT 49
           M           +   GCT+ P Y +P  P+                +   S N      
Sbjct: 2   MQKHALTAIAVALFATGCTMAPHYKRPDAPVAQAYPAGGVYATQPGAAGARSANGQAATA 61

Query: 50  LKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSS--------- 100
           + W E F D  L +L++IAL+ N  +  +   I AA+      RA LFP+          
Sbjct: 62  IGWREFFVDPRLQRLIEIALKNNRDLRVSVLNIEAARAQYQITRAGLFPTLDGTGTGSIQ 121

Query: 101 --YASISHRFIPNLKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVI 157
              A +S    P +       L + W++DLFG+ + + + +LA   S       ++++++
Sbjct: 122 RFPAGVSQTGQPLISRTYNVGLSASWELDLFGRVQSLKDQALAQYLSTAYARQASEISLV 181

Query: 158 SKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIES 217
           S++   Y+      + + +    L   + + +L+ L+F  G  S+L L + +  +++  +
Sbjct: 182 SQVADQYLTLLSTDDLLKVTEDTLKTAQASYDLTKLQFDNGTGSELELRQAQTVVETALA 241

Query: 218 DIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPD 277
           +     ++    ++ +  L+G P  + L            NL   +  G+P+DL+  RPD
Sbjct: 242 NQQAQARARAQALNALVLLIGEPLPDDLPAGMPLDA---QNLLTDVPAGLPSDLLTRRPD 298

Query: 278 IRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPI 334
           +   E+ L  + A IG A++  +P +SL G+           F      WSF P + LPI
Sbjct: 299 VMQAEQTLLAANANIGAARAAFFPKISLTGAFGTASPTLGGLFKAGTAAWSFAPSIALPI 358

Query: 335 FDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHK 394
           F+ G+  +N+  A    + +   +++ + +A +EV + L +     + +  L+      +
Sbjct: 359 FEGGQNIANLDLAHVQKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQ 418

Query: 395 KSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +   LS + Y+ G  S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 419 RRFDLSDLRYKNGVDSYLSVLTAQTDLYSAQQSLISARLARWTNLVDLYRALGGGW 474


>gi|227819849|ref|YP_002823820.1| NodT, RND efflux system, outer membrane lipoprotein [Sinorhizobium
           fredii NGR234]
 gi|227338848|gb|ACP23067.1| putative NodT, RND efflux system, outer membrane lipoprotein
           [Sinorhizobium fredii NGR234]
          Length = 515

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 129/449 (28%), Positives = 225/449 (50%), Gaps = 16/449 (3%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTIL 76
           GC VGP+Y +P   L     S    K     +  +WW  F D  L+ L+  A++ NL + 
Sbjct: 40  GCVVGPDYEQPRFALPTHWGSKEEQKPARPPELSQWWRQFRDPLLDTLIAEAVEGNLDVA 99

Query: 77  QATERINAAKENILSVRADLFPSSYASISHRFI----------PNLKTNSTGQLDSDWKI 126
            A  +I  A+      +  L PS   S S              P++     G  D+ W++
Sbjct: 100 LAKAKIREARATYREQQGTLLPSVDGSASATRTRSTSSVAGSEPSVYNQYQGGFDASWEL 159

Query: 127 DLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYK 185
           DLFG  R  +E++    ++A  ++    + ++  +   YI AR ++  +++A +     +
Sbjct: 160 DLFGGNRRGLEAARYGAEAAEEELRDTLVTLVGDVTSYYIQAREYQSLLALARRSAASQR 219

Query: 186 KNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFL 245
           +  +L+  +   G  + +   K +A+  S E+DIPT + S+   VH +S L+G P     
Sbjct: 220 ETAKLTREQLAAGEATGVDDAKADAQATSTEADIPTYQISYAQTVHRLSILIGQPPAALE 279

Query: 246 HYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSL 305
             ++K      P   +    GIPADL+ NRPD+R  E++LA S AKIG A+++ YPS+SL
Sbjct: 280 GRLKKGGAVPLPKSPVA--AGIPADLLVNRPDVRLAERQLAQSTAKIGQAEANRYPSISL 337

Query: 306 NGSIALTHDNSFPGYNTH---WSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETV 362
            G  A +  ++          WSFGP L +PIF+ G++K+ +  A++   + Y  +Q  V
Sbjct: 338 TGDTATSALSTSDLGKKSSIGWSFGPTLTVPIFNGGQLKATVDVAKAQRDQYYAAYQAAV 397

Query: 363 LNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATA 422
           L+A+++VENA+ S+++ +    KL  +   ++++  LS      G    LD+LD ER+  
Sbjct: 398 LSAMEDVENAIVSLSQTRARYAKLTSSTASYRRAAELSRTLNEAGAVDFLDVLDAERSLY 457

Query: 423 KVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             E  L  ++  +A  ++ L  A+G G++
Sbjct: 458 TAEEALIRSRADIAIYFIALNKALGGGWD 486


>gi|323527225|ref|YP_004229378.1| NodT family RND efflux system, outer membrane lipoprotein
           [Burkholderia sp. CCGE1001]
 gi|323384227|gb|ADX56318.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. CCGE1001]
          Length = 506

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 110/461 (23%), Positives = 209/461 (45%), Gaps = 30/461 (6%)

Query: 17  GCTVGPEYTKPHMPLLP-------------TQFSIGNSKNLINIDTLKWWESFNDTSLNK 63
           GCT+ P+Y +P  P+                      S N +    + W + F D  + +
Sbjct: 17  GCTMAPKYERPAAPVTSTFPTGGVYDAQPGAAQPGARSANGMAAADIGWRDFFVDPRMQR 76

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL----------K 113
           L++IAL+ N  +  +   + A++     VRA LFP+  A+ S                  
Sbjct: 77  LIEIALKNNRDLRVSVLNMQASQAQFRIVRAGLFPTLDAAASQTKQRTPKNLSVFGNTIS 136

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
            + +  L++ W+ID FG+ + + + +LA   +       A+++++S++   Y+      +
Sbjct: 137 NSYSVGLNASWEIDFFGRVQSLKDQALAQYLATTQARKAAEISLVSQVANQYLTVLELDD 196

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + +    L   +++  ++ L+F  G  S+L L + +  ++   +++ + E+      + 
Sbjct: 197 LLKVTQGTLKTAEESYRITKLQFDNGTGSELDLRQAQTVVEQAGANLQSQERLRAQAENA 256

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  LLG P    L      S+    NL   I  G+P+DL+  RPDI   E+ L  + A I
Sbjct: 257 LVLLLGEPLPADLPPGLTLSD---QNLLTDIPAGLPSDLLTRRPDIMEAEENLLAANANI 313

Query: 293 GIAKSDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL GS    + T    F   +  WSF P + LPIF+ G+ K+N+  A  
Sbjct: 314 GAARAAFFPKVSLTGSFGTLSPTLGGLFKPGSAAWSFAPSITLPIFEGGQNKANLDLANI 373

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
               Q  T+++ +  A +EV +AL +     + +  L+      ++ + LS + Y  G  
Sbjct: 374 QKNAQIATYEKAIQTAFREVADALAARGTYDQQIQSLERNTFAQQRRLDLSNLRYTNGVD 433

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S L +L  +      +  L  A+ +  ++ V LY A+G G+
Sbjct: 434 SYLSVLTAQTDLYSSQQSLITARMERLQNLVTLYQALGGGW 474


>gi|186474286|ref|YP_001861628.1| RND efflux system outer membrane lipoprotein [Burkholderia phymatum
           STM815]
 gi|186475415|ref|YP_001856885.1| RND efflux system outer membrane lipoprotein [Burkholderia phymatum
           STM815]
 gi|184191874|gb|ACC69839.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia phymatum STM815]
 gi|184196618|gb|ACC74582.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia phymatum STM815]
          Length = 496

 Score =  208 bits (528), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 113/462 (24%), Positives = 209/462 (45%), Gaps = 24/462 (5%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
            + +   + L+GC +GP+Y++P + +  T     N  +  ++   +WW+ F+D  LN L+
Sbjct: 9   PLCAFCALTLSGCLLGPDYSRPQVEVPATYRFPENYAS--DVANTEWWKQFDDPVLNDLI 66

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF-------------IPNL 112
             AL  N  +  A  R++      ++ RA LFP   A +                    +
Sbjct: 67  TAALANNNDVKIAAARVDQFLGQFVTTRAALFPQVSAGLDAARERVSTSSPLFTGVQNPV 126

Query: 113 KTNSTGQLDSDWKID-LFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
             +    L + W+ID     RR  E++ A+L S         L ++S +  SYI+ R   
Sbjct: 127 FNSYQLALSASWEIDLFGHNRRLTEAARASLLSTEEARRGTILTLVSSVASSYINLRSLD 186

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
            ++ IA        +++ +  L+F  G  S++ L + ++E +   + IP +E        
Sbjct: 187 RQLEIAKATTASRAESVHVFELRFQGGEVSQMELAQSQSEYEDSRARIPQIESQIAQQED 246

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
            +S LLG    + L                 +  G+P++L+  RPD+R  E+ L  + A+
Sbjct: 247 ALSVLLGRNPGDILR-----GRALGELAAPAVPAGLPSNLLERRPDLRQAEQDLVAANAQ 301

Query: 292 IGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
           IG AK+  +P +S+ G +          F G    WSF   +  PIF+ G I   +++AE
Sbjct: 302 IGAAKALYFPQISITGLLGTQSGQFSRLFTGPARVWSFAGSVTQPIFEGGAIAGQVKQAE 361

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           +  Q+   T+++ +  A +EV++AL S  + ++        V+       L+ + Y  G 
Sbjct: 362 AVQQQALYTYRKAIQVAFQEVDDALISSQKLREQFEVQGRQVQALATYAHLARLRYEGGY 421

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            S +++LD ER+    ++  +  +  +  SYV LY A+G G+
Sbjct: 422 TSYIEVLDAERSLFNAQLSETQTQAGVLVSYVSLYKAMGGGW 463


>gi|78067407|ref|YP_370176.1| RND efflux system outer membrane lipoprotein [Burkholderia sp. 383]
 gi|77968152|gb|ABB09532.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. 383]
          Length = 507

 Score =  208 bits (528), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 104/476 (21%), Positives = 201/476 (42%), Gaps = 29/476 (6%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIG-----------NSKNLINIDT 49
           M           +   GCT+ P Y +P  P+     + G            S N      
Sbjct: 2   MQKHALTAIAVALFATGCTMAPHYKRPDAPVAQAYPAGGVYATQPGAAGARSANGQAATA 61

Query: 50  LKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS---- 105
           + W E F D  L +L++IAL+ N  +  +   I AA+      RA LFP+   + +    
Sbjct: 62  IGWREFFVDPRLQRLIEIALKNNRDLRVSVLNIEAARAQYQITRAGLFPTLDGTGTGNVQ 121

Query: 106 -------HRFIPNLKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVI 157
                      P +  +    L + W++DLFG+ + + + +LA   S        +++++
Sbjct: 122 RIPQGLSTTGAPMISRSYNVGLSASWELDLFGRVQSLKDQALAQYLSTSYARQAQEISLV 181

Query: 158 SKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIES 217
           S++   Y+      + + +    L   + +  L+ LKF  G  S+L L + +  +++  +
Sbjct: 182 SQVADQYLTLLSTDDLLKVTEDTLKSAQDSYNLTKLKFDNGTGSELDLRQAQTVVETALA 241

Query: 218 DIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPD 277
              +  +     ++ +  L+G P  + L            NL   +  G+P+DL+  RPD
Sbjct: 242 SQQSQARDRAQALNYLVLLIGEPLPDDLPAGMPLDA---QNLLTDVPAGLPSDLLTRRPD 298

Query: 278 IRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPI 334
           +   E+ L  + A IG A++  +P +SL G+           F      WSF P++ +PI
Sbjct: 299 VMQAEQTLLAANANIGAARAAFFPKISLTGAFGTGSPTLGGLFKAGTAAWSFAPQITMPI 358

Query: 335 FDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHK 394
           F+ G+  +N+  A    + +   +++ + +A +EV + L +     + +  L+      +
Sbjct: 359 FEGGQNIANLNLAHVQKRIEIANYEKAIQSAFREVADGLAARGTYDQQIAALERNEHAQQ 418

Query: 395 KSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +   LS + Y+ G  S L +L  +      +  L  A+     + V LY A+G G+
Sbjct: 419 RRYDLSDLRYKNGVDSYLSVLTAQTDLYNAQQSLISARLARWTNLVTLYRALGGGW 474


>gi|257140096|ref|ZP_05588358.1| RND efflux system outer membrane lipoprotein [Burkholderia
           thailandensis E264]
          Length = 513

 Score =  208 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 106/461 (22%), Positives = 202/461 (43%), Gaps = 30/461 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIG------------NSKNLINIDTLKWWESFNDTSLNKL 64
           GCT+ P Y +P  P+     + G             S N      + W E F D  L +L
Sbjct: 12  GCTLAPRYERPAAPVSGAFPTDGVYAAQPGAAAGARSANGQAAVDIGWREFFVDPRLQRL 71

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSS-----------YASISHRFIPNLK 113
           ++IAL+ N  +  +   + A++      RA LFP+             A +S    P + 
Sbjct: 72  IEIALKNNRDLRVSVLNVEASRAQYRITRAGLFPTLDGTGTGTIQRTPAGVSVTGQPLIS 131

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                 + + W++DLFG+ + + + +LA   +       A++++++ +   Y+      +
Sbjct: 132 RTYNVGVSASWELDLFGRVQSLKDQALAQYFATAQARKAAEISLVASVADQYLTLLSTDD 191

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + I    L   + + +L+ L+F  G  S+L L + +  +++  ++     ++    V+ 
Sbjct: 192 LLQITENTLKTARASYDLTKLQFDNGTGSELDLRQAQTVVETALANQQAQARARAQAVNA 251

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G P  + L      +     NL   I  G+P+DL+  RPDI   E+ L  + A I
Sbjct: 252 LVLLIGEPLPDDLPAGLPLNA---QNLLTDIPAGLPSDLLTRRPDIMQAEETLRAANANI 308

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL G+           F      WSF P + LPIF+ G+  +N+  A  
Sbjct: 309 GAARAAFFPKISLTGAFGTASPTLGGLFKAGTAAWSFAPSIALPIFEGGQNIANLDLAHV 368

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             + +   +++ + +A +EV + L +     + +  L+      ++   LS + Y+ G  
Sbjct: 369 QKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRYDLSDLRYKNGVD 428

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 429 SYLSVLTAQTDLYSAQQQLISARLARWTNLVDLYRALGGGW 469


>gi|34557171|ref|NP_906986.1| putative outer membrane channel protein [Wolinella succinogenes DSM
           1740]
 gi|34482887|emb|CAE09886.1| PUTATIVE OUTER MEMBRANE CHANNEL PROTEIN [Wolinella succinogenes]
          Length = 468

 Score =  208 bits (527), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 110/460 (23%), Positives = 207/460 (45%), Gaps = 20/460 (4%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
           A+     +LLAGC++ P+     + +     ++      + +  ++WW  F D  L +L+
Sbjct: 6   AVILAGALLLAGCSMSPKLELKPVEIP---LALAKEAKTMEVINVEWWREFKDPLLEELI 62

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF-----------IPNLKT 114
           K AL  N  +  A   ++ A+  +   RADL+PS  A  S                    
Sbjct: 63  KEALVHNSDLRVAATNVSLARATLGGARADLYPSLDAEGSAGRKKTSDESYPVGTRATYN 122

Query: 115 NSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
           N +      ++IDL+G+ R    S+ A L +  A  +   L V S +   Y +    +E 
Sbjct: 123 NFSLSGVLSYEIDLWGRLRDSKRSAEALLLANEANQETIALAVASSVAEGYFNLITLREG 182

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
           I I  + +D Y+K+ +    +   GA S++ + +   E++S ++++   E+        +
Sbjct: 183 IQILKETVDSYQKSYDYRLKQHGLGAISEIVMEQSRVELESAKANLYLYERQESEAATAL 242

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
           S LLG    E        ++         +  G+P++++ +R DI+  E+KL  +   IG
Sbjct: 243 SILLGRTPKEIFEKSFSLASVLP--ALPEVPAGLPSEILTHRSDIKVAEEKLKAANYSIG 300

Query: 294 IAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESS 350
           +A++  +P+LSL+G +       D         WS G  L  P+ + G+  + +  A++ 
Sbjct: 301 VARAAYFPTLSLSGVLGYQSAELDRLMRPSGEMWSLGGNLGAPLLNFGRTSAKVESAKAQ 360

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
            +   I ++ T+  A  EV++AL       K +  LQ       + + ++   + +G +S
Sbjct: 361 KESAEIEYEATIRQAFGEVKDALVKREVANKRLLSLQSQTTSQNRVLEIAQKRFDEGHFS 420

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            LD+LD +R      + L+ AK + A S V LY A+G G+
Sbjct: 421 HLDLLDAQRGYLNARLALNSAKLETATSVVTLYKALGGGW 460


>gi|222082588|ref|YP_002541953.1| nodulation protein (outer membrane efflux protein) [Agrobacterium
           radiobacter K84]
 gi|221727267|gb|ACM30356.1| nodulation protein (outer membrane efflux protein) [Agrobacterium
           radiobacter K84]
          Length = 502

 Score =  208 bits (527), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 127/459 (27%), Positives = 229/459 (49%), Gaps = 15/459 (3%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
           A       +L  C VGP+Y KP++ L        +SK   + +  +WW+ F D +LN L+
Sbjct: 23  AAVLCCTTILTSCVVGPDYEKPNVALPSRWSGQASSKTATSPNLTEWWKQFRDPTLNALI 82

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP---------NLKTNS 116
           + A+Q NL +  A  +I  A+      +  L P+   + S              ++    
Sbjct: 83  EEAVQTNLDVATAKAKIREARATYREQKGTLLPTVEGTASATRNRVAASDGAAASVYNEF 142

Query: 117 TGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERIS 175
               D+ W++DLFG  +   E++   +D+A   +    + ++  +   Y+ AR ++    
Sbjct: 143 QPGFDASWELDLFGGNKRSAEAARYGVDAAEEDLRDTLVTLVGDVTTYYVQAREYQALRD 202

Query: 176 IAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIST 235
           +A +     +K   L+  +F  G  + +       E  S E+DIPT + S+  +VH ++ 
Sbjct: 203 LAKRTAVSQRKTAALTQEEFAAGTVTGVDAANANGEASSTEADIPTYQISYAQSVHKLAV 262

Query: 236 LLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIA 295
           LLG P       ++  +    P   + ++ GIPA+++ +RPD+R  E++LA   AKIG+A
Sbjct: 263 LLGKPPAALDERLK--ATAAIPQPPLKVSTGIPANILTSRPDVRLAERQLAQYTAKIGVA 320

Query: 296 KSDLYPSLSLNGSIALTHDNSFP---GYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQ 352
           +++ YPS+SL GSI  +  +           W+FGP L +PIF  G++K+ +  A++   
Sbjct: 321 EANRYPSISLTGSITSSATDLADLGRKSTIGWAFGPTLTVPIFQGGQLKAAVDVAKAERD 380

Query: 353 EQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLL 412
           + YI +Q  VL A+++VENA+ S+ ++K    KL  +   ++ +  LS    + G    L
Sbjct: 381 QYYIAYQAAVLTAMQDVENAIVSLTQEKIKNAKLVSSASSYRTAADLSRQLNKAGATDFL 440

Query: 413 DILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           ++LD ER+    E  L  +K  +A  Y+ L+ A+G G++
Sbjct: 441 NVLDAERSLYSAESSLIQSKAAIATDYISLHKALGGGWD 479


>gi|167572873|ref|ZP_02365747.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia oklahomensis C6786]
          Length = 481

 Score =  208 bits (527), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 105/462 (22%), Positives = 199/462 (43%), Gaps = 30/462 (6%)

Query: 16  AGCTVGPEYTKPHMPLL------------PTQFSIGNSKNLINIDTLKWWESFNDTSLNK 63
            GCT+ P Y +P  P+             P   S   S N      + W E F D  L +
Sbjct: 2   TGCTLAPRYERPAAPVSGAFPTDGVYAAQPGAASGARSANGQTAADIGWREFFVDPRLQR 61

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLD-- 121
           L+ IAL+ N  +  +   + A++      RA LFP+   + +          ST      
Sbjct: 62  LIDIALKNNRDLRVSVLNVEASRAQYQITRAGLFPTLDGTGTGAIQRYPSGVSTTGRPLI 121

Query: 122 ---------SDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
                    + W++DLFG+ + + + +LA   +       A++++++ +   Y+      
Sbjct: 122 SRAYNVGVSASWELDLFGRVQSLKDQALAQYFATAQARKAAEISLVASVADQYLALLSTD 181

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
           + + +    L   + + +L+ L+F  G  S+L L + +  +++  ++     ++    V+
Sbjct: 182 DLLQVTENTLKTARASYDLTKLQFDNGTGSELDLRQAQTVVETALANQQAQARARAQAVN 241

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
            +  L+G P  + L      +     NL   I  G+P+DL+  RPDI   E+ L  + A 
Sbjct: 242 ALVLLVGEPLPDDLPAGLPLNA---QNLLTDIPAGLPSDLLTRRPDIMQAEETLRAANAN 298

Query: 292 IGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
           IG A++  +P +SL G+           F      WSF P + LPIF+ G+  +N+  A 
Sbjct: 299 IGAARAAFFPKISLTGAFGTASPTLGGLFKAGTAAWSFAPSIALPIFEGGQNIANLDLAH 358

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
              + +   +++ + +A +EV + L +     + +  L+      ++   LS + Y+ G 
Sbjct: 359 VQKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRYDLSDLRYKNGV 418

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 419 DSYLSVLTAQTDLYSAQQQLISARLARWSNLVDLYRALGGGW 460


>gi|296157260|ref|ZP_06840096.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. Ch1-1]
 gi|295892596|gb|EFG72378.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. Ch1-1]
          Length = 515

 Score =  208 bits (527), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 106/486 (21%), Positives = 206/486 (42%), Gaps = 39/486 (8%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLL----------------------PTQFSI 38
           M     I     +  AGCT+ P+Y +P  P+                       P     
Sbjct: 1   MQKHSLIAVAVALFAAGCTMAPKYERPAAPVTATFPTGGVYDTQPGATQPGQQQPGTTGA 60

Query: 39  GNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFP 98
             + N      + W + F D  + +L++IAL+ N  +  +   + A+      VRA L P
Sbjct: 61  ARTANGQAAADIGWRDFFVDPRMQRLIEIALKNNRDLRVSVLNMQASAAQFRIVRAGLLP 120

Query: 99  SSYASISHRFIPNL----------KTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYA 147
           +  A+ S                   + +  L++ W+ID FG+ + + + +LA   +   
Sbjct: 121 TLDAAASQSKSRTPKDLSFFDQTISNSYSVGLNASWEIDFFGRIQSLKDQALAQYLATAQ 180

Query: 148 QVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVK 207
               A++ ++S++   Y+      + + +    L   +++  ++ L+F  G  S+L L +
Sbjct: 181 ARKAAEITLVSQVANQYMTVLELDDLLKVTENTLKTSQESYRIAKLQFDNGTGSELDLRQ 240

Query: 208 LEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGI 267
            +  ++   +++   ++      + +  LLG P  +    +         NL   I  G+
Sbjct: 241 SQTVVEQASANLQQQQRLRAQADNALVLLLGEPLPDD---LPPGMTLDNQNLLTDIPAGL 297

Query: 268 PADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHW 324
           P+DL+  RPDI   E+ L  + A IG A++  +P +SL GS      +    F   +  W
Sbjct: 298 PSDLLTRRPDIMEAEENLLAANANIGAARAAFFPKVSLTGSFGTLSPSLGGLFKPGSAAW 357

Query: 325 SFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVT 384
           SF P + LPIF+ G+  +N+  A    + Q  T+++ +  A +EV + L +     + + 
Sbjct: 358 SFAPSITLPIFEGGQNLANLDLANIQKKVQIATYEKAIQTAFREVADGLAARGTYDQQIQ 417

Query: 385 KLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYI 444
            L+      ++ + LS + Y  G  S L +L  +      +  L  A+ +  ++ V LY 
Sbjct: 418 ALERNTFAEQRRLDLSNLRYTNGVDSYLSVLTAQTDLYSSQQLLVTARMERLQNLVTLYQ 477

Query: 445 AIGSGY 450
           A+G G+
Sbjct: 478 ALGGGW 483


>gi|170720210|ref|YP_001747898.1| RND efflux system outer membrane lipoprotein [Pseudomonas putida
           W619]
 gi|169758213|gb|ACA71529.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Pseudomonas putida W619]
          Length = 484

 Score =  208 bits (527), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 97/470 (20%), Positives = 198/470 (42%), Gaps = 24/470 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINID----TLKWWESF 56
           M       ++   +L GC++ P+Y  P  P+              + D       W + F
Sbjct: 1   MTKSLLSLAVTAFILGGCSLIPDYQTPEAPVAAQWPQGPAYSPTESADVAAAEQGWRQFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           +D +L +L++ +L  N  +  A   ++A +      RADLFP+  A+ S          S
Sbjct: 61  HDPALQQLIQTSLVNNRDLRVAALNLDAYRAQYRIQRADLFPAVSATGSGSRQRVPADMS 120

Query: 117 TGQL------------DSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPS 163
           T                S +++DLFG+ R +         S+       ++ +++ +  +
Sbjct: 121 TTGEANITSQYSATLGVSAYELDLFGRVRSLTEQALETYLSSEQARRSTQIALVASVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y   +  +    +  + L  Y+++  L+      G  S L L +    ++         +
Sbjct: 181 YYTWQADQALFKLTEETLKTYEESYNLTRRSNEVGVASALDLSQARTAVEGARVKYSQYQ 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    ++++++ L+G      L    +   +    +      G+P+D+++ RPDI+  E 
Sbjct: 241 RLVAQDLNSLAVLVGTGIPANLPKPLELDADQLAEVP----AGLPSDILQRRPDIQEAEH 296

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  +      +    F G +  W F P++ LPIF+ G +
Sbjct: 297 LLKAANANIGAARAAFFPSISLTANAGTLSPDMDGLFKGGSGTWLFQPQINLPIFNAGSL 356

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           K+++  ++         +++T+  A +EV + L +    ++ +   +  V+ ++    L+
Sbjct: 357 KASLDYSKIQKDINVAKYEKTIQTAFQEVSDGLAARKTFEEQLQAQRDLVQANQDYYRLA 416

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              YR G  S L  LD +R     +  L   +     S V+LY A+G G+
Sbjct: 417 ERRYRIGIDSNLTFLDAQRNLFSAQQSLITDRLSQLTSEVNLYKALGGGW 466


>gi|77920683|ref|YP_358498.1| outer membrane protein [Pelobacter carbinolicus DSM 2380]
 gi|77546766|gb|ABA90328.1| outer membrane protein [Pelobacter carbinolicus DSM 2380]
          Length = 503

 Score =  208 bits (527), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 125/454 (27%), Positives = 239/454 (52%), Gaps = 19/454 (4%)

Query: 16  AGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINID-TLKWWESFNDTSLNKLVKIALQQNL 73
           + C  VGP+Y  P +       S  +   + +   T+ WW +F D  L++ ++ A + NL
Sbjct: 34  SSCIAVGPDYAPPDIKTPDDWRSGQDPALVPDQSVTVDWWATFEDPLLDQYIEQAGRNNL 93

Query: 74  TILQATERINAAKENILSVRADLFPSSYA-----------SISHRFIPNLKTNSTGQLDS 122
            I QA  RI  A+ ++ + R   +P + A           +  +      +T     LD+
Sbjct: 94  DIRQAVSRIREARASLGAARGAWWPEANAKGSAIRQRSSENGMYSTGGKTETLYNTGLDA 153

Query: 123 DWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQIL 181
            W+IDLFG+ RR +E++ A+  ++        ++V +++  +Y D R ++ R++ A   +
Sbjct: 154 SWEIDLFGRIRRSVEAAQADYQASEEDRRDVLISVFAEVARTYFDIRTYQARLAAAQGNI 213

Query: 182 DLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPA 241
           +  ++ ++L+  +F  G  + L + + E  + + +++IP L+     +V+ ++ LLG   
Sbjct: 214 ESQQQVLKLTRSRFRNGLATGLDVAQAEQVLAASQAEIPPLQVGLTRSVNTLAVLLGQAP 273

Query: 242 TEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYP 301
                 ++K +    P     + +G+PADL+R RPDIR  E++LA   A+IG+A +DLYP
Sbjct: 274 GSLSEQLEKPAPIPVP--PARVAVGVPADLLRQRPDIRRAERQLAAQTARIGVATADLYP 331

Query: 302 SLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITW 358
           SLSL+G+ A       N   G +  + FGP L   +FD G++++ I   ++  ++  +++
Sbjct: 332 SLSLSGTFAFEAIDAGNLLKGSSRAFGFGPTLRWMLFDGGRVRAQIAVQDAKTEQALLSY 391

Query: 359 QETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIE 418
           +++VL A+ EVENAL+     +  ++ L+ +V+  ++S+ L+   YR G     ++LD +
Sbjct: 392 EQSVLEALNEVENALSQYLNQRNRLSALERSVQAAQRSLKLATRLYRDGLVDFQNVLDAQ 451

Query: 419 RATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           R+    E  L+ A+   +   V LY  +G G+NP
Sbjct: 452 RSLFDNENQLAAARGDTSIYLVQLYKTLGGGWNP 485


>gi|221064714|ref|ZP_03540819.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Comamonas testosteroni KF-1]
 gi|220709737|gb|EED65105.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Comamonas testosteroni KF-1]
          Length = 495

 Score =  208 bits (527), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 110/466 (23%), Positives = 217/466 (46%), Gaps = 22/466 (4%)

Query: 2   NILRAIFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFS-IGNSKNLINIDTLKWWESFNDT 59
            +  A  +L  V+L GC ++ P    P +P+     + +G+  +  +   L W   F D 
Sbjct: 12  RLRAASLALSAVVLTGCMSLAPAPDTPPLPVPEAWPAHLGSGTDGAHAGELAWQAYFTDP 71

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQ 119
            L +L++ AL+ N  +  A  R+  A       R+D FP+                +   
Sbjct: 72  LLQRLIETALENNRDLRVAALRVEEASATFRIQRSDRFPAMGVGAQGGRARVPGDLNMSG 131

Query: 120 LD------------SDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYID 166
                         + W++DL+G+ R++ +++L    ++ A      L +I+++   Y+ 
Sbjct: 132 RSQVGGEYRAEVGLTTWELDLWGRIRNLEDAALQTWLASDAARQAVHLALIAQVADGYLG 191

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
            R   ER++IA Q +   +++  +   +   G+TSKL L +++  +   ++ +  LE++ 
Sbjct: 192 LREIDERVAIARQTVTTREESYRIFRRRVEVGSTSKLDLTQVQTLLNQAQALLTQLEQAR 251

Query: 227 RMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLA 286
              +H ++ L+G         +  ++   +  +   +  G+P++L+ +RPDI   E +L 
Sbjct: 252 TTQLHALALLVGADPG----PLPAKAPFDETTVLAELRAGLPSELLVSRPDIISAEHQLR 307

Query: 287 DSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSN 343
            S A IG A++   P ++L GS      +    F   +  W+F P L LPIFD G+ ++N
Sbjct: 308 ASNAHIGAARAAFLPRIALTGSFGTASSDLNGLFDSGSRAWTFMPTLSLPIFDGGRRRAN 367

Query: 344 IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
           +  +E         +++T+  A +EV +AL++ +   + +T  +  +E   +   L+ + 
Sbjct: 368 LELSEVRRDIAVAGYEKTIQTAFREVADALSAKHWLAEQLTIQRANLEAQSERARLAKLR 427

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           Y  G  + L++LD +R     +  L  A+R L  S V LY A+G G
Sbjct: 428 YDNGSAAFLEVLDAQRDLLGAQQQLVQARRALLSSQVALYAALGGG 473


>gi|170690255|ref|ZP_02881422.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia graminis C4D1M]
 gi|170144690|gb|EDT12851.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia graminis C4D1M]
          Length = 491

 Score =  208 bits (527), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 118/464 (25%), Positives = 214/464 (46%), Gaps = 25/464 (5%)

Query: 5   RAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKL 64
           R +  L +  L GC +GP Y +P    +P  F     +     +T+ WWE F D  LN+L
Sbjct: 8   RLLAVLVLTSLYGCLLGPNYERPKTE-VPATFRFSMEQTAETANTV-WWEQFQDPVLNEL 65

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST------- 117
           +  AL  NL +  A  R+   +   ++ R+ LFP   A+         ++ +        
Sbjct: 66  IAAALADNLDVKIAAARVEEFRGQFVTTRSGLFPQVGANFDASRQRASQSGAVPLPAGVG 125

Query: 118 -------GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                    + + W+IDLFG+ RR  E++ ANL ++        L++++ +  SYI+ R 
Sbjct: 126 AVYNQVDASVSASWEIDLFGKIRRQSEAARANLLASEEGRRGTILSLVASVASSYINLRS 185

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
             +++ IA   +     ++ +  L+F  G  S+L L + ++E ++  + +P LE    + 
Sbjct: 186 LDKQLDIAKATVQSRADSVNVFTLRFKGGEVSQLELAQSQSEYQAARATLPQLEAQIAVQ 245

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
              ++ LLG      +      +          I  G+P+DL+  RPD+   E+ L    
Sbjct: 246 EDALAVLLGRNPEPIVRGHDLDALAA-----PTIPSGLPSDLLERRPDLLQAEQNLVAQN 300

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           A IG A++  +PS+SL G       +    F G    WSF   + LPIF  G I+  + +
Sbjct: 301 ALIGAARALYFPSISLTGLFGSLSTDFASLFSGPARIWSFAGAVSLPIFTAGNIEGQVHQ 360

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
           AE+  QE    +++ +  A +EV +AL ++ +  + ++     V        L+ + Y  
Sbjct: 361 AEARQQEALFAYRKAIQVAFQEVSDALINLQKSGEQLSVQGDQVNALAMYAHLARLRYEG 420

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           G  S +++LD ER+    ++  +  +     S+V+LY A+G G+
Sbjct: 421 GYTSYIEVLDAERSLFNAQLSYTQTQGVQLTSFVNLYKAMGGGW 464


>gi|312797142|ref|YP_004030064.1| Type I secretion outer membrane protein [Burkholderia rhizoxinica
           HKI 454]
 gi|312168917|emb|CBW75920.1| Type I secretion outer membrane protein [Burkholderia rhizoxinica
           HKI 454]
          Length = 533

 Score =  208 bits (527), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 109/478 (22%), Positives = 209/478 (43%), Gaps = 31/478 (6%)

Query: 1   MNILR--AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIG------------NSKNLIN 46
           M  +    I      L++ CT  P+Y +P  P+  T    G               N + 
Sbjct: 28  MKPMSKLPICVAVAALVSACTFQPKYERPAPPVASTFAQSGVYATQPRVAPGQQGANGVA 87

Query: 47  IDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH 106
              + W E FND  L +L++++L  N  +  A  ++  A       RADLFP+  A    
Sbjct: 88  AADIGWREFFNDPRLQRLIELSLNNNRDLAVAVLKVQQAAAQYRVTRADLFPTLDAVGRE 147

Query: 107 RFIPNL----------KTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLN 155
                               +  L + W+ID +G+ R + + +LA   +       A++ 
Sbjct: 148 TKTRTPRNLSFLDRTISNQYSVGLSASWQIDFWGRVRSLKDQALAQYLATAQARKAAEIL 207

Query: 156 VISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSI 215
           ++S++   Y+      E++++  + LD    +  L+ L+F  G  S+L L + +  ++  
Sbjct: 208 LVSQVADQYLAVLAADEQLAVTQRTLDTASASYHLAKLQFDTGMGSELDLHQSQGIVEQA 267

Query: 216 ESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNR 275
            +++   ++      + +  L+G P  E    +         +L   I  G+P++L+  R
Sbjct: 268 RANLQAQQRVRAQAENALVLLVGQPLPED---LPAGLPLHAQSLLADIPAGLPSELLTRR 324

Query: 276 PDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYL 332
           PD+   E++L  + A IG A++  +P++SL G+    + T D  F   +  W F PK+ L
Sbjct: 325 PDVMEAEQRLLAANANIGAARAAFFPNISLTGNFGTLSPTLDGLFKPGSAAWGFTPKIDL 384

Query: 333 PIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVEL 392
           PIF+ G   +N++ A+   +     +++ +  A +EV + L +     + +  L   V  
Sbjct: 385 PIFEGGLNVANLQLADVGKKIAIAQYEKAIQTAFREVADGLAARGTYDQQIQSLDRYVAS 444

Query: 393 HKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            ++ + LS + YR G  S L++L  +      +  L  A+     + VDLY  +G G+
Sbjct: 445 QQRRLELSELRYRNGVDSYLNVLTAQTDLYSAQQSLISARLNRLTNLVDLYQYLGGGW 502


>gi|94987437|ref|YP_595370.1| outer membrane efflux protein [Lawsonia intracellularis PHE/MN1-00]
 gi|94731686|emb|CAJ55049.1| outer membrane efflux protein [Lawsonia intracellularis PHE/MN1-00]
          Length = 459

 Score =  207 bits (526), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 117/462 (25%), Positives = 228/462 (49%), Gaps = 16/462 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M  L  +  +  V+++ C+  P+Y +PH+ L     S   S       +++WW+ FND++
Sbjct: 1   MKRL-LLCIITCVIVSSCSFAPDYNRPHLELPEVWVS---SPETGVPASMQWWKRFNDST 56

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYA-------SISHRFIPNLK 113
           L+ LV  ALQ N  ++ A  R++ A+  +   R+DLFP            + H+ + + +
Sbjct: 57  LDILVAEALQHNRDLIAAVARVDYAQAQLGVARSDLFPHFSGNAQATPVWVDHKRVTDGQ 116

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
           +  +    + W+ID++G+ R+  +++ + L +  A+ +   L++ ++   +Y   R    
Sbjct: 117 SPYSANFSASWEIDIWGKIRNAKDAAFSQLMATEAEKEGVFLSIAAQTANAYFLLRSLDL 176

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
           + SIA + +   +  + +   ++ +G  +KL L + + E+++  + +     +       
Sbjct: 177 QCSIAERTVKTREDALSIYTAQYQKGFINKLDLTRAKTEVETARTALYQKRIAQENAETA 236

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQP-NLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
           +S LLG      +    ++  + +  +    I  GIP++L+  RPDIR  E  L  + A 
Sbjct: 237 LSVLLGRSPRLIMDTAIERGVSMKDLSCIPVIPQGIPSELLERRPDIRQAEYTLKATSAN 296

Query: 292 IGIAKSDLYPSLSLNGSIALTHDNSFP---GYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
           IG+A++   PS+SL G   +   +           WS+G    +PI D G++  N+  A+
Sbjct: 297 IGVARAAWLPSISLTGLFGIVSPHLSDLLKNPLKTWSYGETGTVPILDFGQVYYNVEAAQ 356

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           +  +E    +++TV NA K++ +AL    E K IV  L+  V+  + ++ L+   Y  G 
Sbjct: 357 AKEREALANYEKTVQNAFKDIHDALIRQYESKNIVNSLERMVKELRIAVHLARTLYDNGY 416

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            S LD+LD ERA  + E+DL+ A      S V + +A+G  +
Sbjct: 417 TSYLDVLDAERALFQSELDLASAWSDRLSSIVQVCLALGGSW 458


>gi|77917904|ref|YP_355719.1| outer membrane protein OmpK [Pelobacter carbinolicus DSM 2380]
 gi|77543987|gb|ABA87549.1| outer membrane protein OmpK [Pelobacter carbinolicus DSM 2380]
          Length = 474

 Score =  207 bits (526), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 108/469 (23%), Positives = 212/469 (45%), Gaps = 26/469 (5%)

Query: 4   LRAIFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLI------NIDTLKWWESF 56
           ++ + ++   LLAGC T+ P YT+P  P+  +       +         +   + W E F
Sbjct: 8   IKLLAAILTFLLAGCGTLAPRYTRPASPVPVSWPEGSAYQPAAEGTETRSAAEVGWREFF 67

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
            +  L KL+++AL+ N  +  +  +I  A+      RADLFP+   +          + S
Sbjct: 68  ANEKLRKLMELALENNRDLRVSALKIEKARAQYRIQRADLFPTLSIAGKGSVNRTPASLS 127

Query: 117 T------------GQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPS 163
           T            G   S ++ D FG+ R + + +L    +       A++ +I+++  +
Sbjct: 128 TTGKRGTFEEYSVGLGMSSYEFDFFGRVRSLKDQTLEEYFATEEARRSAQITLIAEVATA 187

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y      +ER+ +A Q L  ++   EL+  +F  G  +KL + + +  + S   DI    
Sbjct: 188 YQTLAADRERLDLARQTLKSHQATYELTRSRFQAGLATKLEVRQAQTSVDSTLVDIARYT 247

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
                + + +  L+G   T+F   +   + +        I  G+P+++++ RPDI   E 
Sbjct: 248 SLTAEDENALRFLVG---TDFSSALLPAALDEAVTDLKDIPAGVPSEVLQRRPDILAAEH 304

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKI 340
           +L  + A IG A++  +P ++L  S     D   + F G    W+F P++ LPIF+ G++
Sbjct: 305 RLMGANANIGAARAAFFPRITLTASGGFASDALSSLFEGATGTWAFAPRIELPIFNAGRL 364

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++ ++ ++         ++  +  A +EV +AL         +   +  VE   +S  LS
Sbjct: 365 RAQLKTSKVDRDIYLARYEGAIQGAFREVADALAQRGTIDDQLLAQRSLVEATDESYILS 424

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
              +R+G  S L++LD +R+    + +L   +     ++V LY  +G G
Sbjct: 425 EARFRKGIDSFLNVLDSQRSLYDAQQNLITIRLARLDNFVKLYRVLGGG 473


>gi|300309818|ref|YP_003773910.1| drug efflux lipoprotein [Herbaspirillum seropedicae SmR1]
 gi|300072603|gb|ADJ62002.1| drug efflux lipoprotein [Herbaspirillum seropedicae SmR1]
          Length = 483

 Score =  207 bits (526), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 110/459 (23%), Positives = 212/459 (46%), Gaps = 20/459 (4%)

Query: 7   IFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVK 66
              +   +L GC++ P Y +P  P+  +  +    +  +    L W + F D  L +L+ 
Sbjct: 17  AALVMAGVLGGCSLAPTYERPQAPVESSYPADAAGRAELQAVNLGWRQFFPDQRLQQLIA 76

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDS---- 122
            AL+ N  +  A   I  A+      RADL P+   S +        + S     +    
Sbjct: 77  AALENNRDLRTAVLNIEEARAQYQIARADLLPNLNLSGNAARTRTAASQSLTGQPTISNS 136

Query: 123 --------DWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
                    +++D FG+ R++ +++LA+  S       A++++++++  +Y+  R + E+
Sbjct: 137 YQVGLAVPAYELDFFGRVRNLKDAALASYLSTEEAQKSAQISLVAQVAQAYLAERSYAEQ 196

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
           + +A + L   + N++L+  +   GA++ L     +  ++S       LE+      + +
Sbjct: 197 LKLADETLKSRQSNLDLAQKRLDVGASTALDFRLTQTLVESARVAKTQLERQRAQAENAL 256

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
           + L+G    E    +          +   I  G+P+DL+ NRPDIR  E+ L  + A IG
Sbjct: 257 TLLVGKKIGE----LPPAQLLSDEKIVTDIPAGLPSDLLTNRPDIRSAEQSLLAANANIG 312

Query: 294 IAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESS 350
            A++  +P +SL G+           F   +  WSFGP L LPIFD G+  +N+  AE  
Sbjct: 313 AARAAFFPRISLTGNFGSASSTLGGLFESGSGAWSFGPSLSLPIFDFGRNSANLDLAEVR 372

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
             +  +T+++ +  A +EV +AL +     + V   +  +   ++ + L+ + ++ G  S
Sbjct: 373 KNKAVVTYEKAIQTAFREVADALVARGSLDEQVKAQEAFLAAQQERLKLTDLRFKNGIAS 432

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
            LD LD +R     +  L  A++    + +DLY A+G G
Sbjct: 433 SLDQLDAQRDLFSAQQALIQARQLRLNNAIDLYKALGGG 471


>gi|167645051|ref|YP_001682714.1| RND efflux system outer membrane lipoprotein [Caulobacter sp. K31]
 gi|167347481|gb|ABZ70216.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Caulobacter sp. K31]
          Length = 482

 Score =  207 bits (526), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 119/457 (26%), Positives = 221/457 (48%), Gaps = 16/457 (3%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKI 67
               ++LL+ C VGP+Y  P    +  Q +   + +  N    +WW++F D  L+ LV  
Sbjct: 26  LFASMLLLSACAVGPDYKTPVDAPVVVQNAPAGAFSTAN-PEAQWWKAFGDPVLDGLVTQ 84

Query: 68  ALQQNLTILQATERINAAKENILSVRADLFPSSYASISH----------RFIPNLKTNST 117
           AL  NL I  A  R++ A+      R D  P   A  S+                     
Sbjct: 85  ALAGNLDIKVAVARVDEARALFKDARLDQLPRVTADGSYVKSDQQQPGSNGQRVESETYQ 144

Query: 118 GQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISI 176
           G  D+ W+IDLFG+ R  +ES+ A   +A A +  A++ + +++  +Y++ R  + R+++
Sbjct: 145 GGFDAGWEIDLFGRVRRGVESARAEAGAAKADLRDAQVTIAAEVARNYLELRGAQARLAV 204

Query: 177 AHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL 236
           A++ LD  ++ + L+ +++  GA + + +   +A + + E+ IP+L  + +   + +  L
Sbjct: 205 ANRNLDTQRETLRLTKVRYDAGAGNPIDVASAQARLNATEAAIPSLITAEKHANYRLCVL 264

Query: 237 LGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
            G         +  Q+    P L   + IG  ADL+R RPDI+  E++LA   AK+G+A 
Sbjct: 265 TGQRPGALDATLVVQNAEVTP-LITALPIGDAADLLRRRPDIQAAERRLAAQTAKVGVAT 323

Query: 297 SDLYPSLSLNGSIAL---THDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQE 353
           +DL+P + + G I     +        +  WS  P +  P  D G     ++ A++    
Sbjct: 324 ADLFPRVRVTGFIGFLSGSASGFGNSASQAWSVAPSVTWPALDLGGAHQRLKAAQARNDA 383

Query: 354 QYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLD 413
               + +TVL A++++ENAL    + +  +  L +     +++  L+ I Y++G    L 
Sbjct: 384 SLAVYDQTVLTALEDLENALVGYRQQQAQLVSLTNQAAASRRAAELARIQYKEGGIDFLV 443

Query: 414 ILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +LD ER     E  L++A+  +  + V +Y A+G G+
Sbjct: 444 LLDAERTLLAAEDSLTVAETGVNTNVVAIYKALGGGW 480


>gi|73543124|ref|YP_297644.1| RND efflux system, outer membrane lipoprotein, NodT [Ralstonia
           eutropha JMP134]
 gi|72120537|gb|AAZ62800.1| RND efflux system, outer membrane lipoprotein, NodT [Ralstonia
           eutropha JMP134]
          Length = 496

 Score =  207 bits (526), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 118/465 (25%), Positives = 196/465 (42%), Gaps = 27/465 (5%)

Query: 11  FIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLIN--------IDTLKWWESFNDTSLN 62
              +L GCT+ P+Y +P  P+                          + W E F D  L 
Sbjct: 11  VAGVLTGCTLAPKYERPVPPVAAGFPGAPEGYATAEVKSGETRRATDIGWREFFRDPRLQ 70

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKT-------- 114
            L+  +L+ N  + QA  RI  A+      RADL P+  A+  +                
Sbjct: 71  TLIATSLENNRDLRQAALRIEEARSLYQIQRADLLPTVNANAGYTRARTSAAQTATVLGQ 130

Query: 115 ------NSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
                  S G   S +++D FG+ R +  ++LA   +       A ++++S++  +Y+  
Sbjct: 131 PSVSDLYSVGLGISSYELDFFGRVRSLSNAALAQYFATEEAHRSAYISLVSEVAKAYLSE 190

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
           R F E+  IA   L   +    L+  +F  GATS L L   E+ +         L +   
Sbjct: 191 RSFAEQYEIARDTLKARESTYALAKQRFDVGATSALDLRDNESLVAQARVSAAQLARQRA 250

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
              + +  L+G P     +  +    +    +   I  G+P+DL+  RPDIR  E+ L  
Sbjct: 251 QAQNALEVLVGKPIGSIENLPEPMRLS-DERIISDIPEGLPSDLLEQRPDIRQAEQLLLS 309

Query: 288 SVAKIGIAKSDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNI 344
           + A IG A++  +P ++L  +I   + T    F      WSF P+L LPIFD G+ KSN+
Sbjct: 310 ANANIGAARAAFFPRITLTTNIGTISPTFSGLFDAGTKAWSFAPQLTLPIFDYGRNKSNL 369

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
             A      +   +++T+  A  EV +AL +    +  V   +           L+ + +
Sbjct: 370 DLANVRKNIEVANYEKTIQTAFAEVADALVARGTLEDQVAGQEQVRNAEAARYELARLRF 429

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           R G  S LD LD +R     E  L  A++    + +DLY ++G G
Sbjct: 430 RSGVASYLDELDAQRQLFTAEQALIQARQLRLNNSIDLYRSLGGG 474


>gi|254250324|ref|ZP_04943643.1| RND efflux system, outer membrane lipoprotein, NodT [Burkholderia
           cenocepacia PC184]
 gi|124879458|gb|EAY66814.1| RND efflux system, outer membrane lipoprotein, NodT [Burkholderia
           cenocepacia PC184]
          Length = 506

 Score =  207 bits (526), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 103/476 (21%), Positives = 200/476 (42%), Gaps = 29/476 (6%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQ-----------FSIGNSKNLINIDT 49
           M           +   GCT+ P Y +P  P+                +   S N      
Sbjct: 3   MQKHALTAIAVALFATGCTMAPHYKRPDAPVAQAYPAGGVYATQPGAAGARSANGQAATA 62

Query: 50  LKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI 109
           + W E F D  L +L++IAL+ N  +  +   I AA+      RA LFP+   + +    
Sbjct: 63  IGWREFFVDPRLQRLIEIALKNNRDLRVSVLNIEAARAQYQITRAGLFPTLDGTGTGNIQ 122

Query: 110 PNL-----------KTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVI 157
                                L + W++DLFG+ + + + +LA   S       ++++++
Sbjct: 123 RYPQGVSPTNQAYISRTYNVGLSASWELDLFGRVQSLKDQALAQYLSTAYARQASEISLV 182

Query: 158 SKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIES 217
           S++   Y+      + + +    L   + + +L+ L+F  G  S+L L + +  +++  +
Sbjct: 183 SQVADQYLTLLSTDDLLKVTEDTLKTAQASYDLTKLQFDNGTGSELELRQAQTVVETALA 242

Query: 218 DIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPD 277
           +     ++    ++ +  L+G P  + L            NL   +  G+P+DL+  RPD
Sbjct: 243 NQQAQARARAQALNALVLLIGEPLPDDLPAGMPLDA---QNLLTDVPAGLPSDLLTRRPD 299

Query: 278 IRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPI 334
           +   E+ L  + A IG A++  +P +SL G+           F      WSF P + LPI
Sbjct: 300 VMQAEQTLLAANANIGAARAAFFPKISLTGAFGTASPTLGGLFKAGTAAWSFAPSIALPI 359

Query: 335 FDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHK 394
           F+ G+  +N+  A    + +   +++ + +A +EV + L +     + +  L+      +
Sbjct: 360 FEGGQNIANLDLANVQKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQ 419

Query: 395 KSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +   LS + Y+ G  S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 420 RRFDLSDLRYKNGVDSYLSVLTAQTDLYSAQQSLISARLARWTNLVDLYRALGGGW 475


>gi|283834148|ref|ZP_06353889.1| cation efflux system protein CusC [Citrobacter youngae ATCC 29220]
 gi|291070298|gb|EFE08407.1| cation efflux system protein CusC [Citrobacter youngae ATCC 29220]
          Length = 460

 Score =  207 bits (525), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 105/463 (22%), Positives = 210/463 (45%), Gaps = 18/463 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINI---DTLKWWESFN 57
           M+  + +    + +LAGC++ P+Y +P +P +P QFS+  +  +          W   F 
Sbjct: 1   MSKFKLLTLSAVFVLAGCSLAPDYQRPALP-VPQQFSLSQNALVSAPVGYQDTGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST 117
           D  +  L+  AL  N  +  A  ++  A+       AD +P   A  S  +   LK +S+
Sbjct: 60  DPQVKALIGEALANNRDLRMAVLKVQEARAQYGVTDADRYPQITAGSSGTYSGKLKGDSS 119

Query: 118 ------GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                   L+  + +D FG+ +   E+   N  ++        +++IS +  SY + R  
Sbjct: 120 TDREFEAGLNLSFDLDFFGRLKNMSEADRQNFFASEEARRAVHISLISNVSQSYFNQRLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+T+ L+L +    I+S  S+I   +       
Sbjct: 180 YAQLQIAEETLQNYQRSYAFVEKQLVTGSTNVLALEQARGVIESTRSEIAKRKGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +      ++ +      + +   +P+ ++  RPDI   E  L  + A
Sbjct: 240 NALQLLLG----TYGKLPDDRARSDGDIKPVTLPPSLPSQILLQRPDILEAEHGLMAANA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS++L  S + +     N F   +  W+F PK+ +PIF+ G+ +SN+  A
Sbjct: 296 NIGAARAAFFPSITLTSSASSSSSDLSNLFNAASGMWNFVPKIDIPIFNAGRNQSNLDLA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + +A KEV +AL         ++  Q  +   + ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKIQSAFKEVADALDLRQSIADQISGQQRYLTSLQITLQRARALYQNG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             S +++LD ER+    +  L         + + L+ A+G G+
Sbjct: 416 AVSYIEVLDAERSLFATQQSLLDLNYSQQVNEIKLFAALGGGW 458


>gi|217419053|ref|ZP_03450560.1| outer membrane efflux protein OprM [Burkholderia pseudomallei 576]
 gi|217398357|gb|EEC38372.1| outer membrane efflux protein OprM [Burkholderia pseudomallei 576]
          Length = 558

 Score =  207 bits (525), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 104/461 (22%), Positives = 200/461 (43%), Gaps = 30/461 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIG------------NSKNLINIDTLKWWESFNDTSLNKL 64
           GCT+ P Y +P  P+     + G             S N      + W E F D  L +L
Sbjct: 64  GCTLAPRYERPAAPVSGAFPADGVYAAQPGAAPGARSANGQAAVDIGWREFFVDPRLQRL 123

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSS-----------YASISHRFIPNLK 113
           ++IAL+ N  +  +   + A++      RA LFP+             A +S    P + 
Sbjct: 124 IEIALKNNRDLRVSVLNVEASRAQYQITRAGLFPTLSGTGTGTIQRTPAGVSITGQPLIS 183

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                 + + W++DLFG+ + + + +LA   +       A++++++ +   Y+      +
Sbjct: 184 RTYNVGVSASWELDLFGRVQSLKDQALAQYFATAQARKAAEISLVASVADQYLTLLSTDD 243

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + +    L   + + +L+ L+F  G  S+L L + +  +++  +      ++    ++ 
Sbjct: 244 LLQVTQNTLKSARASYDLTKLQFDNGTGSELDLRQAQTVVETALASQQAQARARAQALNA 303

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G P  + L      +     NL   I  G+P+DL+  RPDI   E+ L  + A I
Sbjct: 304 LVLLIGEPLPDDLPAGLPLNA---QNLLTDIPAGLPSDLLTRRPDIMQAEETLRAANANI 360

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL  +           F      WSF P + LPIF+ G+  +N+  A  
Sbjct: 361 GAARAAFFPKISLTSAFGTASPTLGGLFKAGTAAWSFAPNIALPIFEGGQNIANLDLAHV 420

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             + +   +++ + +A +EV + L +     + +  L+      ++   LS + YR G  
Sbjct: 421 QKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRYDLSDLRYRNGVD 480

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 481 SYLSVLTAQTDLYSAQQQLISARLARWTNLVDLYRALGGGW 521


>gi|237728471|ref|ZP_04558952.1| copper/silver efflux system outer membrane protein CusC
           [Citrobacter sp. 30_2]
 gi|226909949|gb|EEH95867.1| copper/silver efflux system outer membrane protein CusC
           [Citrobacter sp. 30_2]
          Length = 562

 Score =  207 bits (525), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 97/464 (20%), Positives = 208/464 (44%), Gaps = 19/464 (4%)

Query: 1   MNILRAIFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINI---DTLKWWESF 56
           M  L+ +    I +LAGC ++ PEY +P  P +P QFS+  +     +       W   F
Sbjct: 102 MFKLKLLSISTIFILAGCVSLAPEYQRPPAP-VPQQFSLSKNSLTPAVNSYQDTGWRNFF 160

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP------ 110
            D  +++L+  AL  N  +  A  ++  A+       AD +P   AS    +        
Sbjct: 161 VDPQVSRLIGEALNNNRDLRMAALKVEEARAQFNVTDADRYPQLNASSGITYNGGLKGDK 220

Query: 111 NLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                    L+  +++D FG+ +   E+   N  ++        + ++S +  SY   + 
Sbjct: 221 PTTQEYDAGLELSYELDFFGKLKNMSEADRQNYFASEEARRAVHILLVSNVSQSYFSQQL 280

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
             E++ IA + L  Y+++      +   G+T+ L+L +   +I+S  ++I   E      
Sbjct: 281 AYEQLRIARETLKNYEQSYAFVEQQLVTGSTNVLALEQARGQIESTRAEIAKREGDLAQA 340

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            + +  +LG     +     ++         + +   + + ++  RPDI   E +L  + 
Sbjct: 341 NNALQLVLG----TYRAVPSEKGIKGGEIAPVKLPPNLSSQILLQRPDIMEAEYQLKAAD 396

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           A IG A++  +PS++L   ++ +     + F   +  W+F PK+ +PIF+ G+ K+N++ 
Sbjct: 397 ANIGAARAAFFPSITLTSGLSASSTELSSLFTSGSGMWNFIPKIEIPIFNAGRNKANLKL 456

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
           AE   Q+  + +++ + +A K+V + L   +   + +   Q  ++  + ++  +   Y  
Sbjct: 457 AEIRQQQSVVNYEQKIQSAFKDVSDTLALRDSLSQQLESQQRYLDSLQITLQRARGLYSS 516

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           G  S +++LD ER+    +  +         + ++L+ A+G G+
Sbjct: 517 GAVSYIEVLDAERSLFATQQTILDLTYSRQVNEINLFTALGGGW 560


>gi|167577931|ref|ZP_02370805.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia thailandensis TXDOH]
          Length = 493

 Score =  207 bits (525), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 105/461 (22%), Positives = 202/461 (43%), Gaps = 30/461 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIG------------NSKNLINIDTLKWWESFNDTSLNKL 64
           GCT+ P Y +P  P+     + G             S N      + W E F D  L +L
Sbjct: 1   GCTLAPRYERPAAPVSGAFPTDGVYAAQPGAAAGARSANGQAAVDIGWREFFVDPRLQRL 60

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSS-----------YASISHRFIPNLK 113
           ++IAL+ N  +  +   + A++      RA LFP+             A +S    P + 
Sbjct: 61  IEIALKNNRDLRVSVLNVEASRAQYQITRAGLFPTLDGTGTGTIQRTPAGVSVTGQPLIS 120

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                 + + W++DLFG+ + + + +LA   +       A++++++ +   Y+      +
Sbjct: 121 RTYNVGVSASWELDLFGRVQSLKDQALAQYFATAQARKAAEISLVASVADQYLTLLSTDD 180

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + +    L   + + +L+ L+F  G  S+L L + +  +++  ++     ++    V+ 
Sbjct: 181 LLQVTENTLKTARASYDLTKLQFDNGTGSELDLRQAQTVVETALANQQAQARARAQAVNA 240

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G P  + L      +     NL   I  G+P+DL+  RPDI   E+ L  + A I
Sbjct: 241 LVLLIGEPLPDDLPAGLPLNA---QNLLTDIPAGLPSDLLTRRPDIMQAEQTLRAANANI 297

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL G+           F      WSF P + LPIF+ G+  +N+  A  
Sbjct: 298 GAARAAFFPKISLTGAFGTASPTLGGLFKAGTAAWSFAPSIALPIFEGGQNIANLDLAHV 357

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             + +   +++ + +A +EV + L +     + +  L+      ++   LS + Y+ G  
Sbjct: 358 QKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRYDLSDLRYKNGVD 417

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 418 SYLSVLTAQTDLYSAQQQLISARLARWTNLVDLYRALGGGW 458


>gi|94312521|ref|YP_585731.1| RND efflux system outer membrane lipoprotein NodT [Cupriavidus
           metallidurans CH34]
 gi|93356373|gb|ABF10462.1| multidrug/solvent efflux outer membrane protein, RND family
           [Cupriavidus metallidurans CH34]
          Length = 491

 Score =  207 bits (525), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 116/463 (25%), Positives = 201/463 (43%), Gaps = 25/463 (5%)

Query: 11  FIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLIN--------IDTLKWWESFNDTSLN 62
              +L+GCT+ P Y +P  P+     +                    + W E F D  L 
Sbjct: 11  VAGVLSGCTMAPHYDRPAAPVAGGYPAAPEGYASAEVKSGETRRATEIGWREFFTDPRLQ 70

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKT-------- 114
            L++ AL+ N  +  A  RI  A+      RADL P+  A+   +               
Sbjct: 71  GLIEAALENNRDLRTAALRIEEARAQYQIQRADLLPTVNANAGFQRGRFSGASSGIDQSF 130

Query: 115 ----NSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                  G   + W++D FG+ R +  ++LA   +       A ++++S++  +Y+  R 
Sbjct: 131 TGNVYQVGLSVTQWELDFFGRVRSLSNAALAQYLATEEAHRAAYISLVSEVAKAYLAERA 190

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
           F E+  +A       +   EL+  +F+ GATS L L   E+ +         L +     
Sbjct: 191 FAEQYDLARDTYKARQSTYELAQKRFSAGATSALDLRDNESLVAQARVAAAQLARQRAQA 250

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            + +  L+G P  E  +       +   ++   I  G+P++L+  RPDIR  E++L  + 
Sbjct: 251 QNALEVLVGKPIAEIPNLPAPMRLS-DEHIISDIPEGLPSELLTQRPDIRQAEQQLLSAN 309

Query: 290 AKIGIAKSDLYPSLSLNGS---IALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           A IG A++  +P +++  +   I+ +  N F      WSF P+L LPIFD G+  SN+  
Sbjct: 310 ANIGAARAAFFPRITMTANAGTISTSFTNLFDSGAHVWSFAPQLVLPIFDYGRNMSNLDL 369

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
           +      Q   +++T+  A  EV +AL +    +  V   +   +       L+ + +R 
Sbjct: 370 SNVRKNIQIANYEKTIQTAFSEVADALVARGTLEDQVAGQEQQRDAEAARYELARMRFRS 429

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           G  S LD LD +R     E DL  A++    + +DLY A+G G
Sbjct: 430 GVASYLDELDAQRQLFSAEQDLVAARQLRLVNSIDLYRALGGG 472


>gi|134283507|ref|ZP_01770207.1| outer membrane efflux protein OprB [Burkholderia pseudomallei 305]
 gi|134245256|gb|EBA45350.1| outer membrane efflux protein OprB [Burkholderia pseudomallei 305]
          Length = 552

 Score =  206 bits (524), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 104/461 (22%), Positives = 200/461 (43%), Gaps = 30/461 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIG------------NSKNLINIDTLKWWESFNDTSLNKL 64
           GCT+ P Y +P  P+     + G             S N      + W E F D  L +L
Sbjct: 59  GCTLAPRYERPAAPVSGAFPADGVYAAQPGAAPGARSANGQAAVDIGWREFFVDPRLQRL 118

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSS-----------YASISHRFIPNLK 113
           ++IAL+ N  +  +   + A++      RA LFP+             A +S    P + 
Sbjct: 119 IEIALKNNRDLRVSVLNVEASRAQYQITRAGLFPTLSGTGTGTIQRTPAGVSITGQPLIS 178

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                 + + W++DLFG+ + + + +LA   +       A++++++ +   Y+      +
Sbjct: 179 RTYNVGVSASWELDLFGRVQSLKDQALAQYFATAQARKAAEISLVASVADQYLTLLSTDD 238

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + +    L   + + +L+ L+F  G  S+L L + +  +++  +      ++    ++ 
Sbjct: 239 LLQVTQNTLKSARASYDLTKLQFDNGTGSELDLRQAQTVVETALASQQAQARARAQALNA 298

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G P  + L      +     NL   I  G+P+DL+  RPDI   E+ L  + A I
Sbjct: 299 LVLLIGEPLPDDLPAGLPLNA---QNLLTDIPAGLPSDLLTRRPDIMQAEETLRAANANI 355

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL  +           F      WSF P + LPIF+ G+  +N+  A  
Sbjct: 356 GAARAAFFPKISLTSAFGTASPTLGGLFKAGTAAWSFAPNIALPIFEGGQNIANLDLAHV 415

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             + +   +++ + +A +EV + L +     + +  L+      ++   LS + YR G  
Sbjct: 416 QKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRYDLSDLRYRNGVD 475

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 476 SYLSVLTAQTDLYSAQQQLISARLARWTNLVDLYRALGGGW 516


>gi|124381814|ref|YP_001024205.1| outer membrane efflux protein OprB [Burkholderia mallei NCTC 10229]
 gi|254200519|ref|ZP_04906884.1| outer membrane efflux protein OprB [Burkholderia mallei FMH]
 gi|254204543|ref|ZP_04910896.1| outer membrane efflux protein OprB [Burkholderia mallei JHU]
 gi|147748131|gb|EDK55206.1| outer membrane efflux protein OprB [Burkholderia mallei FMH]
 gi|147754129|gb|EDK61193.1| outer membrane efflux protein OprB [Burkholderia mallei JHU]
          Length = 553

 Score =  206 bits (524), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 104/461 (22%), Positives = 200/461 (43%), Gaps = 30/461 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIG------------NSKNLINIDTLKWWESFNDTSLNKL 64
           GCT+ P Y +P  P+     + G             S N      + W E F D  L +L
Sbjct: 59  GCTLAPRYERPAAPVSGAFPADGVYAAQPGAAPGARSANGQAAVDIGWREFFVDPRLQRL 118

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSS-----------YASISHRFIPNLK 113
           ++IAL+ N  +  +   + A++      RA LFP+             A +S    P + 
Sbjct: 119 IEIALKNNRDLRVSVLNVEASRAQYQITRAGLFPTLSGTGTGTIQRTPAGVSITGQPLIS 178

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                 + + W++DLFG+ + + + +LA   +       A++++++ +   Y+      +
Sbjct: 179 RTYNVGVSASWELDLFGRVQSLKDQALAQYFATAQARKAAEISLVASVADQYLTLLSTDD 238

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + +    L   + + +L+ L+F  G  S+L L + +  +++  +      ++    ++ 
Sbjct: 239 LLQVTQNTLKSARASYDLTKLQFDNGTGSELDLRQAQTVVETALASQQAQARARAQALNA 298

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G P  + L      +     NL   I  G+P+DL+  RPDI   E+ L  + A I
Sbjct: 299 LVLLIGEPLPDDLPADLPLNA---QNLLTDIPAGLPSDLLTRRPDIMQAEETLRAANANI 355

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL  +           F      WSF P + LPIF+ G+  +N+  A  
Sbjct: 356 GAARAAFFPKISLTSAFGTASTTLGGLFKAGTAAWSFAPNIALPIFEGGQNIANLDLAHV 415

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             + +   +++ + +A +EV + L +     + +  L+      ++   LS + YR G  
Sbjct: 416 QKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRYDLSDLRYRNGVD 475

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 476 SYLSVLTAQTDLYSAQQQLISARLARWTNLVDLYRALGGGW 516


>gi|319782575|ref|YP_004142051.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317168463|gb|ADV12001.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 496

 Score =  206 bits (524), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 130/462 (28%), Positives = 231/462 (50%), Gaps = 17/462 (3%)

Query: 5   RAIFS--LFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLN 62
           R + +  L  VLLAGC VGP+Y  P + +         +K        KWW+   D  LN
Sbjct: 12  RRLLAPMLTAVLLAGCVVGPDYQTPILAMPANWSGQKPTKPAQPARLSKWWQRLRDPELN 71

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF---------IPNLK 113
            LV+ A+  NL +  A  +I  A+ +       L PS+  S S                 
Sbjct: 72  TLVEEAVAGNLDVATAKAKIREARASYRQSAGTLLPSADGSGSASRNKSAETTSGSDATY 131

Query: 114 TNSTGQLDSDWKID-LFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
           +      D+ W++D     RR +E++   L+++  ++    L ++  +   Y  AR ++ 
Sbjct: 132 SEYQAGFDASWELDLFGANRRGVEAARYGLNASQEELRSTLLTLVGDVASYYTQARGYQA 191

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
           RI++A +     ++  EL+      G  +   + K   +  S E+ +PTLE S+   VH 
Sbjct: 192 RIALARRSAASQRQTAELTRTMAQAGTATAADVAKAMGQAASTEAAVPTLEASYAQAVHR 251

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           ++ L G P       +++ +    P L   +  GIPADL+ +RPD+R  E++ A   AKI
Sbjct: 252 LAVLAGRPPASLNERLKRVAPIPAPRLP--MPTGIPADLLLSRPDLRMAERQYAQYTAKI 309

Query: 293 GIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  YPS+SL G I+       +     +  WSFGP L +P+F+ G++++ +  A++
Sbjct: 310 GQAEAARYPSVSLTGDISTAALKLGDLGKNSSIGWSFGPTLSVPLFNAGQLQAAVEFAKA 369

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
              + +I ++ +VL A+++VENAL  +++++  + KL  + + + ++ SL    Y+ G  
Sbjct: 370 QRDQYFIAYRSSVLTALEDVENALVLLSQERIRIGKLASSAKSYGEAASLEGTLYKAGET 429

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           SLLD+LD +R+    E  L  ++  LA +Y+ L  A+G G++
Sbjct: 430 SLLDVLDAQRSLYSAEDSLLQSRVLLATNYIALNKALGGGWD 471


>gi|121592755|ref|YP_984651.1| RND efflux system outer membrane lipoprotein [Acidovorax sp. JS42]
 gi|120604835|gb|ABM40575.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Acidovorax sp. JS42]
          Length = 480

 Score =  206 bits (524), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 111/458 (24%), Positives = 215/458 (46%), Gaps = 12/458 (2%)

Query: 5   RAIFSL-FIVLLAGCTVGPEYTKPHMPLLPTQF-SIGNSKNLINIDTLKWWESFNDTSLN 62
           RA+ +L   VLLAGC+  P Y +P  P+ PT   +  ++    +  ++ W + F D  L 
Sbjct: 13  RALSTLTAAVLLAGCSFIPHYERPAAPVPPTYPLASASAAAPQSAASIDWKDYFTDPRLQ 72

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLD- 121
           +L+ IAL  N  +  A   +  A+      RA+ FP+  A  S    P++ T S      
Sbjct: 73  RLIGIALDNNRDLRMAMLNVEQARAQFQIQRANQFPTVNAIASGTRQPSVTTGSYANQFQ 132

Query: 122 -----SDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERIS 175
                S W+ID FG+   ++    A   +       A++++++ +   ++     +E + 
Sbjct: 133 VGLGISAWEIDFFGRVAALKEQALAQYLATDEARKSAQISLVAAVASGWLTLMADEELLD 192

Query: 176 IAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIST 235
           I+ + L+   ++++L+ L+   G +S+L   + E+  ++  +     ++   ++ + +  
Sbjct: 193 ISRRTLETRDESVKLTRLRLENGVSSELDNRQAESLAQAARATYAQQQRQRMLDENALVL 252

Query: 236 LLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIA 295
           LLG P  + +      S          +  G+P+DL+  RPD+R  E++L  + A IG A
Sbjct: 253 LLGQPLPDDIRASLPSSRLADATPMQALPAGLPSDLLVRRPDVRMAEQQLIGANANIGAA 312

Query: 296 KSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQ 352
           ++  +P +SL        D     F   +  +S  P+L LPIFD G+ ++ +  A +  +
Sbjct: 313 RAAFFPRISLTAQFGTVSDELSGLFKSGSWAFSLAPQLALPIFDAGRNQAGLESARAGRE 372

Query: 353 EQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLL 412
                +++++  A +EV +AL      ++ V   +   +   K   LS + YR G  S L
Sbjct: 373 IAVAQYEKSIQTAFREVSDALAGQATLQEQVDAQRAQAQADAKRFELSDLRYRNGVASYL 432

Query: 413 DILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           D+LD +R+    +  L + + Q  ++ V LY  +G G+
Sbjct: 433 DLLDAQRSLFATQQSLVVTRLQQLQNQVTLYKVLGGGW 470


>gi|120553520|ref|YP_957871.1| RND efflux system outer membrane lipoprotein [Marinobacter
           aquaeolei VT8]
 gi|120323369|gb|ABM17684.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Marinobacter aquaeolei VT8]
          Length = 477

 Score =  206 bits (524), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 110/467 (23%), Positives = 218/467 (46%), Gaps = 18/467 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M +   + +L ++ L GC++ P   KP  P +P  ++         +  L WW  + D +
Sbjct: 1   MTVKVLLTTLMVLSLGGCSLAPTVKKPE-PSMPENWTSARLSADEKLP-LDWWRGYGDPA 58

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP---------- 110
           L  LV+ AL  N  +  A  R+  A+  +   +A+ +P      S               
Sbjct: 59  LVTLVEEALDANNDLQLAAARVAEARALLTGQQAERYPLLEVEGSAVRQGPSEESVNSTG 118

Query: 111 -NLKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
                +        +++DL+G+  +  E++ A L ++ A  +  +L VI ++   Y + R
Sbjct: 119 GQPFNDIQVGGVLSYELDLWGRLANASEAARARLLASAANREAVRLAVIGEVANGYFNLR 178

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
               +I IA + +   ++++ L   +F  G  ++L+L + E+E+ + ES++P L +   +
Sbjct: 179 ALDRQIDIAERTVSSRRESVALQRARFEGGEINELALRQAESELAAAESELPRLRQQRSL 238

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPN-LYIPINIGIPADLIRNRPDIRYQEKKLAD 287
             + ++ LLG      +      +N      +   I  G PADL+  RPDI   E++L  
Sbjct: 239 QRNALAVLLGRDPQRIVRSDISVANTIGEMDVPASIPAGRPADLMVRRPDIAAAEQELIA 298

Query: 288 SVAKIGIAKSDLYPSLSLNGS---IALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNI 344
           + A+IG+A++   P +S  G     + +  + F G  + W  G  L  P+ D G+ ++ +
Sbjct: 299 ANAEIGVARAAFLPRISFEGLLGLRSASGGDLFQGSASTWQLGGSLVGPLLDFGRSEALV 358

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
            +AE+  ++  I +++ +  A +EV +A+  +   +  +      V   + +  L+ + +
Sbjct: 359 NQAEARQRQALIAYRQAIQVAFREVLDAMAGVRGTEDRLEAQARQVAALRSTAKLARLRF 418

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             G  S L++LD ER+    E+DL   +R   +S V+LY A+G G+ 
Sbjct: 419 EGGASSYLEVLDAERSLFTTELDLVETRRDHLQSTVNLYRALGGGWQ 465


>gi|311105895|ref|YP_003978748.1| outer membrane protein OprM 2 [Achromobacter xylosoxidans A8]
 gi|310760584|gb|ADP16033.1| outer membrane protein OprM 2 [Achromobacter xylosoxidans A8]
          Length = 488

 Score =  206 bits (523), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 108/473 (22%), Positives = 210/473 (44%), Gaps = 26/473 (5%)

Query: 4   LRAIFSL-FIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINID-------TLKWWES 55
           +R + S+     LAGC++ P Y +P  P+     +  + +     D        + W + 
Sbjct: 5   MRTLLSVSLAAALAGCSLAPTYERPDAPVDTAYPTGPSYQAAQPADAGGLLTADIGWRDF 64

Query: 56  FN-DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL-- 112
           F  D  L +L++ +L  N  +  A   + AA+      RADL PS   +       +   
Sbjct: 65  FGSDPLLQQLIEQSLANNRDLRVAALNVEAARAQYRIQRADLMPSVGIAGQESAQRSPAD 124

Query: 113 ----------KTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLI 161
                      +   G   S W++DLFG+ R + + +L +  +        +L +I+++ 
Sbjct: 125 LSPSGRATTSHSYQVGAAMSAWELDLFGRIRSLSDKALESYLALDETRTATQLTLIAEVA 184

Query: 162 PSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPT 221
            +Y+  R  +E +S+  + L   + + +L+   + QG ++ L L + E  +++ E ++  
Sbjct: 185 NAYLTLRADQELLSLTRETLKSQQDSFKLTQQSYDQGLSTSLDLSQAEVSLRTAERNLSQ 244

Query: 222 LEKSFRMNVHNISTLLGYPA-TEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRY 280
             +    + + +  L+G P   E    +          L   +  G+P+DL+  RPDIR 
Sbjct: 245 YTRQAAQDRNALVLLVGQPLSPEMTAALDNAVRLDDGMLPTTLPAGLPSDLLARRPDIRA 304

Query: 281 QEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDK 337
            E +L  + A IG A++  +P++SL GS      +    F G +  WSF P++ +PIF  
Sbjct: 305 AEHQLKGANANIGAARAAFFPTISLTGSAGTASASLGGLFEGGSGAWSFVPQITVPIFAG 364

Query: 338 GKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSM 397
           G + + +  A+     Q   +++++    +EV +AL       + +   Q  V  ++++ 
Sbjct: 365 GSLLAGLDLAKVQKNIQVAQYEKSIQTGFREVADALAGRGTLDEQIQAQQLLVAANQRAY 424

Query: 398 SLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             S   +RQG    L +LD +R+    +  L   +R    + V LY  +G G+
Sbjct: 425 DASDQRFRQGIDDYLSVLDSQRSLYTAQQALVDTRRARLSNLVTLYKVLGGGW 477


>gi|262381296|ref|ZP_06074434.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
 gi|262296473|gb|EEY84403.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
          Length = 1494

 Score =  206 bits (523), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 106/450 (23%), Positives = 214/450 (47%), Gaps = 14/450 (3%)

Query: 11   FIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQ 70
             ++  + C +G  Y +P + L     +  ++ +  +++ + W   + D +L  L+K AL 
Sbjct: 1049 SMLAFSSCKIGKRYARPELNLPDRIEAYTDTTDTASVENIPWESLYADETLKDLIKKALD 1108

Query: 71   QNLTILQATERINAAKENILSVRADLFPSSYASISHR--------FIPNLKTNSTGQLDS 122
             N  +  A  ++           A++ P   A+I  +          P        +L  
Sbjct: 1109 NNKDMKIAAAKVKEMIAAKRISFANMLPEVGANIYAQKERLNYGGDDPKPDPEFGAKLTL 1168

Query: 123  DWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQIL 181
             W++DL+G  R    +++A+           +L +I+++  +Y       + +SI  Q L
Sbjct: 1169 SWELDLWGNLRWANEATIASYMQTVEGQRALRLTIIAEVAANYYQLCALDQELSIVQQTL 1228

Query: 182  DLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPA 241
            D  ++ + L+ L++  G TS+ +  + + E+   E+ IP+LE+  ++   ++S LLG   
Sbjct: 1229 DARREGVRLAKLRYEGGLTSETAYNQAQVELARTETLIPSLERQIKIKESDLSMLLG--- 1285

Query: 242  TEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYP 301
             E+   + +  +    +L   + IG+P+ L+  RPD+R  E KL  + A++G+A++DL+P
Sbjct: 1286 -EYTDDIPRGLSLSDQHLPDALPIGLPSSLLERRPDMRQAEFKLRAANAQVGVAQTDLFP 1344

Query: 302  SLSLNGSIALTHDNSFPG-YNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQE 360
             + L  +     D       +        L  PIF  GK K+ ++ A++  +++  ++++
Sbjct: 1345 KIRLTSNYGFESDELSSILKSPAGFIAGSLLQPIFAMGKNKAKVKAAKARYEQEVYSYEK 1404

Query: 361  TVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERA 420
            +VL A KEV NA+ ++ + K+I     +      K + L+ + Y  G  S +D+LD +R 
Sbjct: 1405 SVLGAFKEVNNAIVTVRKVKEIRASRMNLEASASKYLELAQLQYINGVISYMDVLDAQRG 1464

Query: 421  TAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
                ++ L+ A      S V LY A+G G+
Sbjct: 1465 LLDAQIGLNNAVLDELLSVVYLYKALGGGF 1494


>gi|260466898|ref|ZP_05813081.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Mesorhizobium opportunistum WSM2075]
 gi|259029294|gb|EEW30587.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Mesorhizobium opportunistum WSM2075]
          Length = 497

 Score =  206 bits (523), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 126/459 (27%), Positives = 228/459 (49%), Gaps = 15/459 (3%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
            +  +  VLLAGC VGP+Y  P + +         +K++      +WW+   D  L+ LV
Sbjct: 15  FVPMITAVLLAGCVVGPDYRTPILAMPANWSGERPTKSVQPAQLSRWWQRLRDPQLDTLV 74

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF---------IPNLKTNS 116
           + A+  NL +  A  +I  A+ +     A L PS   S S                 T  
Sbjct: 75  EEAVAGNLDVATAKAKIREARASYRQTAATLLPSVDGSGSVTRNKSADTTTGSNATYTEY 134

Query: 117 TGQLDSDWKID-LFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERIS 175
               D+ W++D     RR +E++   +D++  ++    L ++  +  +Y  AR ++ RI+
Sbjct: 135 QAGFDASWELDLFGANRRGLEAARYGVDASEQELRSTLLTLVGDVASTYTQARGYQARIA 194

Query: 176 IAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIST 235
           +A +     ++  EL+      G+ +   + K   +  S E+ +PTLE S+   VH +S 
Sbjct: 195 LARRSAVSQRQTAELTRTMALAGSATAADVAKAMGQAASTEASVPTLEASYAEAVHRLSV 254

Query: 236 LLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIA 295
           L G P       +++      P L   +  GIPAD++ +RPD+   E++ A   AK+G A
Sbjct: 255 LTGRPPAALSERLKRSKPIPSPRLP--MPTGIPADILLSRPDVLMAERQYAQYTAKVGQA 312

Query: 296 KSDLYPSLSLNGSIALTHDNSFPGYNTH---WSFGPKLYLPIFDKGKIKSNIRRAESSAQ 352
           ++  YPS+SL G+I+    +           WSFGP L +P+F+ G++++    A +   
Sbjct: 313 EAARYPSVSLTGNISTAALDLGDLGKNSSIGWSFGPTLSVPLFNAGQLQAAADVARAQRD 372

Query: 353 EQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLL 412
           + +I ++ +VL A+++VENAL  + +++  + KL  + + + ++ SL    Y+ G  SLL
Sbjct: 373 QYFIAYRASVLTALEDVENALVLMAQERIRIGKLASSAKSYGEAASLEGTLYKAGETSLL 432

Query: 413 DILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           D+LD +R+    E  L  ++  LA +Y+ L  A+G G++
Sbjct: 433 DVLDAQRSLYSAEDSLLQSRVLLATNYIALNKALGGGWD 471


>gi|157146840|ref|YP_001454159.1| copper/silver efflux system outer membrane protein CusC
           [Citrobacter koseri ATCC BAA-895]
 gi|157084045|gb|ABV13723.1| hypothetical protein CKO_02614 [Citrobacter koseri ATCC BAA-895]
          Length = 471

 Score =  206 bits (523), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 103/463 (22%), Positives = 208/463 (44%), Gaps = 18/463 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINID---TLKWWESFN 57
           M   + +    +++L GC++ P+Y +P +P +P QFS+  +  +          W   F 
Sbjct: 12  MRKFKLLTLSVMLVLTGCSLAPDYQRPALP-VPQQFSLSQNALVSAPAGYQETGWRTFFV 70

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST 117
           D  +  L+  AL+ N  +  AT ++  A+       AD +P   +  S  +   LK +S+
Sbjct: 71  DEQVKSLIGEALRNNRDLRMATLKVQEARAQYRVTDADRYPQLNSDASGSWEGKLKGDSS 130

Query: 118 ------GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                   L+  + +D FG+ +   E+   N  ++        + +IS +  SY + R  
Sbjct: 131 STREYEAGLNLSFDLDFFGRLKNMSEADRQNYFASEEARRAVHILLISNVAQSYFNQRLA 190

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L+ Y ++      +   G+T+ L+L +    I+S  SDI   +       
Sbjct: 191 YAQLQIAQETLENYTRSYAFVEKQLLTGSTTVLALEQARGVIESTRSDIAKRQGELAQAN 250

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +      ++ +      + +   + + ++  RPDI   E  L  + A
Sbjct: 251 NALQLLLG----TYSVLPDDRARDSGDIKNVTLPPSLSSQILLQRPDIMEAEHTLMAANA 306

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS++L   ++ +  +    F   +  W+F PK+ LPIF+ G+ ++N+  A
Sbjct: 307 NIGAARAAFFPSITLTSGVSGSSSDLSRLFNAASGMWNFIPKVELPIFNAGRNQANLDLA 366

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ +  A KEV +AL         +T  Q  +   + ++  +   Y+ G
Sbjct: 367 EIRQQQSVVNYEQKIQTAFKEVADALALRQSLTDQITAQQRYLSSLRITLQRARALYQHG 426

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             S +++LD ER+    +  L         + + L+ A+G G+
Sbjct: 427 AVSYIEVLDAERSLFSTQQTLLDLNYARQANEITLFTALGGGW 469


>gi|26988118|ref|NP_743543.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Pseudomonas putida KT2440]
 gi|71153371|sp|Q88N32|TTGC_PSEPK RecName: Full=Probable efflux pump outer membrane protein ttgC;
           Flags: Precursor
 gi|71153831|sp|P0C071|MEPC_PSEPU RecName: Full=Multidrug/solvent efflux pump outer membrane protein
           mepC; Flags: Precursor
 gi|24982847|gb|AAN67007.1|AE016329_2 multidrug/solvent RND outer membrane protein TtgC [Pseudomonas
           putida KT2440]
          Length = 484

 Score =  206 bits (523), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 97/470 (20%), Positives = 196/470 (41%), Gaps = 24/470 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINID----TLKWWESF 56
           M       ++   +L GC++ P+Y  P  P+              + D       W + F
Sbjct: 1   MTKSLLSLAVTAFILGGCSLIPDYQTPEAPVAAQWPQGPAYSPTQSADVAAAEQGWRQFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           +D +L +L++ +L  N  +  A   ++A +      RADLFP+  A+ S          S
Sbjct: 61  HDPALQQLIQTSLVNNRDLRVAALNLDAYRAQYRIQRADLFPAVSATGSGSRQRVPANMS 120

Query: 117 TGQLD------------SDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPS 163
                            S +++DLFG+ R +         S+       ++ +++ +  +
Sbjct: 121 QTGESGITSQYSATLGVSAYELDLFGRVRSLTEQALETYLSSEQARRSTQIALVASVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y   +  +    +  + L  Y+++  L+      G  S L + +    ++         +
Sbjct: 181 YYTWQADQALFKLTEETLKTYEESYNLTRRSNEVGVASALDVSQARTAVEGARVKYSQYQ 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    +V++++ LLG      L    +   +    +      G+P+D+++ RPDI+  E 
Sbjct: 241 RLVAQDVNSLTVLLGTGIPADLAKPLELDADQLAEVP----AGLPSDILQRRPDIQEAEH 296

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  +      +    F G    W F P++ LPIF+ G +
Sbjct: 297 LLKAANANIGAARAAFFPSISLTANAGSLSPDMGHLFSGGQGTWLFQPQINLPIFNAGSL 356

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           K+++  ++         +++T+  A +EV + L +    ++ +   +  V+ ++    L+
Sbjct: 357 KASLDYSKIQKDINVAKYEKTIQTAFQEVSDGLAARKTFEEQLQAQRDLVQANQDYYRLA 416

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              YR G  S L  LD +R     +  L   +     S V+LY A+G G+
Sbjct: 417 ERRYRIGIDSNLTFLDAQRNLFSAQQALIGDRLSQLTSEVNLYKALGGGW 466


>gi|332828972|gb|EGK01650.1| hypothetical protein HMPREF9455_02061 [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 458

 Score =  206 bits (523), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 105/459 (22%), Positives = 209/459 (45%), Gaps = 14/459 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M+  + I  + ++LL+ C +G +Y +P M +         S    +   + W   ++DT 
Sbjct: 1   MSKPKYILIISVILLSSCKIGQKYEQPEMNMPKAF--DAGSMATGDASDIGWSTLYSDTV 58

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASI--------SHRFIPNL 112
           L  L+  AL  N  +L A  RI           A+LFP     +                
Sbjct: 59  LQGLITKALGHNKDMLVAVARIKEMAAKKRISFANLFPEIGGELAGQKEHLNYGGDNSKY 118

Query: 113 KTNSTGQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
                  L+  W++D++G+ R    + +A             L +++++  SY + +   
Sbjct: 119 TPELRANLNVSWELDVWGKLRWANDAGVAAYMQTVEAQRALHLTIVAQVAQSYFELKALD 178

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
             + I  Q L+  ++ +  + L++  G TS++   +   E+   E+ IP LE   ++  +
Sbjct: 179 RELEIVKQTLEARREGVRFAKLRYEGGLTSEIPYRQSLVELARTETLIPNLENEIKLKEN 238

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
           ++  L+G   +  +  +    +     +   + + +P+ L++ RPD+   E+KL ++ A+
Sbjct: 239 DLFVLVGEFPSGSIPRVG--GDINHQLIPQSLPVDMPSSLLKRRPDMIQAEQKLIETNAR 296

Query: 292 IGIAKSDLYPSLSLNGSIALTHDNSFPG-YNTHWSFGPKLYLPIFDKGKIKSNIRRAESS 350
           +GIA ++++PSL+L G +   +D       +  W     L  PIF+ GK K+    A+++
Sbjct: 297 VGIAYTEMFPSLNLTGRLGGENDELSNFLKSPTWFISGVLTGPIFNMGKNKAAHNAAKAA 356

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
            +++  T++++VL A KEV N++ + N+ K++    +      K    L+ + Y  G  S
Sbjct: 357 YEQEVYTYEKSVLEAFKEVNNSIVTFNKMKEVYRSQEALYNSAKSYHELAKLQYVNGVIS 416

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
            +D+LD +R     E+ L+ A      S V LY  +G G
Sbjct: 417 YIDLLDAQRQFFDAEIALNTAILNELSSMVGLYKVLGGG 455


>gi|94971098|ref|YP_593146.1| RND efflux system, outer membrane lipoprotein, NodT [Candidatus
           Koribacter versatilis Ellin345]
 gi|94553148|gb|ABF43072.1| RND efflux system, outer membrane lipoprotein, NodT [Candidatus
           Koribacter versatilis Ellin345]
          Length = 464

 Score =  206 bits (523), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 126/467 (26%), Positives = 216/467 (46%), Gaps = 20/467 (4%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFS---IGNSKNLINIDTLKWWESFN 57
           MN  R + +L ++L+AGC VGP Y +P + +          G   N I++   KWW+ FN
Sbjct: 1   MNCKRILLALLLLLMAGCKVGPNYKRPAVTVPDAYRGPTLDGGQANGISLGEQKWWDVFN 60

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST 117
           D  L KL++ AL  N  +  A  R+  A+  +   RAD FP+     S       +    
Sbjct: 61  DEQLQKLIRQALDANYDVKIAATRVLQAQAALGITRADQFPTIAGGASALNERIPRVKGL 120

Query: 118 GQLDSD---------WKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
              ++          W++D +G+ R   E++ A+L S          +VIS +   Y   
Sbjct: 121 PAYENSALQVNLSLVWQLDFWGKYRRATEAARADLLSTEWGKRAVINSVISNVANGYFQL 180

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
                 + IA   L   ++++ L +++   G TS L + + E  + +  + IP LE+   
Sbjct: 181 LELDREMEIAKGTLASRQESLRLVNIRQKGGTTSLLDVRQSEQLLYTAAAAIPDLERRIE 240

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
              + IS LLG                  P++      G+P+ L+  RPD++  E++L  
Sbjct: 241 QEENFISILLGQNPGPIQRGKPLVEFAILPSVPP----GLPSTLLERRPDLQSAEQQLVA 296

Query: 288 SVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNI 344
           + A+IG+AK+D +P +SL              F G    WSFG +L  PIF  GKI+SN+
Sbjct: 297 ANARIGVAKADYFPQISLTALGGYQSSALTGLFSGPAGLWSFGGQLAQPIFTGGKIRSNV 356

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
           R  E+  QE    +Q+++  A +EV ++L +  ++++   +  +       +  L+ I Y
Sbjct: 357 RLTEAQQQEAVFRYQQSIQQAFREVSDSLVAYRKNQEFREQEANLAASAVDATRLARIRY 416

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             G  S L++LD +  +   E+ L+ A+     + V LY A+G G+ 
Sbjct: 417 EGGVSSYLEVLDNDTRSFDAEISLAQAQLGERVALVQLYNALGGGWQ 463


>gi|76818680|ref|YP_335239.1| RND efflux system outer membrane lipoprotein [Burkholderia
           pseudomallei 1710b]
 gi|76583153|gb|ABA52627.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia pseudomallei 1710b]
          Length = 551

 Score =  206 bits (523), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 104/461 (22%), Positives = 200/461 (43%), Gaps = 30/461 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIG------------NSKNLINIDTLKWWESFNDTSLNKL 64
           GCT+ P Y +P  P+     + G             S N      + W E F D  L +L
Sbjct: 58  GCTLAPRYERPAAPVSGAFPADGVYAAQPGAAPGARSANGQAAVDIGWREFFVDPRLQRL 117

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSS-----------YASISHRFIPNLK 113
           ++IAL+ N  +  +   + A++      RA LFP+             A +S    P + 
Sbjct: 118 IEIALKNNRDLRVSVLNVEASRAQYQITRAGLFPTLSGTGTGTIQRTPAGVSITGQPLIS 177

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                 + + W++DLFG+ + + + +LA   +       A++++++ +   Y+      +
Sbjct: 178 RTYNVGVSASWELDLFGRVQSLKDQALAQYFATAQARKAAEISLVASVADQYLTLLSTDD 237

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + +    L   + + +L+ L+F  G  S+L L + +  +++  +      ++    ++ 
Sbjct: 238 LLQVTQNTLKSARASYDLTKLQFDNGTGSELDLRQAQTVVETALASQQAQARARAQALNA 297

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G P  + L      +     NL   I  G+P+DL+  RPDI   E+ L  + A I
Sbjct: 298 LVLLIGEPLPDDLPAGLPLNA---QNLLTDIPAGLPSDLLTRRPDIMQAEETLRAANANI 354

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL  +           F      WSF P + LPIF+ G+  +N+  A  
Sbjct: 355 GAARAAFFPKISLTSAFGTASPTLGGLFKAGTAAWSFAPNIALPIFEGGQNIANLDLAHV 414

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             + +   +++ + +A +EV + L +     + +  L+      ++   LS + YR G  
Sbjct: 415 QKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRYDLSDLRYRNGVD 474

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 475 SYLSVLTAQTDLYSAQQQLISARLARWTNLVDLYRALGGGW 515


>gi|113971077|ref|YP_734870.1| RND efflux system outer membrane lipoprotein [Shewanella sp. MR-4]
 gi|113885761|gb|ABI39813.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Shewanella sp. MR-4]
          Length = 517

 Score =  206 bits (522), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 123/459 (26%), Positives = 217/459 (47%), Gaps = 16/459 (3%)

Query: 5   RAIFSLFIVLLAGCTV-GPEYTKPHMPLLPTQFSIGN---SKNLINIDTLKWWESFNDTS 60
           R +      LL+GCTV GP+Y +P +P + T  S  +   S      D  +WW    D  
Sbjct: 9   RLVIGGACALLSGCTVLGPDYQQPEVPEIQTWQSASSQLFSAAPSASDYQQWWSQLQDPV 68

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFP--------SSYASISHRFIPNL 112
           L+ L+  AL +N  +  A  RI  A+  +    +   P           A  +       
Sbjct: 69  LSSLIDEALLKNPDVRIAGLRILEAQAQLGIAESLRNPQLTQATAQWLGAGQTQSGNSTS 128

Query: 113 KTNSTGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
            ++     +  W++D +G+ +  IES+ AN  +  AQ D  ++ +I+++   Y+  R  +
Sbjct: 129 GSSYGAAFNLGWELDFWGKFQRGIESADANYFATIAQYDDVQVLMIAQVAQLYVTIRTLE 188

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
            R+ IAH    + K+++E++  +F  G T++L + + + +     S IPTLE + R + +
Sbjct: 189 ARLQIAHDNAQIQKRSLEITQHQFHSGNTAELDVQQAKTQYLGTLSTIPTLETNLRHSQN 248

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
            +STLL                  Q  L +     +PADL+R RPD+R  E++LA    +
Sbjct: 249 ALSTLLARAPGPLPEMASNTGVIPQGQLALV--TEMPADLLRRRPDVRTAERQLATQSGQ 306

Query: 292 IGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           IGIA+SDLYPS++L G++ L            W  GP +   I D G++ + I   ++  
Sbjct: 307 IGIAESDLYPSITLAGTLGLNATG-SGHSIFSWGVGPSISWNILDSGRLTNQILVQDARF 365

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           ++ +  ++ETV  A +EV++A  +       +T L    E   +S+ ++   YR+G    
Sbjct: 366 EQLHEVYRETVFKAAREVDDAAIAFANSATEITLLTQTGEAASRSLEIANTQYREGMADF 425

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             +LD +RA    +  L  ++     + + LY A+G G+
Sbjct: 426 QRVLDSQRALFSQQERLVNSRGAHIGNLITLYKALGGGW 464


>gi|257093126|ref|YP_003166767.1| NodT family RND efflux system, outer membrane lipoprotein
           [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
 gi|257045650|gb|ACV34838.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
          Length = 472

 Score =  206 bits (522), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 117/451 (25%), Positives = 219/451 (48%), Gaps = 23/451 (5%)

Query: 16  AGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTI 75
           +GC VGP+Y +P +   P  + +   ++  ++    WWE F D  LN LV  AL++N  +
Sbjct: 15  SGCMVGPDYVRPPVDT-PAAWRLSE-QDARDLANTAWWEQFGDPVLNDLVATALRENKDL 72

Query: 76  LQATERINAAKENILSVRADLFPSSYASISHRFIPNLK------------TNSTGQLDSD 123
           + A  R+     N   VR+ LFP   A    R   ++              +    L++ 
Sbjct: 73  MIAAARVEQFAGNYGIVRSGLFPQVGAGYEVRRQRDISAVVVGAGGDETYNSYNAVLNAS 132

Query: 124 WKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILD 182
           W+ID++G+ RR  E++ A L ++        L+++  +  +YI+ R    ++ IA     
Sbjct: 133 WEIDIWGRIRRQTEAARAQLMASEEGRRAVILSLVGSVSGAYINLRDLDRQLDIARATAK 192

Query: 183 LYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPAT 242
              ++ E+  L+F  G  S L L +  ++ +   + IP LEK+     + +S LLG    
Sbjct: 193 SRGESYEIFKLRFAGGIISVLELSQNRSQYEEALASIPPLEKAIAQQENGLSVLLGRNPG 252

Query: 243 EFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPS 302
                   +  +        I  G+P+DL+  RPDIR  E+ L  + A+IG AK+  +P+
Sbjct: 253 -----PIPRGKDIDHLALPAIPAGLPSDLLERRPDIRRTEQDLIAANAQIGAAKAAYFPT 307

Query: 303 LSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQ 359
           +SL G          N F   +  W++G  + +PIF  G I   ++ AE++ Q+    +Q
Sbjct: 308 ISLTGLFGYASTSLSNLFDSQSKVWNYGAPITMPIFTAGAIAGQVQAAEAAQQQALFAYQ 367

Query: 360 ETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIER 419
           + +  A +EV ++L S +  ++ +   +  VE  ++  + + + Y  G  S +++LD ER
Sbjct: 368 KAIQEAFREVNDSLVSRDRTREQLKAQRRQVEALQQYAATARLRYDNGYTSYIEVLDAER 427

Query: 420 ATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +   V++  +  ++   +S ++LY+A+G G+
Sbjct: 428 SLFNVQLQYTQTQQVEFQSMINLYLAMGGGW 458


>gi|77918426|ref|YP_356241.1| outer membrane protein [Pelobacter carbinolicus DSM 2380]
 gi|77544509|gb|ABA88071.1| outer membrane protein [Pelobacter carbinolicus DSM 2380]
          Length = 479

 Score =  206 bits (522), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 128/470 (27%), Positives = 233/470 (49%), Gaps = 20/470 (4%)

Query: 1   MNILRAI---FSLFIVLLAGC-TVGPEYTKPHMPLLPTQ--FSIGNSKNLINIDTLKWWE 54
           MN +R +   F L  + L  C  VGP+Y  P   +  T    +    +     D  +WWE
Sbjct: 1   MNTIRCVRTMFVLACLGLTACVAVGPDYVPPVADVPATWSMATDNQGQAAEPGDLSRWWE 60

Query: 55  SFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKT 114
            FND  LN LV  AL  NL +  A  ++  A+       + L PS   + S     + + 
Sbjct: 61  EFNDPVLNDLVTDALTANLDLATARAQLREARAQRALAGSQLGPSVDVATSASRSQSSEE 120

Query: 115 N--------STGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
           +         +   D+ W+ D+FG  RR +E++ A++D++   +   +++++++++ +Y+
Sbjct: 121 SGSGSTSELYSAGFDASWEADVFGGLRRGVEAAAADVDASVESLRDTQVSLVAEVVLNYV 180

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
           D R  + R+S+A   +    +   L+  +   G  S+L + +   E++S  + +P L  +
Sbjct: 181 DLRTAERRLSVAENNIASLSETYRLAGWRLQAGLVSELDVAQARTELESTRASLPALRTT 240

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
                + ++ LLG    E    ++  S    P       +GIPAD++R RPD+R  E++L
Sbjct: 241 RAEARNRLAVLLGSSPAELGSRLE--SAGAIPLAERAAAVGIPADILRQRPDVRAAERQL 298

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHDNSF---PGYNTHWSFGPKLYLPIFDKGKIKS 342
           A   A++G A+++ YPS  L+GSI L          G    +S    +  PIFD G+I++
Sbjct: 299 AAQTARLGEAEAERYPSFKLSGSIGLEALTLSALSNGGAAVYSLLGSITAPIFDSGRIRA 358

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
           NI   ++  ++  + ++  VL A+++VENAL ++N   K    L  A +  ++++ L+  
Sbjct: 359 NIETQDALLEQTRLAYKAAVLTALEDVENALVAVNNAGKRRETLTLAADSARETLQLAEQ 418

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            Y  G    L +LD +R    +E DL+ +   LA + + LY A+G G++P
Sbjct: 419 RYAGGLVDFLTVLDSQRTLLGLEDDLASSAGDLAGAQIQLYKALGGGWSP 468


>gi|71152257|sp|Q9KJC1|ARPC_PSEPU RecName: Full=Antibiotic efflux pump outer membrane protein ArpC;
           Flags: Precursor
 gi|8163737|gb|AAF73833.1|AF183959_4 outer membrane channel protein [Pseudomonas putida]
          Length = 484

 Score =  206 bits (522), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 97/470 (20%), Positives = 196/470 (41%), Gaps = 24/470 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINID----TLKWWESF 56
           M       ++   +L GC++ P+Y  P  P+              + D       W + F
Sbjct: 1   MTKSLLSLAVTAFILGGCSLIPDYQAPEAPVAAQWPQGPAYSPTQSADVAAAEQGWRQFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           +D +L +L++ +L  N  +  A   ++A +      RADLFP+  A+ S          S
Sbjct: 61  HDPALQQLIQTSLVNNRDLRVAALNLDAYRAQYRIQRADLFPAVSATGSGSRQRVPANMS 120

Query: 117 TGQLD------------SDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPS 163
                            S +++DLFG+ R +         S+       ++ +++ +  +
Sbjct: 121 QTGESGITSQYSATLGVSAYELDLFGRVRSLTEQALETYLSSEQARRSTQIALVASVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y   +  +    +  + L  Y+++  L+      G  S L + +    ++         +
Sbjct: 181 YYTWQADQALFKLTEETLKTYEESYNLTRRSNEVGVASALDVSQARTAVEGARVKYSQYQ 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    +V++++ LLG      L    +   +    +      G+P+D+++ RPDI+  E 
Sbjct: 241 RLVAQDVNSLTVLLGTGIPADLAKPLELDADQLAEVP----AGLPSDILQRRPDIQEAEH 296

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  +      +    F G    W F P++ LPIF+ G +
Sbjct: 297 LLKAANANIGAARAAFFPSISLTANAGSLSPDMGHLFSGGQGTWLFQPQINLPIFNAGSL 356

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           K+++  ++         +++T+  A +EV + L +    ++ +   +  V+ ++    L+
Sbjct: 357 KASLDYSKIQKDINVAKYEKTIQTAFQEVSDGLAARKTFEEQLQAQRDLVQANQDYYRLA 416

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              YR G  S L  LD +R     +  L   +     S V+LY A+G G+
Sbjct: 417 ERRYRIGIDSNLTFLDAQRNLFSAQQALIGDRLSQLTSEVNLYKALGGGW 466


>gi|114048311|ref|YP_738861.1| RND efflux system outer membrane lipoprotein [Shewanella sp. MR-7]
 gi|113889753|gb|ABI43804.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Shewanella sp. MR-7]
          Length = 517

 Score =  206 bits (522), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 123/459 (26%), Positives = 217/459 (47%), Gaps = 16/459 (3%)

Query: 5   RAIFSLFIVLLAGCTV-GPEYTKPHMPLLPTQFSIGN---SKNLINIDTLKWWESFNDTS 60
           R +      LL+GCTV GP+Y +P +P + T  S  +   S      D  +WW    D  
Sbjct: 9   RLVIGGACALLSGCTVLGPDYQQPEVPEIQTWQSASSQLFSAAPSASDYQQWWSQLQDPV 68

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFP--------SSYASISHRFIPNL 112
           L+ L+  AL +N  +  A  RI  A+  +    +   P           A  +       
Sbjct: 69  LSSLIDEALLKNPDVRIAGLRILEAQAQLGIAESLRNPQLTQATAQWLGAGQTQSGNSTS 128

Query: 113 KTNSTGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
            ++     +  W++D +G+ +  IES+ AN  +  AQ D  ++ +I+++   Y+  R  +
Sbjct: 129 GSSYGAAFNLGWELDFWGKFQRGIESADANYFATIAQYDDVQVLMIAQVAQLYVTIRTLE 188

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
            R+ IAH    + K+++E++  +F  G T++L + + + +     S IPTLE + R + +
Sbjct: 189 ARLQIAHDNAQIQKRSLEITQHQFHSGNTAELDVQQAKTQYLGTLSTIPTLETNLRQSQN 248

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
            +STLL                  Q  L +     +PADL+R RPD+R  E++LA    +
Sbjct: 249 ALSTLLARAPGPLPEMASNTGVLPQGQLALV--TEMPADLLRRRPDVRTAERQLATQSGQ 306

Query: 292 IGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           IGIA+SDLYPS++L G++ L            W  GP +   I D G++ + I   ++  
Sbjct: 307 IGIAESDLYPSITLAGTLGLNATG-SGHSIFSWGVGPSISWNILDSGRLTNQILVQDARF 365

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           ++ +  ++ETV  A +EV++A  +       +T L    E   +S+ ++   YR+G    
Sbjct: 366 EQLHEVYRETVFKAAREVDDAAIAFANSATEITLLTQTGEAASRSLEIANTQYREGMADF 425

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             +LD +RA    +  L  ++     + + LY A+G G+
Sbjct: 426 QRVLDSQRALFSQQERLVNSRGAHIGNLITLYKALGGGW 464


>gi|107028582|ref|YP_625677.1| RND efflux system, outer membrane lipoprotein, NodT [Burkholderia
           cenocepacia AU 1054]
 gi|116686584|ref|YP_839831.1| RND efflux system outer membrane lipoprotein [Burkholderia
           cenocepacia HI2424]
 gi|105897746|gb|ABF80704.1| RND efflux system, outer membrane lipoprotein, NodT [Burkholderia
           cenocepacia AU 1054]
 gi|116652299|gb|ABK12938.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia cenocepacia HI2424]
          Length = 508

 Score =  206 bits (522), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 104/460 (22%), Positives = 200/460 (43%), Gaps = 29/460 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQ-----------FSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
           GCT+ P Y +P  P+                +  +S N      + W E F D  L +L+
Sbjct: 21  GCTMAPHYKRPDAPVAQAYPAGGVYATQPGAAGAHSANGQAATAIGWREFFVDPRLQRLI 80

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFP-----------SSYASISHRFIPNLKT 114
           +IAL+ N  +  +   I AA+      RA LFP              A +S    P +  
Sbjct: 81  EIALKNNRDLRVSVLNIEAARAQYQITRAGLFPTLDGTGTGNIQRLPAGVSTTRAPLISR 140

Query: 115 NSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
                L + W++DLFG+ + + + +LA   S       ++++++S++   Y+      + 
Sbjct: 141 TYNVGLSASWELDLFGRVQSLKDQALAQYLSTAYARQASEISLVSQVADQYLTLLSTDDL 200

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
           + +    L   + + +L+ L+F  G  S+L L + +  +++  ++     ++    ++ +
Sbjct: 201 LKVTEDTLKTAQASYDLTKLQFDNGTGSELELRQAQTVVETALANQQAQARARAQALNAL 260

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
             L+G P  + L            NL   +  G+P+DL+  RPD+   E+ L  + A IG
Sbjct: 261 VLLIGEPLPDDLPAGMPLDA---QNLLTDVPAGLPSDLLTRRPDVMQAEQTLLAANANIG 317

Query: 294 IAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESS 350
            A++  +P +SL  +           F      WSF P + LPIF+ G+  +N+  A   
Sbjct: 318 AARAAFFPRISLTAAFGTASPTLGGLFKAGTAAWSFAPNIALPIFEGGQNIANLDLANVQ 377

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
            + +   +++ + +A +EV + L +     + +  L+      ++   LS + Y+ G  S
Sbjct: 378 KRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRFDLSDLRYKNGVDS 437

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 438 YLSVLTAQTDLYSAQQSLISARLARWTNLVDLYRALGGGW 477


>gi|293980659|ref|YP_003543417.1| RND-family efflux transporter [Sphingobium japonicum UT26S]
 gi|292677676|dbj|BAI99191.1| RND-family efflux transporter [Sphingobium japonicum UT26S]
          Length = 467

 Score =  205 bits (521), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 109/467 (23%), Positives = 199/467 (42%), Gaps = 23/467 (4%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFS--IGNSKNLINIDTLKWWESFNDTS 60
           + R         L  C + P + +P +P      +   G+         + W E F D  
Sbjct: 1   MRRVFVLTLTSFLGACQLAPPHARPALPTTRDYPTSYAGDGVLGRRAVEISWREFFADPQ 60

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKT------ 114
           L  L+  AL++N  +  A  +I  A+       A+  P+  A+          +      
Sbjct: 61  LETLIATALERNRDLAVAVAQIQEARGLYRIQGAERLPALGANGDVTRSRTPGSAIGIPE 120

Query: 115 --------NSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
                    S G   + +++D +G+ R++ +++ +   +        +L +I  +  +Y 
Sbjct: 121 VGAITDTRYSIGVGVTGFELDFWGRVRNLSDAARSQYLATVQAERAFRLALIRDVASTYF 180

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
            +R   ERI++A   +   ++ + ++  +   G TS L   + E+ +   E+++ +L  +
Sbjct: 181 ASREADERIALAEATVRSRQEGLRIAERRLEAGVTSALDFRQAESLLTQAETELASLRLA 240

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
              + + ++ LLG P    L      ++     +      G+P++L+  RPDI   E+KL
Sbjct: 241 EAQSENFLAVLLGGPVPVGLTVPLTLADQKNGTVIA---AGLPSELMVTRPDILAAEEKL 297

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFP---GYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG A++  +PS+SL GSI     +           WSFGP + LPIFD G  K 
Sbjct: 298 RAARANIGAARAAFFPSISLTGSIGFASTDLGNLIGNEGLSWSFGPSISLPIFDWGARKG 357

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
           N+  AE+        ++ T+  A +EV +AL       + V     A    +    L+  
Sbjct: 358 NLSVAEAREDIAIAEYERTIQGAFREVADALAGRRWLAEQVAAQVRATAAQRAIADLART 417

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
            YR+G  + L++LD ER     E  L   +R    + V LY+A+G G
Sbjct: 418 RYREGVANYLEVLDAERNLFIAEQTLIQLRRAELDALVSLYVALGGG 464


>gi|310778926|ref|YP_003967259.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Ilyobacter polytropus DSM 2926]
 gi|309748249|gb|ADO82911.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Ilyobacter polytropus DSM 2926]
          Length = 482

 Score =  205 bits (521), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 134/467 (28%), Positives = 243/467 (52%), Gaps = 19/467 (4%)

Query: 2   NILRAIFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL--KWWESFND 58
            +  A+    +++  GC  VGP+Y  P +  +P +++   S N  N + L  +WWE F+D
Sbjct: 11  KLPAALTLSAVLVFTGCTAVGPDYVSPKV-KVPEKWNGEKSVNFNNENRLSEQWWELFDD 69

Query: 59  TSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASI---------SHRFI 109
             L++L+K A   NL + +A  R++  +  +  V  + +PS              +  + 
Sbjct: 70  PMLDELIKEASVSNLDLKEAMARVDEYRSRLGVVTGERYPSIGVEGDLLRQKTSENAGYT 129

Query: 110 PNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
               T     L++ W+IDLFG+ RR IE++ AN +      +  ++++ S++  +YI  R
Sbjct: 130 GTTNTYKALGLEAGWEIDLFGRVRRSIEAAKANYEVVQEDRNDVRISINSRIALNYIKIR 189

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
            ++ R+  ++  ++L ++ + ++  +F  G  + L + + E  + S E+ +P L      
Sbjct: 190 TYQARLEASNSNIELQREVLRITESRFKYGLATALEVAQAEQALASSEATVPPLRIQLSE 249

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
            ++ ++ LLG    E    M ++ +   P       IG+PAD++R RPDIR  E++LA  
Sbjct: 250 AINTMAVLLGRNPGELNQLMSEKKSIPVP--PADAAIGVPADILRQRPDIRSAERQLAVE 307

Query: 289 VAKIGIAKSDLYPSLSLNGSIAL---THDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
            A++GIAK+DLYP  SL+GS      +  N F     ++S GP L   IF  G I + I 
Sbjct: 308 TARVGIAKADLYPQFSLSGSFGYQSVSSGNLFSSGGNYFSIGPSLRWNIFSGGSILNQID 367

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
             ++  +++ + ++  VLNA+ E EN +T+  ED   +  L+  VE  KK++ LS+  Y+
Sbjct: 368 VQDAIVRQKALQYESIVLNALNEAENTMTAYTEDSMRLKHLEKTVEASKKTVKLSLNLYK 427

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           QG     ++L+ + +    E  L+ A+   A+ +V LY A+G G+NP
Sbjct: 428 QGLVDFENVLNSQLSQFTSEDRLAQARGDSAEDFVRLYAALGGGWNP 474


>gi|116624870|ref|YP_827026.1| RND efflux system outer membrane lipoprotein [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116228032|gb|ABJ86741.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Candidatus Solibacter usitatus Ellin6076]
          Length = 480

 Score =  205 bits (521), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 101/457 (22%), Positives = 196/457 (42%), Gaps = 20/457 (4%)

Query: 11  FIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQ 70
           F +LL  C VGP Y +P +   P   S   +    +   L WW+ F D +L +L+K +L 
Sbjct: 6   FSLLLPACAVGPNYRRPSVSAPPAFRSAAGAAQQASFADLPWWDVFRDDTLKQLIKTSLA 65

Query: 71  QNLTILQATERINAAKENILSVRADLFPSSYASISHRF------------IPNLKTNSTG 118
            N  +  A  R+  A++     R++ FP+   S    +             P  +    G
Sbjct: 66  NNYDLQAAIARVEQARQVAALARSEYFPAINYSTVTTYGHNQFINSPVSISPGAQGFLLG 125

Query: 119 QLDSDWKIDLFGQRRHIES-SLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIA 177
              + W+ D++G+ R     + A   +         L + S L  +Y +    + ++ IA
Sbjct: 126 IASAAWEADVWGRIRRTNEGARAQYLATEEARRGVMLTLTSDLSQAYFELLGLRLQLDIA 185

Query: 178 HQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLL 237
            +    Y   + L   +  +G  + L   +  A++ S  + +  +E+   +  + IS LL
Sbjct: 186 RETTQSYTATLNLFSDRLREGLGNALQTSRAAADLASAAASVREIERQIAIKENQISVLL 245

Query: 238 GYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKS 297
           G          +       P++     +G+P+ L+  RPD+   E+++  + A+IG+AKS
Sbjct: 246 GKNPGAIETKAKLLEETVPPSIP----VGLPSALLERRPDVLSAEQRVRYANAQIGVAKS 301

Query: 298 DLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQ 354
             +P + L            +   G    WS G     PIF  G +++  R+A +   E 
Sbjct: 302 AYFPRIGLTTFFGKLSTPLADLSSGNTNAWSVGANAAGPIFRGGAVRAQHRQAIAFRDEA 361

Query: 355 YITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDI 414
              +++T + A ++V +AL S  +   I   L   V   ++++ L+ + Y +G  +  ++
Sbjct: 362 EAEYRQTAVRAFRDVADALVSREKYDAIREDLIRGVRSSEEAVRLARMRYLEGLSNYNEV 421

Query: 415 LDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           L+ ++     ++ L+  +       V LY A+G G+N
Sbjct: 422 LEAQQRLYPSQLALAQTEINRRLVVVQLYKALGGGWN 458


>gi|237507825|ref|ZP_04520540.1| outer membrane protein OprM [Burkholderia pseudomallei MSHR346]
 gi|235000030|gb|EEP49454.1| outer membrane protein OprM [Burkholderia pseudomallei MSHR346]
          Length = 552

 Score =  205 bits (521), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 104/461 (22%), Positives = 200/461 (43%), Gaps = 30/461 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIG------------NSKNLINIDTLKWWESFNDTSLNKL 64
           GCT+ P Y +P  P+     + G             S N      + W E F D  L +L
Sbjct: 59  GCTLAPRYERPAAPVSGAFPADGVYAAQPGAAPGARSANGQAAVDIGWREFFVDPRLQRL 118

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSS-----------YASISHRFIPNLK 113
           ++IAL+ N  +  +   + A++      RA LFP+             A +S    P + 
Sbjct: 119 IEIALKNNRDLRVSVLNVEASRAQYQITRAGLFPTLSGTGTGTIQRTPAGVSITGQPLIS 178

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                 + + W++DLFG+ + + + +LA   +       A++++++ +   Y+      +
Sbjct: 179 RTYNVGVSASWELDLFGRVQSLKDQALAQYFATAQARKAAEISLVASVADQYLTLLSTDD 238

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + +    L   + + +L+ L+F  G  S+L L + +  +++  +      ++    ++ 
Sbjct: 239 LLQVTQNTLKSARASYDLTKLQFDNGTGSELDLRQAQTVVETALASQQAQARARAQALNA 298

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G P  + L      +     NL   I  G+P+DL+  RPDI   E+ L  + A I
Sbjct: 299 LVLLIGEPLPDDLPAGLPLNA---QNLLTDIPAGLPSDLLTRRPDIMQAEETLRAANANI 355

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL  +           F      WSF P + LPIF+ G+  +N+  A  
Sbjct: 356 GAARAAFFPKISLTSAFGTASPTLGGLFKAGTAAWSFAPNIALPIFEGGQNIANLDLAHV 415

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             + +   +++ + +A +EV + L +     + +  L+      ++   LS + YR G  
Sbjct: 416 QKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRYDLSDLRYRNGVD 475

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 476 SYLSVLTAQTDLYSAQQQLISARLARWTNLVDLYRALGGGW 516


>gi|316934461|ref|YP_004109443.1| RND efflux system outer membrane lipoprotein [Rhodopseudomonas
           palustris DX-1]
 gi|315602175|gb|ADU44710.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhodopseudomonas palustris DX-1]
          Length = 554

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 129/474 (27%), Positives = 223/474 (47%), Gaps = 31/474 (6%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
            +  L  VLL GC VGP+Y  P +   P Q+S   +         +WW    D +L++LV
Sbjct: 54  TLMILAAVLLGGCAVGPDYRTPLL-ATPAQWSRAGASTPAPPVLPRWWTRLRDPTLDRLV 112

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFP------------------------SSY 101
             A+  NL +  A+ R+  A+ +       L P                        +  
Sbjct: 113 VEAVDGNLDVATASARVREARASYRQAVGALLPAITNSDSASLAKGMGVPSAAPGRPNLS 172

Query: 102 ASISHRFIPNLKTNSTGQLDSDWKIDLFGQRRHIESSLAN-LDSAYAQVDIAKLNVISKL 160
           +  S               D+ W++DLFG  R    + A  +D++   +    L ++  +
Sbjct: 173 SPSSVAGSEGTSGLYKAGFDASWELDLFGANRRAVEAAAYGIDASDENLRAVLLTLVGDV 232

Query: 161 IPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIP 220
             SY++AR ++ RI++AH+      +   ++  +   G  S + L     +  +  + IP
Sbjct: 233 ASSYVEARAYQARIALAHRTALSQDETTTITRNRLAAGTASAVDLATATGQAAATRAAIP 292

Query: 221 TLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRY 280
            LE ++   VH +S L G P       + +      P L +P   GIPAD++  RPD+R 
Sbjct: 293 ALETAYAQTVHRLSVLTGRPPAALSALLARPKPVPTPKLPVP--AGIPADVLLTRPDVRL 350

Query: 281 QEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTH---WSFGPKLYLPIFDK 337
            E++ A S A+IG A++ LYPS+SL G+IA +              WS GP L +PIF+ 
Sbjct: 351 AERRYAQSTARIGQAEAALYPSVSLAGNIATSGTRLGDLGRNSSISWSLGPTLTMPIFNG 410

Query: 338 GKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSM 397
           GK+++ +  A++    Q++ +Q +VL A+K+VE+AL +++ ++     L  +   ++++ 
Sbjct: 411 GKLRAAVEIAQAQRDAQFLAYQASVLTALKDVEDALVALSNERVRGRILATSTTAYRQAA 470

Query: 398 SLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           SLS   YR G  S LD+L  ER+    E  L  ++ ++   Y+ L  A G G++
Sbjct: 471 SLSQSLYRSGSSSFLDVLTAERSLYSAEDALLQSRVRIVSDYIALNKAFGGGWD 524


>gi|300697413|ref|YP_003748074.1| outer membrane drug efflux lipoprotein [Ralstonia solanacearum
           CFBP2957]
 gi|299074137|emb|CBJ53682.1| outer membrane drug efflux lipoprotein [Ralstonia solanacearum
           CFBP2957]
          Length = 504

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 112/484 (23%), Positives = 208/484 (42%), Gaps = 34/484 (7%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQF-----------------SIGNSKN 43
           M  L  I      +LAGCT+ P Y +P  P+  T                   + G+++ 
Sbjct: 4   MIRLSPIALALAAMLAGCTLMPTYQRPAAPVPATFAGTSDKSDASDASGERGNTGGDARP 63

Query: 44  LINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYAS 103
           +  +  + W + F D SL +++ +AL  N  +  A   I  A+       A LFP+  AS
Sbjct: 64  VGPVADIGWRDVFTDPSLQRVIGMALANNRDLRVAVLNIEKARAQYRVQDAALFPTVKAS 123

Query: 104 ISHRFIPNLKTNSTGQL------------DSDWKIDLFGQRRHIESSL-ANLDSAYAQVD 150
            S        T ST                S +++DLFG+ R + +       S      
Sbjct: 124 GSESASRTPATLSTTGQPLVAHSYSATLGFSAYELDLFGRVRSLSAQALEQYLSTVEARR 183

Query: 151 IAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEA 210
            +++++I+++  +Y+     ++ + +A   L        L+   +  G  S+L+L + + 
Sbjct: 184 SSQISLIAEVATAYLTLAADQDLLKLAQDTLSSQSDTYRLNQRSYELGTASRLTLRQSQT 243

Query: 211 EIKSIESDIPTLEKSFRMNVHNISTLLGYP-ATEFLHYMQKQSNNFQPNLYIPINIGIPA 269
            + +   D+         + + +  L+G     E L      S+    +L   I  G+ +
Sbjct: 244 SVDAARVDVERYTAQVAQDRNALVLLVGADLPAELLPGSLPDSSAAAGSLLATIPPGLTS 303

Query: 270 DLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSF 326
           +L++ RPDI   E  L  + A IG A++  +PS+SL  S   +  +    F G +  W+F
Sbjct: 304 NLLQRRPDILQAEHDLKAANANIGAARAAFFPSISLTASAGTSSASLAGLFKGGSGAWNF 363

Query: 327 GPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKL 386
           GP++ LPIFD G  ++N+  A +S       +++ +  A +EV +AL       + +   
Sbjct: 364 GPQIALPIFDGGANRANLDVANTSRDIAVAQYEKAIQTAFREVSDALAQRGTLGRQIEAQ 423

Query: 387 QHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAI 446
           Q  VE    S  L+   +++G  S L++LD +R+    + +L   +     + V  Y  +
Sbjct: 424 QSLVEATADSYQLATARFKRGVDSYLNVLDSQRSLYTAQQNLINTRLSRLTNLVTFYKTL 483

Query: 447 GSGY 450
           G G+
Sbjct: 484 GGGW 487


>gi|197295594|ref|YP_002154135.1| multidrug efflux system outer membrane protein [Burkholderia
           cenocepacia J2315]
 gi|195945073|emb|CAR57698.1| multidrug efflux system outer membrane protein [Burkholderia
           cenocepacia J2315]
          Length = 500

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 103/461 (22%), Positives = 199/461 (43%), Gaps = 29/461 (6%)

Query: 16  AGCTVGPEYTKPHMPLLPTQ-----------FSIGNSKNLINIDTLKWWESFNDTSLNKL 64
            GCT+ P Y +P  P+                +   S N      + W E F D  L +L
Sbjct: 20  TGCTMAPHYKRPDAPVAQAYPAGGVYATQPGAAGARSANGQAATAIGWREFFVDPRLQRL 79

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK----------- 113
           ++IAL+ N  +  +   I AA+      RA LFP+   + +                   
Sbjct: 80  IEIALKNNRDLRVSVLNIEAARAQYQITRAGLFPTLDGTGTGNRQRLPNSLTAVPGRNIT 139

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
           T     L + W++DLFG+ + + + +LA   S       ++++++S++   Y+      +
Sbjct: 140 TTYNVGLSASWELDLFGRVQSLKDQALAQYLSTSYARQASEISLVSQVADQYLTLLSTDD 199

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + +    L   + + +L+ L+F  G  S+L L + +  +++  ++     ++    ++ 
Sbjct: 200 LLKVTEDTLKTAQASYDLTKLQFDNGTGSELELRQAQTVVETALANQQAQARARAQALNA 259

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G P  + L            NL   +  G+P+DL+  RPD+   E+ L  + A I
Sbjct: 260 LVLLIGEPLPDDLPAGMPLDA---QNLLTDVPAGLPSDLLTRRPDVMQAEQTLLAANANI 316

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL G+           F      WSF P + LPIF+ G+  +N+  A  
Sbjct: 317 GAARAAFFPKISLTGAFGTASPTLGGLFKAGTAAWSFAPSIALPIFEGGQNIANLDLANV 376

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             + +   +++ + +A +EV + L +     + +  L+      ++   LS + Y+ G  
Sbjct: 377 QKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRFDLSDLRYKNGVD 436

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 437 SYLSVLTAQTDLYAAQQSLISARLARWTNLVDLYRALGGGW 477


>gi|170735177|ref|YP_001774291.1| RND efflux system outer membrane lipoprotein [Burkholderia
           cenocepacia MC0-3]
 gi|169821215|gb|ACA95796.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia cenocepacia MC0-3]
          Length = 508

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 102/460 (22%), Positives = 197/460 (42%), Gaps = 29/460 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQ-----------FSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
           GCT+ P Y +P  P+                +   S N      + W E F D  L +L+
Sbjct: 21  GCTMAPHYKRPDAPVAQAYPAGGVYATQPGAAGARSANGQAAAAIGWREFFVDPRLQRLI 80

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL-----------KT 114
           +IAL+ N  +  +   I AA+      RA LFP+     +                    
Sbjct: 81  EIALKNNRDLRVSVLNIEAARAQYQITRAGLFPTLGGMGTGNIQRYPQGVSPTNQAYISR 140

Query: 115 NSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
                L + W++DLFG+ + + + +LA   S       ++++++S++   Y+      + 
Sbjct: 141 TYNVGLSASWELDLFGRVQSLKDQALAQYLSTAYARQASEISLVSQVADQYLTLLSTDDL 200

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
           + +    L   + + +L+ L+F  G  S+L L + +  +++  ++     ++    ++ +
Sbjct: 201 LKVTEDTLKTAQASYDLTKLQFDNGTGSELELRQAQTVVETALANQQAQARARAQALNAL 260

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
             L+G P  + L            NL   +  G+P+DL+  RPD+   E+ L  + A IG
Sbjct: 261 VLLIGEPLPDDLPAGMPLEA---QNLLTDVPAGLPSDLLTRRPDVMQAEQTLLAANANIG 317

Query: 294 IAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESS 350
            A++  +P +SL G+           F      WSF P + LPIF+ G+  +N+  A   
Sbjct: 318 AARAAFFPKISLTGAFGTASPTLGGLFKAGTAAWSFAPSIALPIFEGGQNIANLDLANVQ 377

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
            + +   +++ + +A +EV + L +     + +  L+      ++   LS + Y+ G  S
Sbjct: 378 KRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRFDLSDLRYKNGVDS 437

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 438 YLSVLTAQTDLYSAQQSLISARLARWTNLVDLYRALGGGW 477


>gi|126441010|ref|YP_001057907.1| outer membrane efflux protein OprB [Burkholderia pseudomallei 668]
 gi|126454516|ref|YP_001065142.1| outer membrane efflux protein OprB [Burkholderia pseudomallei
           1106a]
 gi|134279820|ref|ZP_01766532.1| outer membrane efflux protein OprB [Burkholderia pseudomallei 305]
 gi|217420291|ref|ZP_03451797.1| outer membrane efflux protein OprM [Burkholderia pseudomallei 576]
 gi|237811057|ref|YP_002895508.1| outer membrane protein OprM [Burkholderia pseudomallei MSHR346]
 gi|242316555|ref|ZP_04815571.1| outer membrane efflux protein OprM [Burkholderia pseudomallei
           1106b]
 gi|254181592|ref|ZP_04888189.1| outer membrane efflux protein OprM [Burkholderia pseudomallei 1655]
 gi|126220503|gb|ABN84009.1| outer membrane efflux protein OprM [Burkholderia pseudomallei 668]
 gi|126228158|gb|ABN91698.1| outer membrane efflux protein OprM [Burkholderia pseudomallei
           1106a]
 gi|134249020|gb|EBA49102.1| outer membrane efflux protein OprB [Burkholderia pseudomallei 305]
 gi|184212130|gb|EDU09173.1| outer membrane efflux protein OprM [Burkholderia pseudomallei 1655]
 gi|217397595|gb|EEC37611.1| outer membrane efflux protein OprM [Burkholderia pseudomallei 576]
 gi|237504962|gb|ACQ97280.1| outer membrane protein OprM [Burkholderia pseudomallei MSHR346]
 gi|242139794|gb|EES26196.1| outer membrane efflux protein OprM [Burkholderia pseudomallei
           1106b]
          Length = 514

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 104/461 (22%), Positives = 200/461 (43%), Gaps = 30/461 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIG------------NSKNLINIDTLKWWESFNDTSLNKL 64
           GCT+ P Y +P  P+     + G             S N      + W E F D  L +L
Sbjct: 18  GCTLAPRYERPAAPVSGAFPADGVYAAQPGAAPGARSANGQAAVDIGWREFFVDPRLQRL 77

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSS-----------YASISHRFIPNLK 113
           ++IAL+ N  +  +   + A++      RA LFP+             A +S    P + 
Sbjct: 78  IEIALKNNRDLRVSVLNVEASRAQYQITRAGLFPTLSGTGTGTIQRTPAGVSITGQPLIS 137

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                 + + W++DLFG+ + + + +LA   +       A++++++ +   Y+      +
Sbjct: 138 RTYNVGVSASWELDLFGRVQSLKDQALAQYFATAQARKAAEISLVASVADQYLTLLSTDD 197

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + +    L   + + +L+ L+F  G  S+L L + +  +++  +      ++    ++ 
Sbjct: 198 LLQVTQNTLKSARASYDLTKLQFDNGTGSELDLRQAQTVVETALASQQAQARARAQALNA 257

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G P  + L      +     NL   I  G+P+DL+  RPDI   E+ L  + A I
Sbjct: 258 LVLLIGEPLPDDLPAGLPLNA---QNLLTDIPAGLPSDLLTRRPDIMQAEETLRAANANI 314

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL  +           F      WSF P + LPIF+ G+  +N+  A  
Sbjct: 315 GAARAAFFPKISLTSAFGTASPTLGGLFKAGTAAWSFAPNIALPIFEGGQNIANLDLAHV 374

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             + +   +++ + +A +EV + L +     + +  L+      ++   LS + YR G  
Sbjct: 375 QKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRYDLSDLRYRNGVD 434

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 435 SYLSVLTAQTDLYSAQQQLISARLARWTNLVDLYRALGGGW 475


>gi|154253877|ref|YP_001414701.1| RND efflux system outer membrane lipoprotein [Parvibaculum
           lavamentivorans DS-1]
 gi|154157827|gb|ABS65044.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Parvibaculum lavamentivorans DS-1]
          Length = 495

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 111/465 (23%), Positives = 216/465 (46%), Gaps = 22/465 (4%)

Query: 3   ILRAIFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFS-IGNSKNLINIDTLKWWESFNDTS 60
           +  A  +L  V+L GC ++ P    P +P+     + +G+  +  +   L W   F D  
Sbjct: 13  LRTASLALSAVVLTGCMSLAPAPDTPPLPVPEAWPAHLGSGTDGAHAGELAWQAYFTDPL 72

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL 120
           L +L++ AL+ N  +  A  R+  A       R+D FP+                +    
Sbjct: 73  LQRLIETALENNRDLRLAALRVEEASATFRIQRSDRFPAVGVGAQGGRARVPGDLNMSGR 132

Query: 121 D------------SDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
                        S W++DL+G+ R++ +++L +  ++ A      L +I+++   Y+  
Sbjct: 133 SQVGGEYRAEVGLSTWELDLWGRVRNLEDAALQSWLASDAARQAVHLALIAQVADGYLGL 192

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
           R   ER++IA Q +   +++  +   +   G+TSKL L +++  +   ++ +  LE++  
Sbjct: 193 REIDERVAIARQTVATREESYRIFRRRVEVGSTSKLDLTQVQTLLNQAQALLTQLEQARA 252

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
              H ++ L+G         +  +    +  +   +  G+P++L+ +RPDI   E +L  
Sbjct: 253 TQRHALAMLVGADPG----PLPTKVPFDETTVLAELRAGLPSELLVSRPDIIAAEHQLRA 308

Query: 288 SVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNI 344
           S A IG A++   P ++L GS      +    F   +  W+F P L LPIFD G+ ++N+
Sbjct: 309 SDAHIGAARAAFLPRIALTGSFGTASSDLNGLFDSGSRAWTFMPTLSLPIFDGGRRRANL 368

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
             +E         +++T+  A +EV +AL++ +   + +T  +  +E   +   L+ + Y
Sbjct: 369 ELSEVRRDIAVAGYEKTIQTAFREVADALSAKHWLAEQLTIQRANLEAQSERARLAQLRY 428

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
             G  + L++LD +R     +  L  A+R L  S V LY A+G G
Sbjct: 429 DNGSAAFLEVLDAQRDLLGAQQQLVQARRALLSSQVALYAALGGG 473


>gi|76809792|ref|YP_332432.1| outer membrane efflux protein [Burkholderia pseudomallei 1710b]
 gi|254259380|ref|ZP_04950434.1| outer membrane multidrug efflux protein OprB [Burkholderia
           pseudomallei 1710a]
 gi|76579245|gb|ABA48720.1| outer membrane efflux protein [Burkholderia pseudomallei 1710b]
 gi|254218069|gb|EET07453.1| outer membrane multidrug efflux protein OprB [Burkholderia
           pseudomallei 1710a]
          Length = 514

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 104/461 (22%), Positives = 200/461 (43%), Gaps = 30/461 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIG------------NSKNLINIDTLKWWESFNDTSLNKL 64
           GCT+ P Y +P  P+     + G             S N      + W E F D  L +L
Sbjct: 18  GCTLAPRYERPAAPVSGAFPADGVYAAQPGAAPGARSANGQAAVDIGWREFFVDPRLQRL 77

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSS-----------YASISHRFIPNLK 113
           ++IAL+ N  +  +   + A++      RA LFP+             A +S    P + 
Sbjct: 78  IEIALKNNRDLRVSVLNVEASRAQYQITRAGLFPTLSGTGTGTIQRTPAGVSITGQPLIS 137

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                 + + W++DLFG+ + + + +LA   +       A++++++ +   Y+      +
Sbjct: 138 RTYNVGVSASWELDLFGRVQSLKDQALAQYFATAQARKAAEISLVASVADQYLTLLSTDD 197

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + +    L   + + +L+ L+F  G  S+L L + +  +++  +      ++    ++ 
Sbjct: 198 LLQVTQNTLKSARASYDLTKLQFDNGTGSELDLRQAQTVVETALASQQAQARARAQALNA 257

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G P  + L      +     NL   I  G+P+DL+  RPDI   E+ L  + A I
Sbjct: 258 LVLLIGEPLPDDLPAGLPLNA---QNLLTDIPAGLPSDLLTRRPDIMQAEETLRAANANI 314

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL  +           F      WSF P + LPIF+ G+  +N+  A  
Sbjct: 315 GAARAAFFPKISLTSAFGTASPTLGGLFKAGTAAWSFAPNIALPIFEGGQNIANLDLAHV 374

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             + +   +++ + +A +EV + L +     + +  L+      ++   LS + YR G  
Sbjct: 375 QKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRYDLSDLRYRNGVD 434

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 435 SYLSVLTAQTDLYSAQQQLISARLARWTNLVDLYRALGGGW 475


>gi|284159973|ref|YP_001062578.2| outer membrane efflux protein OprB [Burkholderia pseudomallei 668]
 gi|283775159|gb|ABN88292.2| outer membrane efflux protein OprM [Burkholderia pseudomallei 668]
          Length = 512

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 104/461 (22%), Positives = 200/461 (43%), Gaps = 30/461 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIG------------NSKNLINIDTLKWWESFNDTSLNKL 64
           GCT+ P Y +P  P+     + G             S N      + W E F D  L +L
Sbjct: 18  GCTLAPRYERPAAPVSGAFPADGVYAAQPGAAPGARSANGQAAVDIGWREFFVDPRLQRL 77

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSS-----------YASISHRFIPNLK 113
           ++IAL+ N  +  +   + A++      RA LFP+             A +S    P + 
Sbjct: 78  IEIALKNNRDLRVSVLNVEASRAQYQITRAGLFPTLSGTGTGTIQRTPAGVSITGQPLIS 137

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                 + + W++DLFG+ + + + +LA   +       A++++++ +   Y+      +
Sbjct: 138 RTYNVGVSASWELDLFGRVQSLKDQALAQYFATAQARKAAEISLVASVADQYLTLLSTDD 197

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + +    L   + + +L+ L+F  G  S+L L + +  +++  +      ++    ++ 
Sbjct: 198 LLQVTQNTLKSARASYDLTKLQFDNGTGSELDLRQAQTVVETALASQQAQARARAQALNA 257

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G P  + L      +     NL   I  G+P+DL+  RPDI   E+ L  + A I
Sbjct: 258 LVLLIGEPLPDDLPAGLPLNA---QNLLTDIPAGLPSDLLTRRPDIMQAEETLRAANANI 314

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL  +           F      WSF P + LPIF+ G+  +N+  A  
Sbjct: 315 GAARAAFFPKISLTSAFGTASPTLGGLFKAGTAAWSFAPNIALPIFEGGQNIANLDLAHV 374

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             + +   +++ + +A +EV + L +     + +  L+      ++   LS + YR G  
Sbjct: 375 QKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRYDLSDLRYRNGVD 434

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 435 SYLSVLTAQTDLYSAQQQLISARLARWTNLVDLYRALGGGW 475


>gi|53722148|ref|YP_111133.1| outer membrane efflux protein [Burkholderia pseudomallei K96243]
 gi|52212562|emb|CAH38588.1| putative outer membrane efflux protein [Burkholderia pseudomallei
           K96243]
          Length = 512

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 104/461 (22%), Positives = 200/461 (43%), Gaps = 30/461 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIG------------NSKNLINIDTLKWWESFNDTSLNKL 64
           GCT+ P Y +P  P+     + G             S N      + W E F D  L +L
Sbjct: 18  GCTLAPRYERPAAPVSGAFPADGVYAAQPGAAPGARSANGQAAVDIGWREFFVDPRLQRL 77

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSS-----------YASISHRFIPNLK 113
           ++IAL+ N  +  +   + A++      RA LFP+             A +S    P + 
Sbjct: 78  IEIALKNNRDLRVSVLNVEASRAQYQITRAGLFPTLSGTGTGTIQRTPAGVSITGQPLIS 137

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                 + + W++DLFG+ + + + +LA   +       A++++++ +   Y+      +
Sbjct: 138 RTYNVGVSASWELDLFGRVQSLKDQALAQYFATAQARKAAEISLVASVADQYLTLLSTDD 197

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + +    L   + + +L+ L+F  G  S+L L + +  +++  +      ++    ++ 
Sbjct: 198 LLQVTQNTLKSARASYDLTKLQFDNGTGSELDLRQAQTVVETALASQQAQARARAQALNA 257

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G P  + L      +     NL   I  G+P+DL+  RPDI   E+ L  + A I
Sbjct: 258 LVLLIGEPLPDDLPAGLPLNA---QNLLTDIPAGLPSDLLTRRPDIMQAEETLRAANANI 314

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL  +           F      WSF P + LPIF+ G+  +N+  A  
Sbjct: 315 GAARAAFFPKISLTSAFGTASPTLGGLFKAGTAAWSFAPNIALPIFEGGQNIANLDLAHV 374

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             + +   +++ + +A +EV + L +     + +  L+      ++   LS + YR G  
Sbjct: 375 QKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRYDLSDLRYRNGVD 434

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 435 SYLSVLTAQTDLYSAQQQLISARLARWTNLVDLYRALGGGW 475


>gi|293604956|ref|ZP_06687353.1| outer membrane efflux protein OprM [Achromobacter piechaudii ATCC
           43553]
 gi|292816784|gb|EFF75868.1| outer membrane efflux protein OprM [Achromobacter piechaudii ATCC
           43553]
          Length = 491

 Score =  205 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 103/476 (21%), Positives = 212/476 (44%), Gaps = 26/476 (5%)

Query: 1   MNI-LRAIFSL-FIVLLAGCTVGPEYTKPHMPLLPTQFSIG-------NSKNLINIDTLK 51
           M + +R + S+     LAGC++ P Y +P  P+     +              ++   + 
Sbjct: 1   MKLQMRTLLSVSLAAALAGCSLAPTYERPDAPVSAAYPTGAAYKADGSQLAQGMSTADVG 60

Query: 52  WWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN 111
           W + F+D  L +L++++L  N  +  A   + AA+      RADL PS   +        
Sbjct: 61  WRDFFSDPLLQQLIELSLANNRDLRVAALNVEAARAQYRIQRADLLPSVGVAAQESAQRT 120

Query: 112 L------------KTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVIS 158
                             G   S W++DLFG+ R + + +L +  +        +L +I+
Sbjct: 121 PADLSASGRATTSHNYQVGAALSAWELDLFGRIRSLSDQALESYLALDETRTATQLALIA 180

Query: 159 KLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESD 218
           ++  +Y+  R  +E + +  + L   + + +L+   + QG ++ L L + E  +++ + +
Sbjct: 181 EVANAYLTLRADQELLGLTRETLKSQEDSFKLTQQSYDQGLSTSLDLSQAEVSLRTAQRN 240

Query: 219 IPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQP-NLYIPINIGIPADLIRNRPD 277
           +    +    + + ++ L+G P +  +     Q+       L   +  G+P+DL+  RPD
Sbjct: 241 LSQYTRQAAQDRNALTLLVGQPMSPEIVAALDQAVKLDDGMLPTTLPAGLPSDLLARRPD 300

Query: 278 IRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPI 334
           IR  E +L  + A IG A++  +P+++L G       +    F G +  WSF P++ +PI
Sbjct: 301 IRAAEHQLKGANANIGAARAAFFPTITLTGQAGTASASLGGLFEGGSGAWSFVPRITVPI 360

Query: 335 FDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHK 394
           F  G +++N+  A+     Q   +++++    +EV +AL         +   +  V  ++
Sbjct: 361 FAGGSLQANLDLAKVQKNIQVAQYEKSIQTGFREVADALAGRGTLDDQIEAQRLLVNANQ 420

Query: 395 KSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           ++   S   +RQG    L +LD +R+    +  L   +     + V LY  +G G+
Sbjct: 421 RAYDASDQRFRQGIDDYLSVLDSQRSLYTSQQALVDTRLARLSNLVTLYKVLGGGW 476


>gi|332284259|ref|YP_004416170.1| outer membrane efflux protein [Pusillimonas sp. T7-7]
 gi|330428212|gb|AEC19546.1| outer membrane efflux protein [Pusillimonas sp. T7-7]
          Length = 510

 Score =  205 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 98/476 (20%), Positives = 197/476 (41%), Gaps = 33/476 (6%)

Query: 4   LRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQF------------SIGNSKNLINIDTLK 51
           L A+  L  + LAGC++ P+Y +P MP+                 +   S  + N   L 
Sbjct: 8   LTALPVLVSLALAGCSLAPKYERPAMPVPGQYPDSDAVSNTGPRSASAVSPQVGNSSDLG 67

Query: 52  WWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN 111
           W E F D  L  L+  AL  N  +  A  R+  A+       +D  P+     + +   N
Sbjct: 68  WSEFFTDARLKALISEALANNRDMRIAVGRVEEARAQYGIAASDRLPTIGIGANAQITRN 127

Query: 112 LKT-------------NSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVI 157
            +                 G   + +++D FG+ R++ E++     +         +N++
Sbjct: 128 PENLRANSDSGSVSRYYQAGVGMTSFELDFFGRVRNLSEAAFQQYLATAQAGRTVHINLV 187

Query: 158 SKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIES 217
           +++  +Y   R  ++  ++           +EL   ++  G  S L L +  +++ ++ +
Sbjct: 188 AQVAEAYFRLRTTEQLKALMQSTQQSRTSTLELVQARYDGGVASALDLNQARSQLDTVRA 247

Query: 218 DIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPD 277
           D+  +E++    ++ ++ LLG P  E    + K +   +  +   I +G+P+DL+  RPD
Sbjct: 248 DLVAIERAEAQAMNALNLLLGAPIPEG---LPKPAVFGRDQVLAAIPVGLPSDLLERRPD 304

Query: 278 IRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPI 334
           I   E  L  + A IG A++  +P++S+ G            F      W F P+L  PI
Sbjct: 305 IMGAENSLLAANANIGAARAAFFPNISITGLFGFASTQLGGLFGSGQRFWQFAPQLQTPI 364

Query: 335 FDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHK 394
           F  G   +     ++        +++++  A +EV +AL       + +  L+      +
Sbjct: 365 FGGGVGGNLDLA-KARNNIAVAQYEKSIQTAFREVADALAGEATYTRQLDALRALEASAQ 423

Query: 395 KSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +++ L+ + Y  G  S L + + E      +            + V+LY A+G G+
Sbjct: 424 ETLRLAKLRYETGIDSFLQVQNAEVDLYATQQSFLQTGMDSLLNRVELYKALGGGW 479


>gi|53716941|ref|YP_105712.1| RND efflux system outer membrane lipoprotein [Burkholderia mallei
           ATCC 23344]
 gi|121597060|ref|YP_989650.1| outer membrane efflux protein OprB [Burkholderia mallei SAVP1]
 gi|254174237|ref|ZP_04880899.1| outer membrane efflux protein OprB [Burkholderia mallei ATCC 10399]
 gi|262192860|ref|YP_001078389.2| outer membrane efflux protein OprB [Burkholderia mallei NCTC 10247]
 gi|52422911|gb|AAU46481.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia mallei ATCC 23344]
 gi|121224858|gb|ABM48389.1| outer membrane efflux protein OprB [Burkholderia mallei SAVP1]
 gi|160695283|gb|EDP85253.1| outer membrane efflux protein OprB [Burkholderia mallei ATCC 10399]
 gi|261826516|gb|ABM99103.2| outer membrane efflux protein OprM [Burkholderia mallei NCTC 10229]
 gi|261835008|gb|ABO03071.2| outer membrane efflux protein OprM [Burkholderia mallei NCTC 10247]
          Length = 512

 Score =  205 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 104/461 (22%), Positives = 200/461 (43%), Gaps = 30/461 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIG------------NSKNLINIDTLKWWESFNDTSLNKL 64
           GCT+ P Y +P  P+     + G             S N      + W E F D  L +L
Sbjct: 18  GCTLAPRYERPAAPVSGAFPADGVYAAQPGAAPGARSANGQAAVDIGWREFFVDPRLQRL 77

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSS-----------YASISHRFIPNLK 113
           ++IAL+ N  +  +   + A++      RA LFP+             A +S    P + 
Sbjct: 78  IEIALKNNRDLRVSVLNVEASRAQYQITRAGLFPTLSGTGTGTIQRTPAGVSITGQPLIS 137

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                 + + W++DLFG+ + + + +LA   +       A++++++ +   Y+      +
Sbjct: 138 RTYNVGVSASWELDLFGRVQSLKDQALAQYFATAQARKAAEISLVASVADQYLTLLSTDD 197

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + +    L   + + +L+ L+F  G  S+L L + +  +++  +      ++    ++ 
Sbjct: 198 LLQVTQNTLKSARASYDLTKLQFDNGTGSELDLRQAQTVVETALASQQAQARARAQALNA 257

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G P  + L      +     NL   I  G+P+DL+  RPDI   E+ L  + A I
Sbjct: 258 LVLLIGEPLPDDLPADLPLNA---QNLLTDIPAGLPSDLLTRRPDIMQAEETLRAANANI 314

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL  +           F      WSF P + LPIF+ G+  +N+  A  
Sbjct: 315 GAARAAFFPKISLTSAFGTASTTLGGLFKAGTAAWSFAPNIALPIFEGGQNIANLDLAHV 374

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             + +   +++ + +A +EV + L +     + +  L+      ++   LS + YR G  
Sbjct: 375 QKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRYDLSDLRYRNGVD 434

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 435 SYLSVLTAQTDLYSAQQQLISARLARWTNLVDLYRALGGGW 475


>gi|53725078|ref|YP_102139.1| RND efflux system outer membrane lipoprotein [Burkholderia mallei
           ATCC 23344]
 gi|121601280|ref|YP_991959.1| RND efflux system outer membrane lipoprotein [Burkholderia mallei
           SAVP1]
 gi|238562741|ref|ZP_00439973.2| outer membrane efflux protein OprB [Burkholderia mallei GB8 horse
           4]
 gi|251767802|ref|ZP_02268462.2| outer membrane efflux protein OprB [Burkholderia mallei PRL-20]
 gi|254177075|ref|ZP_04883732.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia mallei ATCC 10399]
 gi|254203821|ref|ZP_04910181.1| outer membrane efflux protein OprB [Burkholderia mallei FMH]
 gi|254208799|ref|ZP_04915147.1| outer membrane efflux protein OprB [Burkholderia mallei JHU]
 gi|52428501|gb|AAU49094.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia mallei ATCC 23344]
 gi|121230090|gb|ABM52608.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia mallei SAVP1]
 gi|147745333|gb|EDK52413.1| outer membrane efflux protein OprB [Burkholderia mallei FMH]
 gi|147750675|gb|EDK57744.1| outer membrane efflux protein OprB [Burkholderia mallei JHU]
 gi|160698116|gb|EDP88086.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia mallei ATCC 10399]
 gi|238522063|gb|EEP85510.1| outer membrane efflux protein OprB [Burkholderia mallei GB8 horse
           4]
 gi|243061663|gb|EES43849.1| outer membrane efflux protein OprB [Burkholderia mallei PRL-20]
          Length = 514

 Score =  205 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 104/461 (22%), Positives = 200/461 (43%), Gaps = 30/461 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIG------------NSKNLINIDTLKWWESFNDTSLNKL 64
           GCT+ P Y +P  P+     + G             S N      + W E F D  L +L
Sbjct: 18  GCTLAPRYERPAAPVSGAFPADGVYAAQPGAAPGARSANGQAAVDIGWREFFVDPRLQRL 77

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSS-----------YASISHRFIPNLK 113
           ++IAL+ N  +  +   + A++      RA LFP+             A +S    P + 
Sbjct: 78  IEIALKNNRDLRVSVLNVEASRAQYQITRAGLFPTLSGTGTGTIQRTPAGVSITGQPLIS 137

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                 + + W++DLFG+ + + + +LA   +       A++++++ +   Y+      +
Sbjct: 138 RTYNVGVSASWELDLFGRVQSLKDQALAQYFATAQARKAAEISLVASVADQYLTLLSTDD 197

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + +    L   + + +L+ L+F  G  S+L L + +  +++  +      ++    ++ 
Sbjct: 198 LLQVTQNTLKSARASYDLTKLQFDNGTGSELDLRQAQTVVETALASQQAQARARAQALNA 257

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G P  + L      +     NL   I  G+P+DL+  RPDI   E+ L  + A I
Sbjct: 258 LVLLIGEPLPDDLPADLPLNA---QNLLTDIPAGLPSDLLTRRPDIMQAEETLRAANANI 314

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL  +           F      WSF P + LPIF+ G+  +N+  A  
Sbjct: 315 GAARAAFFPKISLTSAFGTASTTLGGLFKAGTAAWSFAPNIALPIFEGGQNIANLDLAHV 374

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             + +   +++ + +A +EV + L +     + +  L+      ++   LS + YR G  
Sbjct: 375 QKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRYDLSDLRYRNGVD 434

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 435 SYLSVLTAQTDLYSAQQQLISARLARWTNLVDLYRALGGGW 475


>gi|124385469|ref|YP_001028406.1| RND efflux system outer membrane lipoprotein [Burkholderia mallei
           NCTC 10229]
 gi|126449899|ref|YP_001079640.1| RND efflux system outer membrane lipoprotein [Burkholderia mallei
           NCTC 10247]
 gi|254360148|ref|ZP_04976418.1| outer membrane efflux protein OprB [Burkholderia mallei 2002721280]
 gi|124293489|gb|ABN02758.1| outer membrane efflux protein OprB [Burkholderia mallei NCTC 10229]
 gi|126242769|gb|ABO05862.1| outer membrane efflux protein OprB [Burkholderia mallei NCTC 10247]
 gi|148029388|gb|EDK87293.1| outer membrane efflux protein OprB [Burkholderia mallei 2002721280]
          Length = 514

 Score =  205 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 104/461 (22%), Positives = 200/461 (43%), Gaps = 30/461 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIG------------NSKNLINIDTLKWWESFNDTSLNKL 64
           GCT+ P Y +P  P+     + G             S N      + W E F D  L +L
Sbjct: 18  GCTLAPRYERPAAPVSGAFPADGVYAAQPGAAPGARSANGQAAVDIGWREFFVDPRLQRL 77

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSS-----------YASISHRFIPNLK 113
           ++IAL+ N  +  +   + A++      RA LFP+             A +S    P + 
Sbjct: 78  IEIALKNNRDLRVSVLNVEASRAQYQITRAGLFPTLSGTGTGTIQRTPAGVSITGQPLIS 137

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                 + + W++DLFG+ + + + +LA   +       A++++++ +   Y+      +
Sbjct: 138 RTYNVGVSASWELDLFGRVQSLKDQALAQYFATAQARKAAEISLVASVADQYLTLLSTDD 197

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + +    L   + + +L+ L+F  G  S+L L + +  +++  +      ++    ++ 
Sbjct: 198 LLQVTQNTLKSARASYDLTKLQFDNGTGSELDLCQAQTVVETALASQQAQARARAQALNA 257

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G P  + L      +     NL   I  G+P+DL+  RPDI   E+ L  + A I
Sbjct: 258 LVLLIGEPLPDDLPADLPLNA---QNLLTDIPAGLPSDLLTRRPDIMQAEETLRAANANI 314

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL  +           F      WSF P + LPIF+ G+  +N+  A  
Sbjct: 315 GAARAAFFPKISLTSAFGTASTTLGGLFKAGTAAWSFAPNIALPIFEGGQNIANLDLAHV 374

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             + +   +++ + +A +EV + L +     + +  L+      ++   LS + YR G  
Sbjct: 375 QKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRYDLSDLRYRNGVD 434

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 435 SYLSVLTAQTDLYSAQQQLISARLARWTNLVDLYRALGGGW 475


>gi|53718454|ref|YP_107440.1| outer membrane efflux protein [Burkholderia pseudomallei K96243]
 gi|52208868|emb|CAH34807.1| outer membrane efflux protein [Burkholderia pseudomallei K96243]
          Length = 514

 Score =  205 bits (520), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 104/461 (22%), Positives = 200/461 (43%), Gaps = 30/461 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIG------------NSKNLINIDTLKWWESFNDTSLNKL 64
           GCT+ P Y +P  P+     + G             S N      + W E F D  L +L
Sbjct: 18  GCTLAPRYERPAAPVSGAFPADGVYAAQPGAAPGARSANGQAAVDIGWREFFVDPCLQRL 77

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSS-----------YASISHRFIPNLK 113
           ++IAL+ N  +  +   + A++      RA LFP+             A +S    P + 
Sbjct: 78  IEIALKNNRDLRVSVLNVEASRAQYQITRAGLFPTLSGTGTGTIQRTPAGVSITGQPLIS 137

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                 + + W++DLFG+ + + + +LA   +       A++++++ +   Y+      +
Sbjct: 138 RTYNVGVSASWELDLFGRVQSLKDQALAQYFATAQARKAAEISLVASVADQYLTLLSTDD 197

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + +    L   + + +L+ L+F  G  S+L L + +  +++  +      ++    ++ 
Sbjct: 198 LLQVTQNTLKSARASYDLTKLQFDNGTGSELDLRQAQTVVETALASQQAQARARAQALNA 257

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G P  + L      +     NL   I  G+P+DL+  RPDI   E+ L  + A I
Sbjct: 258 LVLLIGEPLPDDLPAGLPLNA---QNLLTDIPAGLPSDLLTRRPDIMQAEETLRAANANI 314

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL  +           F      WSF P + LPIF+ G+  +N+  A  
Sbjct: 315 GAARAAFFPKISLTSAFGTASPTLGGLFKAGTAAWSFAPNIALPIFEGGQNIANLDLAHV 374

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             + +   +++ + +A +EV + L +     + +  L+      ++   LS + YR G  
Sbjct: 375 QKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRYDLSDLRYRNGVD 434

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 435 SYLSVLTAQTDLYSAQQQLISARLARWTNLVDLYRALGGGW 475


>gi|37588896|gb|AAQ94111.1| outer membrane protein [Burkholderia pseudomallei]
          Length = 532

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 104/461 (22%), Positives = 200/461 (43%), Gaps = 30/461 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIG------------NSKNLINIDTLKWWESFNDTSLNKL 64
           GCT+ P Y +P  P+     + G             S N      + W E F D  L +L
Sbjct: 18  GCTLAPRYERPAAPVSGAFPADGVYAAQPGAAPGARSANGQAAVDIGWREFFVDPRLQRL 77

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSS-----------YASISHRFIPNLK 113
           ++IAL+ N  +  +   + A++      RA LFP+             A +S    P + 
Sbjct: 78  IEIALKNNRDLRVSVLNVEASRAQYQITRAGLFPTLSGTGTGTIQRTPAGVSITGQPLIS 137

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                 + + W++DLFG+ + + + +LA   +       A++++++ +   Y+      +
Sbjct: 138 RTYNVGVSASWELDLFGRVQSLKDQALAQYFATAQARKAAEISLVASVADQYLTLLSTDD 197

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + +    L   + + +L+ L+F  G  S+L L + +  +++  +      ++    ++ 
Sbjct: 198 LLQVTQNTLKSARASYDLTKLQFDNGTGSELDLRQAQTVVETALASQQAQARARAQALNA 257

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G P  + L      +     NL   I  G+P+DL+  RPDI   E+ L  + A I
Sbjct: 258 LVLLIGEPLPDDLPAGLPLNA---QNLLTDIPAGLPSDLLTRRPDIMQAEETLRAANANI 314

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL  +           F      WSF P + LPIF+ G+  +N+  A  
Sbjct: 315 GAARAAFFPKISLTSAFGTASPTLGGLFKAGTAAWSFAPNIALPIFEGGQNIANLDLAHV 374

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             + +   +++ + +A +EV + L +     + +  L+      ++   LS + YR G  
Sbjct: 375 QKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRYDLSDLRYRNGVD 434

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 435 SYLSVLTAQTDLYSAQHQLISARLARWTNLVDLYRALGGGW 475


>gi|148549544|ref|YP_001269646.1| RND efflux system outer membrane lipoprotein [Pseudomonas putida
           F1]
 gi|71153372|sp|Q9WWZ8|TTGC_PSEPU RecName: Full=Toluene efflux pump outer membrane protein ttgC;
           Flags: Precursor
 gi|5091481|gb|AAD39554.1| TtgC [Pseudomonas putida]
 gi|148513602|gb|ABQ80462.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Pseudomonas putida F1]
 gi|313500389|gb|ADR61755.1| TtgC [Pseudomonas putida BIRD-1]
          Length = 484

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 97/470 (20%), Positives = 196/470 (41%), Gaps = 24/470 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINID----TLKWWESF 56
           M       ++   +L GC++ P+Y  P  P+              + D       W + F
Sbjct: 1   MTKSLLSLAVTAFILGGCSLIPDYQTPEAPVAAQWPQGPAYSPTQSADVAAAEQGWRQFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           +D +L +L++ +L  N  +  A   ++A +      RADLFP+  A+ S          S
Sbjct: 61  HDPALQQLIQTSLVNNRDLRVAALNLDAYRAQYRIQRADLFPAVSATGSGSRQRVPANMS 120

Query: 117 TGQLD------------SDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPS 163
                            S +++DLFG+ R +         S+       ++ +++ +  +
Sbjct: 121 QTGESGITSQYSATLGVSAYELDLFGRVRSLTEQALETYLSSEQARRSTQIALVASVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y   +  +    +  + L  Y+++  L+      G  S L + +    ++         +
Sbjct: 181 YYTWQADQALFKLTEETLKTYEESYNLTRRSNEVGVASALDVSQARTAVEGARVKYSQYQ 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    +V++++ LLG      L    +   +    +      G+P+D+++ RPDI+  E 
Sbjct: 241 RLVAQDVNSLTVLLGTGIPADLAKPLELDADQLAEVP----AGLPSDILQRRPDIQEAEH 296

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  +      +    F G    W F P++ LPIF+ G +
Sbjct: 297 LLKAANANIGAARAAFFPSISLTANAGSLSPDMGHLFAGGQGTWLFQPQINLPIFNAGSL 356

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           K+++  ++         +++T+  A +EV + L +    ++ +   +  V+ ++    L+
Sbjct: 357 KASLDYSKIQKDINVAKYEKTIQTAFQEVSDGLAARKTFEEQLQAQRDLVQANQDYYRLA 416

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              YR G  S L  LD +R     +  L   +     S V+LY A+G G+
Sbjct: 417 ERRYRIGIDSNLTFLDAQRNLFSAQQALIGDRLSQLTSEVNLYKALGGGW 466


>gi|221069409|ref|ZP_03545514.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Comamonas testosteroni KF-1]
 gi|220714432|gb|EED69800.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Comamonas testosteroni KF-1]
          Length = 477

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 94/459 (20%), Positives = 205/459 (44%), Gaps = 10/459 (2%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
             L  +     +L +GC+  P   +P  P+     +            + W + + D  L
Sbjct: 3   KTLLPVALAGALLASGCSFIPTLERPAAPVAEHYLATDEQAGTTAAADIPWQQFYTDPRL 62

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP------NLKTN 115
            +++++AL+ N  +  A   I  A+      RA  FP    + S    P         + 
Sbjct: 63  QQVIQLALENNRDLRVAVLNIEKAQAQYQIQRAGQFPEFGVAGSASRQPSATTGRYANSY 122

Query: 116 STGQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
             G     W+ID +G+   ++    A   +       A++++I+ +  ++++ +  +E +
Sbjct: 123 MVGLSMPSWEIDFWGRIGSLKQQALAQYLATEEGRKAAQISLIATVANTWLNLQADEELL 182

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
           +I+ + L   +++I+L+ L+   G  S+L   + ++  +S  + +         +V+ ++
Sbjct: 183 AISRRTLGTREQSIKLTKLRLDSGVASELDYRQAQSLTESARATLAQQAGQRERDVNALT 242

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
            ++G      L    +            +  G+P+DL+  RPDIR  E+ +  + A IG 
Sbjct: 243 LIVGQTLPGDLLTSMQGKQLRDLPALADVPSGLPSDLLLRRPDIRQAEQSMIAANASIGA 302

Query: 295 AKSDLYPSLSLNGSIALTHDNSFP---GYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           A++  +P+++L  S      +        +  ++  P LYLPIF+ G+ ++N++ AE+S 
Sbjct: 303 ARALFFPNITLTASAGFASSDISDLLKSDSAAFTIAPSLYLPIFNAGRNRANLQVAETSQ 362

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           +     ++ ++ +A +EV + L +    K+ +      +E  +    LS + Y  G  S 
Sbjct: 363 KIAVAQYEGSIQSAFREVSDTLVNRRSLKEQLDAQSRQLEAEQVRYKLSDLRYTNGVASY 422

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           LD+LD +R+   +E  +   +    ++ V+LY  +G G+
Sbjct: 423 LDLLDAQRSLFALEQSVVQVRLAQLQNQVNLYKVLGGGW 461


>gi|159185264|ref|NP_355492.2| nodulation protein T precursor [Agrobacterium tumefaciens str. C58]
 gi|9957271|gb|AAG09298.1|AF177860_1 NodT homolog [Agrobacterium tumefaciens]
 gi|9963889|gb|AAG09747.1|AF232237_5 outer membrane protein [Agrobacterium tumefaciens]
 gi|159140524|gb|AAK88277.2| nodulation protein T precursor [Agrobacterium tumefaciens str. C58]
          Length = 484

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 183/464 (39%), Positives = 283/464 (60%), Gaps = 17/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M  +RA   L ++LL+GC VGP++  P +  LP +F+     +  +I T+ WW +FND+ 
Sbjct: 1   MLSIRATLPLTMLLLSGCVVGPDHQTPEIQ-LPGKFAEAGKTSNGDISTVAWWNAFNDSR 59

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI----------P 110
           LN  V   L QNLT+LQA ERIN A+ NI    A   PS  ++  H+             
Sbjct: 60  LNGYVSTGLTQNLTVLQAIERINQAQSNITVAGAGSLPSLTSTFRHQTQGSGGSLPSTND 119

Query: 111 NLKTNSTGQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
           N+   ++   +  W +DLFGQ R  + S  A+LD+AYA  ++ +L +IS +  +YID R+
Sbjct: 120 NVTNTTSNAFNVGWLLDLFGQYRRAQESAGASLDAAYATANVQRLTLISAVTSAYIDVRY 179

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
           ++ER++IA Q L   ++ + L+ L+   GA S+L +V+ E  + S  + +P LE +FR  
Sbjct: 180 YQERLAIARQNLGSRRETLSLTKLQLDAGAASRLDVVQSEGLVNSTLAQMPALETNFRRA 239

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            H I+TLLG PA   +  +Q+ +   QP        GIPADLIRNRPDIR  E++LA +V
Sbjct: 240 AHRIATLLGMPADSLVMELQRGAR--QPVARTIPRTGIPADLIRNRPDIRVAERQLAAAV 297

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           A IG+A++ LYPS++L+GSI  +     N   G +  W FGP + LPI D G++++ +  
Sbjct: 298 ADIGVAEAQLYPSITLSGSITPSFTKISNGASGTSNGWGFGPSITLPILDGGRLRAGVDI 357

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
            +S A+EQY+ W+ TVLNA++EVENALT++N D++ V+  +  V  +++++SL+  +YR 
Sbjct: 358 QKSVAREQYLAWKATVLNAVEEVENALTALNRDQQTVSAYRRTVSSYQEALSLATASYRD 417

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           G  SLLD+LD +R  +  +  L+ A +Q A+ YV L +A+G GY
Sbjct: 418 GASSLLDVLDAQRNVSDAQSQLATAIQQAAQDYVALSVALGGGY 461


>gi|309700428|emb|CBI99719.1| probable outer membrane lipoprotein SilC precursor [Escherichia
           coli ETEC H10407]
          Length = 562

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 97/464 (20%), Positives = 204/464 (43%), Gaps = 19/464 (4%)

Query: 1   MNILRAIFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINI---DTLKWWESF 56
           M  L+ +    I +LAGC ++ PEY +P  P +P QFS+  +     +       W   F
Sbjct: 102 MFKLKLLSISTIFILAGCVSLAPEYQRPPAP-VPQQFSLSKNSLTPAVNSYQDTGWRNFF 160

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP------ 110
            D  +++L+  AL  N  +  A  ++  A+       AD +P   AS    +        
Sbjct: 161 VDPQVSRLIGEALNNNRDLRMAALKVEEARAQFNVTDADRYPQLNASSGITYSGGLKGDK 220

Query: 111 NLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                    L+  +++D FG+ +   E+   N  ++        + ++S +  SY   + 
Sbjct: 221 PTTQEYDAGLELSYELDFFGKLKNMSEADRQNYFASEEARRAVHILLVSNVSQSYFSQQL 280

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
             E++ IA + L  Y+++      +   G+T+ L+L +   +I+S  ++I   E      
Sbjct: 281 AYEQLRIARETLKNYEQSYAFVEQQLVTGSTNVLALEQARGQIESTRAEIAKREGDLAQA 340

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            + +  +LG     +     ++         + +   + + ++  RPDI   E +L  + 
Sbjct: 341 NNALQLVLG----TYRAVPSEKGMKGGEIAPVKLPPNLSSQILLQRPDIMEAEYQLKAAD 396

Query: 290 AKIGIAKSDLYP---SLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           A IG A++  +P     S   S +    + F   +  W+F PK+ +PIF+ G+ K+N++ 
Sbjct: 397 ANIGAARAAFFPSITLTSGLSSSSTELSSLFTSGSGMWNFIPKIEIPIFNAGRNKANLKL 456

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
           AE   Q+  + +++ + +A K+V + L   +   + +   Q  ++  + ++  +   Y  
Sbjct: 457 AEIRQQQSVVNYEQKIQSAFKDVSDTLALRDSLSQQLESQQRYLDSLQITLQRARGLYAS 516

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           G  S +++LD ER+    +  +         + ++L+ A+G G+
Sbjct: 517 GAVSYIEVLDAERSLFATQQTILDLTYSRQVNEINLFTALGGGW 560


>gi|328952942|ref|YP_004370276.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfobacca acetoxidans DSM 11109]
 gi|328453266|gb|AEB09095.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfobacca acetoxidans DSM 11109]
          Length = 475

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 100/469 (21%), Positives = 198/469 (42%), Gaps = 25/469 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL------KWWE 54
           M  + +  +L  +LL GCT+ P Y++P  P+     S    K+  +          +W +
Sbjct: 2   MREILSFCALTALLLTGCTMAPPYSRPEAPIPQDWPSGPAYKDAFSKPDAALAVEVQWRK 61

Query: 55  SFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKT 114
            FND  L  ++ +AL+ N  +  A   +  A+      RA+LFP+    IS +      +
Sbjct: 62  FFNDHRLQTVIAMALKNNRDLRVAALNVEKARALYRVQRAELFPTLETGISAKKERVKIS 121

Query: 115 NSTGQLDS----------DWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPS 163
            + G ++            W+ID FG+ R ++        ++      A++ +IS++  +
Sbjct: 122 GTQGMVNLEEYSINLGISSWEIDFFGRIRSLKKRALEEYLASEQGRRSAEILLISEVANA 181

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+     +E + +A   L+  +    L   +F  G   +L L +++  + +   D+    
Sbjct: 182 YLTLAADRENLKLARSTLETQQAAYNLIRRRFEVGFAPELDLRQVQTRVDTARVDVARYT 241

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    + + +  L G P    L   +       P++      G  ++++  RPDI   E 
Sbjct: 242 ELTAQDENALHLLAGSPIPADLLPRELSLVKPLPDVSP----GTSSEVLLRRPDILQAEH 297

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +P +SL  +I     +    F   +  WS+ P++ LPIFD    
Sbjct: 298 VLKAANANIGAARAAFFPRISLTSAIGTASGDLSGLFETGSFVWSYAPRIVLPIFDART- 356

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           +  +   + + +     ++ ++  A +E  +AL S       +   Q  V+   ++  LS
Sbjct: 357 RPALEATQVARKIALAQYERSIQIAFRETADALASRGTLGDRMAAQQSLVDATARTYQLS 416

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
              Y +G    L++LD +R+    +  L   +     + V LY  +G G
Sbjct: 417 NARYEKGIDIYLNVLDAQRSLYAAQQGLIAIRLAKLVNQVRLYEVLGGG 465


>gi|121605776|ref|YP_983105.1| RND efflux system outer membrane lipoprotein [Polaromonas
           naphthalenivorans CJ2]
 gi|120594745|gb|ABM38184.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Polaromonas naphthalenivorans CJ2]
          Length = 495

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 105/455 (23%), Positives = 204/455 (44%), Gaps = 21/455 (4%)

Query: 17  GCTVGPEYTKPHMPLLPTQFS----------IGNSKNLINIDTLKWWESFNDTSLNKLVK 66
           GC++ P Y +P  P+     +           G +   I    ++W   F+D  L +L+ 
Sbjct: 23  GCSMIPTYERPAAPVAADWPALSATAALSGTSGTANQGIAAADIEWQSFFSDPRLRQLID 82

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN------LKTNSTGQL 120
            +L+ N  +  A   I  A+      RAD +P+  A+ +    P+        T + G  
Sbjct: 83  ASLRNNRDLRIAVLNIEQARAQFQIRRADQYPTVNAAATGSRQPSSSGDSITSTYTAGLA 142

Query: 121 DSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQ 179
            + ++ D FG+   ++ ++LA   +        ++++++ +  +Y+     +E I+I  Q
Sbjct: 143 MTSYEFDFFGRVASLKEAALAQYLATEEGRKTTQISLVAAVANTYLSLLADEELIAITRQ 202

Query: 180 ILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGY 239
            L   + +  LS L+F  G +S+L + + E+ I++    +  L +   ++ + +  LLG 
Sbjct: 203 TLATREDSFRLSKLRFDNGVSSELDVRQAESLIEAARVSLAQLIRQRALDQNALVLLLGQ 262

Query: 240 PA-TEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSD 298
           PA  E    +          + + +  G+P+DL+  RPD+R  E+ L  S A IG A++ 
Sbjct: 263 PATGELAVALPAGKGLADMPMMVDVPAGLPSDLLTRRPDVRQAEQLLLASNANIGAARAA 322

Query: 299 LYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQY 355
            +P +SL  S         + F   +  W+  P+L LPIFD G+ ++ +  A +      
Sbjct: 323 FFPKISLTASAGSASSHLGDLFKSGSFGWTLAPQLLLPIFDAGRNRAGLDSANAGRDIAV 382

Query: 356 ITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDIL 415
             +++++  A +EV +AL       + +   Q           LS + Y+ G  S LD+L
Sbjct: 383 AQYEKSIQTAFREVADALAGRATLGEQLRAQQAQANAEGVRFKLSDLRYQNGIASQLDLL 442

Query: 416 DIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           D +R+    +  +   +    +S V LY  +G G+
Sbjct: 443 DAQRSLFTAQQAVVQTRLAQLQSQVTLYKVLGGGW 477


>gi|254196269|ref|ZP_04902693.1| outer membrane efflux protein OprB [Burkholderia pseudomallei S13]
 gi|169653012|gb|EDS85705.1| outer membrane efflux protein OprB [Burkholderia pseudomallei S13]
          Length = 514

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 104/461 (22%), Positives = 200/461 (43%), Gaps = 30/461 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIG------------NSKNLINIDTLKWWESFNDTSLNKL 64
           GCT+ P Y +P  P+     + G             S N      + W E F D  L +L
Sbjct: 18  GCTLAPRYERPAAPVSGAFPADGVYAAQPGAAPGARSANGQAAVDIGWREFFVDPRLQRL 77

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSS-----------YASISHRFIPNLK 113
           ++IAL+ N  +  +   + A++      RA LFP+             A +S    P + 
Sbjct: 78  IEIALKNNRDLRVSVLNVEASRAQYQITRAGLFPTLSGTGTGTIQRTPAGVSITGQPLIS 137

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                 + + W++DLFG+ + + + +LA   +       A++++++ +   Y+      +
Sbjct: 138 RTYNVGVSASWELDLFGRVQSLKDQALAQYFATAQARKAAEISLVASVADQYLTLLSTDD 197

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + +    L   + + +L+ L+F  G  S+L L + +  +++  +      ++    ++ 
Sbjct: 198 LLQVTQNTLKSARASYDLTKLQFDNGTGSELDLRQAQTVVETALASQQAQARARAQALNA 257

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G P  + L      +     NL   I  G+P+DL+  RPDI   E+ L  + A I
Sbjct: 258 LVLLIGEPLPDDLPAGLPLNA---QNLLTDIPAGLPSDLLTRRPDIMQAEETLRAANANI 314

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL  +           F      WSF P + LPIF+ G+  +N+  A  
Sbjct: 315 GAARAAFFPKISLTSAFGTASPTLGGLFKAGTAAWSFAPNIALPIFEGGQNIANLDLAHV 374

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             + +   +++ + +A +EV + L +     + +  L+      ++   LS + YR G  
Sbjct: 375 QKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRYDLSDLRYRNGVD 434

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 435 SYLSVLTAQTDLYSAQHQLISARLARWTNLVDLYRALGGGW 475


>gi|33596389|ref|NP_884032.1| putative efflux system outer membrane component [Bordetella
           parapertussis 12822]
 gi|33602322|ref|NP_889882.1| putative efflux system outer membrane component [Bordetella
           bronchiseptica RB50]
 gi|33566158|emb|CAE37062.1| putative efflux system outer membrane component [Bordetella
           parapertussis]
 gi|33576761|emb|CAE33839.1| putative efflux system outer membrane component [Bordetella
           bronchiseptica RB50]
          Length = 499

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 104/490 (21%), Positives = 199/490 (40%), Gaps = 41/490 (8%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIG--------------------- 39
           M    A+  L    LAGC++ P+Y +P  P+                             
Sbjct: 5   MYKRSALSVLVAAALAGCSLAPDYKRPEAPVQANWPDQPKVQYGAYASPTSLGEQPAAAV 64

Query: 40  NSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS 99
             +     D + W E F D  L KL+++AL  N  +  A +R+  A+      R   +PS
Sbjct: 65  APQGATPADEIGWREFFRDARLQKLIELALVNNRDLRVAVQRVEEARAQYGVQRGAQWPS 124

Query: 100 SYASISHRFIPNL--------------KTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDS 144
             A I  +                        G   + ++IDLFG+ R++ E++     S
Sbjct: 125 IGAGIQGQRQHLPPDMRPLGPDSTSISSQYQAGLGLTTFEIDLFGRLRNLSEAAYQQYLS 184

Query: 145 AYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLS 204
                    + ++  +  SY + R  + ++ +  + L   +++  L   +F  G  S+L 
Sbjct: 185 TEQAQRSVHITLVGAVAQSYFNLRAAEVQLELTQKTLASRQESYNLVKTRFDGGVASELD 244

Query: 205 LVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPIN 264
           L + ++ + S  +D+  L ++     + +  L+G P       +   +   +  L   + 
Sbjct: 245 LNQSKSLLDSASADLAALARARAQAANALVVLVGLPG--LPEDLPAPAVFGRDQLLASVP 302

Query: 265 IGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYN 321
            G+P+DL+  RPDI   E +L  + A IG A++  +P++SL G + +      N F G  
Sbjct: 303 AGLPSDLLTRRPDILAAENQLKAANANIGAARAAFFPTISLTGLLGVASPSLDNLFKGGQ 362

Query: 322 THWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKK 381
            +WSF P +  P+F  G I+  +  A++        +++++  A +EV +AL        
Sbjct: 363 GYWSFSPSITTPLFAGGSIREGLNLAKARDNIAVAQYEQSIQQAFREVSDALAGEATYSA 422

Query: 382 IVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVD 441
            +   +       +++ LS + Y  G  S L +   +      ++ L         + V+
Sbjct: 423 QLDAQRALQVAAGRTLELSNLRYNNGIDSYLQVQTAQVDFFNAQLGLVQTGLAALINRVE 482

Query: 442 LYIAIGSGYN 451
           LY A+G G+ 
Sbjct: 483 LYKALGGGWQ 492


>gi|257093349|ref|YP_003166990.1| NodT family RND efflux system, outer membrane lipoprotein
           [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
 gi|257045873|gb|ACV35061.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
          Length = 521

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 126/466 (27%), Positives = 224/466 (48%), Gaps = 20/466 (4%)

Query: 4   LRAIFSLFIVLLAGCT-VGPEYTKPHMPLLPTQFSI------GNSKNLINIDTLKWWESF 56
            R +     VLL GC  VGP++ +P +  LP              +      T +WW +F
Sbjct: 11  RRLLAMAGAVLLGGCAAVGPDFKRPAVSWLPGWSGGSLDSLNAEQRGKPRAQTEEWWRNF 70

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASI---------SHR 107
           +D  L++L+  A + N  +  A  RI  A+  ++   + L+P                  
Sbjct: 71  SDPVLDQLIAEAQRVNPNVRTAGMRILEARAQLMIAGSLLYPQQQQITGTVLRTGEERSS 130

Query: 108 FIPNLKTNSTGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYID 166
              +  T     L   W+ID +G+ R  +E++ +   ++ AQ D  ++ + +++   Y  
Sbjct: 131 GPDSALTAYNAGLAIGWEIDFWGKFRRSVEAADSGYFASIAQYDDLQVLMAAQVATFYCA 190

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
            R  + R+ IAHQ   L K+++E++   F  G  S+L + + +A+  +  S IP LE S 
Sbjct: 191 IRTLELRLQIAHQNAALQKRSLEITERLFKHGNDSELDVQQAKAQYLATLSTIPQLEGSL 250

Query: 227 RMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLA 286
           R   + +  +L  P             N  P   + + + +PADL+R RPD+R  E +LA
Sbjct: 251 RQTQNALGVVLARPPGPLSEMAD--GKNTIPQAELGVIVDLPADLLRRRPDVRAVEMQLA 308

Query: 287 DSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNT-HWSFGPKLYLPIFDKGKIKSNIR 345
              A IG++ +DLYPS++L GS+ L+  +      T  W  GP L   +FD G++   + 
Sbjct: 309 AQSALIGVSVADLYPSIALLGSLGLSATSLSGSPRTLAWGVGPSLVWNVFDHGRLTGEVL 368

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
             ++  Q+ Y  +   VL A +EV++A     ++++ V  L+ AV+  K+S++++ I YR
Sbjct: 369 VQDARFQQLYEQYHGAVLQAAREVDDAAVGFAKNREQVPILEEAVKAAKRSLAIASIQYR 428

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +G  +   +LD +R     +  L   +  +A+S V LY A+G G+ 
Sbjct: 429 EGLANFERVLDSQRTLFSQQERLVSNRGNVAQSLVALYKAMGGGWQ 474


>gi|126457707|ref|YP_001075533.1| outer membrane efflux protein OprB [Burkholderia pseudomallei
           1106a]
 gi|242311982|ref|ZP_04810999.1| outer membrane efflux protein OprM [Burkholderia pseudomallei
           1106b]
 gi|126231475|gb|ABN94888.1| outer membrane efflux protein OprM [Burkholderia pseudomallei
           1106a]
 gi|242135221|gb|EES21624.1| outer membrane efflux protein OprM [Burkholderia pseudomallei
           1106b]
          Length = 512

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 104/461 (22%), Positives = 200/461 (43%), Gaps = 30/461 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIG------------NSKNLINIDTLKWWESFNDTSLNKL 64
           GCT+ P Y +P  P+     + G             S N      + W E F D  L +L
Sbjct: 18  GCTLAPRYERPAAPVSGAFPADGVYAAQPGAAPGARSANGQAAVDIGWREFFVDPRLQRL 77

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSS-----------YASISHRFIPNLK 113
           ++IAL+ N  +  +   + A++      RA LFP+             A +S    P + 
Sbjct: 78  IEIALKNNRDLRVSVLNVEASRAQYQITRAGLFPTLSGTGTGTIQRTPAGVSITGQPLIS 137

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                 + + W++DLFG+ + + + +LA   +       A++++++ +   Y+      +
Sbjct: 138 RTYNVGVSASWELDLFGRVQSLKDQALAQYFATAQARKAAEISLVASVADQYLTLLSTDD 197

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + +    L   + + +L+ L+F  G  S+L L + +  +++  +      ++    ++ 
Sbjct: 198 LLQVTQNTLKSARASYDLTKLQFDNGTGSELDLRQAQTVVETALASQQAQARARAQALNA 257

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G P  + L      +     NL   I  G+P+DL+  RPDI   E+ L  + A I
Sbjct: 258 LVLLIGEPLPDDLPAGLPLNA---QNLLTDIPAGLPSDLLTRRPDIMQAEETLRAANANI 314

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL  +           F      WSF P + LPIF+ G+  +N+  A  
Sbjct: 315 GAARAAFFPKISLTSAFGTASPTLGGLFKAGTAAWSFAPNIALPIFEGGQNIANLDLAHV 374

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             + +   +++ + +A +EV + L +     + +  L+      ++   LS + YR G  
Sbjct: 375 QKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRYDLSDLRYRNGVD 434

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 435 SYLSVLTAQTDLYSAQHQLISARLARWTNLVDLYRALGGGW 475


>gi|226198324|ref|ZP_03793894.1| outer membrane efflux protein OprM [Burkholderia pseudomallei
           Pakistan 9]
 gi|225929608|gb|EEH25625.1| outer membrane efflux protein OprM [Burkholderia pseudomallei
           Pakistan 9]
          Length = 511

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 104/461 (22%), Positives = 200/461 (43%), Gaps = 30/461 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIG------------NSKNLINIDTLKWWESFNDTSLNKL 64
           GCT+ P Y +P  P+     + G             S N      + W E F D  L +L
Sbjct: 18  GCTLAPRYERPAAPVSGAFPADGVYAAQPGAAPGARSANGQAAVDIGWREFFVDPRLQRL 77

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSS-----------YASISHRFIPNLK 113
           ++IAL+ N  +  +   + A++      RA LFP+             A +S    P + 
Sbjct: 78  IEIALKNNRDLRVSVLNVEASRAQYQITRAGLFPTLSGTGTGTIQRTPAGVSITGQPLIS 137

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                 + + W++DLFG+ + + + +LA   +       A++++++ +   Y+      +
Sbjct: 138 RTYNVGVSASWELDLFGRVQSLKDQALAQYFATAQARKAAEISLVASVADQYLTLLSTDD 197

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + +    L   + + +L+ L+F  G  S+L L + +  +++  +      ++    ++ 
Sbjct: 198 LLQVTQNTLKSARASYDLTKLQFDNGTGSELDLRQAQTVVETALASQQAQARARAQALNA 257

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G P  + L      +     NL   I  G+P+DL+  RPDI   E+ L  + A I
Sbjct: 258 LVLLIGEPLPDDLPAGLPLNA---QNLLTDIPAGLPSDLLTRRPDIMQAEETLRAANANI 314

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL  +           F      WSF P + LPIF+ G+  +N+  A  
Sbjct: 315 GAARAAFFPKISLTSAFGTASPTLGGLFKAGTAAWSFAPNIALPIFEGGQNIANLDLAHV 374

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             + +   +++ + +A +EV + L +     + +  L+      ++   LS + YR G  
Sbjct: 375 QKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRYDLSDLRYRNGVD 434

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 435 SYLSVLTAQTDLYSAQQQLISARLARWTNLVDLYRALGGGW 475


>gi|241206136|ref|YP_002977232.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240860026|gb|ACS57693.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 477

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 184/464 (39%), Positives = 280/464 (60%), Gaps = 15/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M  LR      ++LL+GC VGP++  P MP LP +F  G +K+  ++ T+ WW +F D  
Sbjct: 1   MVSLRFATPALLLLLSGCVVGPDHVPPEMP-LPAKFGEGGTKSDGDVTTVAWWSAFRDRK 59

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN--------- 111
           L+ LV+  L QNL++ QA ERINAA  N+    A   P+     SH              
Sbjct: 60  LDGLVQSGLDQNLSVQQAIERINAASANVTVAGAGALPNLTVGASHTVSGQKGELRTQFD 119

Query: 112 LKTNSTGQLDSDWKID-LFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
            +  S G+    W +D     +R+ ES+LA+LDSAYA  D+AKL ++  L+ SYID R++
Sbjct: 120 TRNTSGGEAQLTWLLDIFGLYKRNTESALASLDSAYASADVAKLTLVQDLVSSYIDVRYY 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           ++R++++   L   ++  EL+  +   GA S+L +V+ E  ++S  ++IP LE + R++ 
Sbjct: 180 QQRLALSKANLKSRQETYELTKFQLEAGAASRLDVVQAEGLVQSTLAEIPGLETNIRISA 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           H+I+TLLG PA   +          QP     I  GIPADLIRNRPDIR  E+ LA + A
Sbjct: 240 HHIATLLGLPAATLVD--DLLKGYGQPVFRGGITSGIPADLIRNRPDIRVAERDLAAATA 297

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS--FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
           +IG+A++ LYPS+SL+GSI+  + N     G  T WSFGP L LPIFD G +++ ++ A+
Sbjct: 298 QIGVAQAQLYPSISLSGSISPAYINQRGIHGGLTPWSFGPTLNLPIFDGGTLRAGVKTAQ 357

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           S+A   Y+ W+ TVL AI++VENAL+++  D + V+ LQ  V+  ++++ LS  +Y+ G 
Sbjct: 358 SNAAAAYLNWKSTVLTAIEQVENALSAVRRDARTVSALQAQVKTTQETLELSTASYKDGA 417

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            SLLD+LD +R  +  +  L+ A +Q+AK YV L IA+G G+ P
Sbjct: 418 SSLLDVLDAQRQVSLAQASLAAAVQQMAKDYVSLNIAVGGGFAP 461


>gi|78222031|ref|YP_383778.1| RND efflux system, outer membrane lipoprotein, NodT [Geobacter
           metallireducens GS-15]
 gi|78193286|gb|ABB31053.1| RND efflux system, outer membrane lipoprotein, NodT [Geobacter
           metallireducens GS-15]
          Length = 517

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 105/464 (22%), Positives = 203/464 (43%), Gaps = 25/464 (5%)

Query: 8   FSLFIVLLAGCT-VGPEYTKPHMPLLPTQ-----FSIGNSKNLINIDTLKWWESFNDTSL 61
            S+  + LAGCT + P+Y +P  P+         +     ++   +  + W E F D  L
Sbjct: 52  VSIMTLTLAGCTTMAPKYERPAAPVSAAWPEGPAYKETGVRSGKPVADIPWQEFFEDEKL 111

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK-------- 113
            KL+ +AL+ N  +  A   I  ++      R+DLFP   A+         +        
Sbjct: 112 RKLIALALENNRDLRVAALNIERSRAQYRIQRSDLFPKVDATADGSVQRIPQDLSATGQA 171

Query: 114 ----TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
                 S G   S +++DLFG+ R + + +L    +        ++++++++  +Y+   
Sbjct: 172 RTVDQYSVGLGVSSYELDLFGRVRSLKDQALEQYLATEQARRSVQISLVAEVASNYLTLA 231

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
             +ER+ +A   L   + +  L+  +F  G +S L L +    ++S   DI         
Sbjct: 232 ADRERLKLAQDTLASQQSSYNLTKSRFEAGVSSFLDLNQARTSVESARVDIARYTTLIAQ 291

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
           +V+ ++ ++G P +     +   +     +    +  G+P+D++  RPDI   E  L  +
Sbjct: 292 DVNALNLVVGSPVST---ALLPAALTENLSAMKDVAPGLPSDVLLRRPDILQAENLLKGA 348

Query: 289 VAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
            A IG A+++ +P ++L  S+    D     F G +  W+F P++ LPIF  G  ++ ++
Sbjct: 349 NANIGAARANFFPRITLLSSVGFGSDELTGLFSGNSFTWNFAPRITLPIFTAGANQATLK 408

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
            AE         +++ +  A +EV +AL         ++  Q   +   +S  LS   Y 
Sbjct: 409 VAEVDRDIAVAQYEKAIQTAFREVADALAQRGTIDDQLSAQQSLTDATSESYRLSQARYE 468

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           +G  S L +LD +RA    + +L   +     +   LY  +G G
Sbjct: 469 KGVDSYLQVLDSQRALYGAQQNLIGVRLVRLLNVATLYKVLGGG 512


>gi|222106969|ref|YP_002547760.1| nodulation protein T precursor [Agrobacterium vitis S4]
 gi|221738148|gb|ACM39044.1| nodulation protein T precursor [Agrobacterium vitis S4]
          Length = 483

 Score =  204 bits (517), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 177/461 (38%), Positives = 284/461 (61%), Gaps = 13/461 (2%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M  +R      ++LL+GC +GPE++ P    LP +F+ G +K+  +  T++WW +FND  
Sbjct: 1   MVSVRLAAPFAMLLLSGCVMGPEHSPPQT-ALPAKFTEGGTKSAQDTTTVQWWTAFNDAR 59

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST--- 117
           LN L+   + QNL +LQA ERI  A+  +++  A   PS   + S          ++   
Sbjct: 60  LNTLINQGVNQNLDVLQALERIEQARATVVTSSAGGLPSLTGTASESGSQTNGGYNSQPR 119

Query: 118 -----GQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
                G+L + W +DL+GQ R  + S  A+LD+AYA VD ++L  +S L  +YIDAR+++
Sbjct: 120 AWESKGELSASWLLDLWGQYRRAKQSATASLDAAYASVDTSRLTYLSDLATAYIDARYYQ 179

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
            RI+IA++ +   ++ + L+ L+   GA S+L +V+ E  + S  +DIP  E +F  N +
Sbjct: 180 ARIAIANEAVKSRRETLALTKLQLEAGAASRLDVVQSEGLVNSQLADIPGFEANFYSNAY 239

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
           +ISTLLG PA+  ++ ++K +   QP     +  GIPADLIRNRPDIR  E+ LA +V  
Sbjct: 240 HISTLLGLPASTLINDLKKHAP--QPVARRVVLSGIPADLIRNRPDIRKAERDLAAAVYD 297

Query: 292 IGIAKSDLYPSLSLNGSIALTHDNSFPGYN-THWSFGPKLYLPIFDKGKIKSNIRRAESS 350
           IG A++ L PS++L+GSI+ ++ +S        WSFGP L LPIFD G +++N++ A+S 
Sbjct: 298 IGNAQAQLLPSITLSGSISPSYVHSNTHGTANTWSFGPSLNLPIFDGGTLRANVKNAQSV 357

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
           A+E+Y+ W++TVLN +++VE+AL + N D + V   +  V+ +K+++ LS  +Y+ G  S
Sbjct: 358 AREKYLAWKQTVLNGVEDVESALAAYNRDARAVAANRAYVKSYKEALELSTASYKDGASS 417

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           LLD+LD +R     +  L+ + +Q+A  YV L +AIG GYN
Sbjct: 418 LLDVLDAQRELTTAQASLAESIQQMANDYVTLNVAIGGGYN 458


>gi|260642741|ref|ZP_05417145.2| RND efflux system, outer membrane protein, NodT family [Bacteroides
           finegoldii DSM 17565]
 gi|260620754|gb|EEX43625.1| RND efflux system, outer membrane protein, NodT family [Bacteroides
           finegoldii DSM 17565]
          Length = 460

 Score =  204 bits (517), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 104/459 (22%), Positives = 206/459 (44%), Gaps = 17/459 (3%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
             L  +  LF+ +L  C VG  Y +P + L     S+   ++ ++     W + + D++L
Sbjct: 5   KKLYIVILLFVGILTSCKVGKSYVRPDLHLPD---SLAQHQDSVSFGDQDWKDIYTDSTL 61

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF--------IPNLK 113
             L++ AL  N  +L A  R+           A L P     ++                
Sbjct: 62  RSLIERALDHNKDMLIAAARVKEMAAQKRISTAALLPDIKGKVTAERELENHGGEAFKRS 121

Query: 114 TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                Q    W++DL+G  R    +S+A    +       ++ +++++  +Y +      
Sbjct: 122 DTFEAQFLVSWELDLWGNLRWARSASIAEYLQSVEAQRALRMTIVAEVAQAYYELVALDT 181

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + I  Q L   ++ + L+ ++F  G TS+ S  + + E+    + +P LE+   +  ++
Sbjct: 182 ELDIVKQTLKAREEGVRLARIRFAGGLTSETSYRQSQVELARTATLVPDLERKISLKEND 241

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           I+ L G         + +     +      + IG+P+ L+  RPDIR  E+KL  + AK+
Sbjct: 242 IAFLAGEYPN----KIARSRLLQEFKSPETLPIGLPSTLLERRPDIRQAEQKLIAANAKV 297

Query: 293 GIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYL-PIFDKGKIKSNIRRAESSA 351
           G+A ++++P L+L G       +      + ++      L PIF  GK ++ ++  +++ 
Sbjct: 298 GVAYTNMFPRLALTGGFGSESTSLSELLKSPYAVMEGALLTPIFGWGKNRAALKAKKAAY 357

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           + +   ++++VL A KE  NA+ + N+ K++     +     K  M L+ + Y  G  + 
Sbjct: 358 EVEVHNYEKSVLQAFKETRNAIVNFNKIKEVYELRANLERSAKSYMELAQLQYINGVINY 417

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           LD+LD +R     ++ LS A R    + V LY A+G G+
Sbjct: 418 LDVLDAQRGYFDAQIGLSNAIRDELITVVQLYKALGGGW 456


>gi|307822818|ref|ZP_07653049.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Methylobacter tundripaludum SV96]
 gi|307736422|gb|EFO07268.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Methylobacter tundripaludum SV96]
          Length = 471

 Score =  204 bits (517), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 122/466 (26%), Positives = 216/466 (46%), Gaps = 24/466 (5%)

Query: 1   MNILRAIFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDT 59
           M  + +I  L  + L GC  +GP+Y KP  P +P  +    ++ +   DT +WWE F D 
Sbjct: 1   MRHI-SIPLLLPLALTGCFMIGPDYQKPTAP-IPDAWRFAPAETVAASDT-RWWEQFGDP 57

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP--------- 110
            L +L++ AL  N  +  AT  +          RADLFP    S S++            
Sbjct: 58  RLTQLIEQALLHNKDLQIATATVEEFLGLYSVTRADLFPQISGSASYQRQQISGVTAGAL 117

Query: 111 --NLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
                 N    L+  W+ID++G+ RR  E++ ANL           L +++ +  SY+  
Sbjct: 118 PTPASDNIQAALNLSWEIDVWGRLRRATEAARANLYGQEETRRTVVLTLVTSVARSYVQL 177

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
               +R+ IA + L   ++   ++  +F     S   + + E+E+ +  + +P LE    
Sbjct: 178 CELDQRLEIAKRTLVDRREAYRIARARFEGELNSSAEVRQAESEVHNTAASVPQLESLVA 237

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
              H +S LLG+        +     +        I  G+P++L+  RPDIR  E+ L  
Sbjct: 238 QKEHELSVLLGHNPAAVQRGLALTELHL-----PSIPAGLPSELLTRRPDIRKAEQDLIA 292

Query: 288 SVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNI 344
           + A IG+AK+  +P  ++ GS      +      G    W++G  L +P+F  GKI   +
Sbjct: 293 ANANIGVAKAAYFPKFTVTGSFGGASADFSQLLSGPAGAWNYGLGLAMPLFTAGKIAGQV 352

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
           + +E+  QE   ++Q+T+L A +E ENAL   ++ ++ V  L   V   ++   L+ + Y
Sbjct: 353 KASEAREQESLFSYQKTLLQAFQETENALIDNSKIQEQVQALNRQVIALREYRRLAWLRY 412

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             G    L +LD +R    +E+ L+ A+    ++ +++Y A G  +
Sbjct: 413 NNGLTDYLVVLDAQRNLFNIELALATAQSNSLQAVINVYKAFGGSW 458


>gi|299531194|ref|ZP_07044605.1| RND efflux system, outer membrane lipoprotein [Comamonas
           testosteroni S44]
 gi|298720777|gb|EFI61723.1| RND efflux system, outer membrane lipoprotein [Comamonas
           testosteroni S44]
          Length = 473

 Score =  204 bits (517), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 96/459 (20%), Positives = 204/459 (44%), Gaps = 10/459 (2%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
             L  +     +L +GC+  P   +P  P+     +            + W + + D  L
Sbjct: 3   KTLLPVALAGALLASGCSFIPTLERPAAPVAEHYSATDEQAGATAAADIPWQQFYTDPRL 62

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP------NLKTN 115
            +++++AL+ N  +  A   I  A+      RA  FP    + S    P         + 
Sbjct: 63  QQVIQLALENNRDLRVAVLNIEKAQAQYQIQRAGQFPEFGVAGSASRQPSATTGRYANSY 122

Query: 116 STGQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
             G     W+ID +G+   ++    A   +       A++++I+ +  ++++ +  +E +
Sbjct: 123 MVGLSMPSWEIDFWGRIGSLKQQALAQYLATEEGRKAAQISLIATVANTWLNLQADEELL 182

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
           +I+ + L   +++I+L+ L+   G  S+L   + ++  +S  + +         +V+ ++
Sbjct: 183 AISRRTLGTREQSIKLTKLRLDSGVASELDYRQAQSLTESARATLAQQAGQRERDVNALT 242

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
            L+G      L    +            +  G+P+DL+  RPDIR  E+ +  + A IG 
Sbjct: 243 LLVGQTLPADLLTSMQGKQLRDLPALADVPSGLPSDLLLRRPDIRQAEQSMIAANASIGA 302

Query: 295 AKSDLYPSLSLNGSIALTHDNSFP---GYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           A++  +P++SL  S      +        +  ++  P LYLPIF+ G+ ++N++ AE+S 
Sbjct: 303 ARALFFPNISLTASAGFASSDISDLLKSDSAAFTIAPSLYLPIFNAGRNRANLQVAEASQ 362

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           +     ++ ++ +A +EV + L +    K  +      +E  +    LS + Y  G  S 
Sbjct: 363 KIAVAQYEGSIQSAFREVSDTLVNRQALKDQLDAQSRQLEAEQVRYKLSDLRYTNGVASY 422

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           LD+LD +R+   +E  +   +    ++ V+LY  +G G+
Sbjct: 423 LDLLDAQRSLFALEQSVVQVRLAQLQNQVNLYKVLGGGW 461


>gi|332284300|ref|YP_004416211.1| Major intrinsic multiple antibiotic resistance efflux outer
           membrane protein OprM precursor [Pusillimonas sp. T7-7]
 gi|330428253|gb|AEC19587.1| Major intrinsic multiple antibiotic resistance efflux outer
           membrane protein OprM precursor [Pusillimonas sp. T7-7]
          Length = 475

 Score =  204 bits (517), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 99/462 (21%), Positives = 197/462 (42%), Gaps = 24/462 (5%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLI-----NIDTLKWWESFNDTSLNK 63
               +LL  C++ P+Y +P +P     +  G +             + W   F D +L K
Sbjct: 6   VALSMLLQACSLTPKYERPALPAETAAWPQGEAYGESQKLGMAAADISWQSFFQDPALKK 65

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL----------- 112
           L+ +AL  N  +  A   ++A +      R+ LFPS  A+ +                  
Sbjct: 66  LIAVALDSNRDLRVAALNVDAYRAQYRIQRSALFPSLDAAGNGARQRLPADLSPSGAAGI 125

Query: 113 KTNSTGQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
            +         +++D FG+ R++         +         +++++ +  +Y+  +  +
Sbjct: 126 SSQYDVGAAMAFELDFFGRIRNMNQQALEEYLATEEAKRSVHISLVANVAQAYLTWQADQ 185

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
             + +A + L   ++ + L    F  G  S L + +    +    + +    +   ++V+
Sbjct: 186 ALLEVAQRTLQTNERTLSLIQSSFDAGVASALEVRQARTTVNEARAYVQRYTRQVAVDVN 245

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
            +  LLG P    +     Q       ++  I +G+P+DL++ RPDI   E +L  + A 
Sbjct: 246 GLRMLLGGPLPTDM----PQGLKLDSQVFAEIPVGLPSDLLQRRPDILAAEHRLIGANAN 301

Query: 292 IGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
           IG A++  +P +SL GS           F G +  W+F P + +PIF+ G++ +N+  AE
Sbjct: 302 IGAARAAFFPRISLTGSAGTASSQMSGLFEGGSGTWAFMPSISMPIFNAGRLGANLDYAE 361

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
             +  +   ++ T+ NA +EV ++L +     K +   +  VE   +   L+   Y +G 
Sbjct: 362 IQSDIRVAQYERTIQNAFREVSDSLAARGTYGKQLEAQRELVENTSEYFKLAQQRYDEGV 421

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            S L++LD +R     +      +     S +DLY A+G G+
Sbjct: 422 DSYLNVLDAQRLLFTSQQQYIQDRLAQLNSEIDLYKALGGGW 463


>gi|209550733|ref|YP_002282650.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209536489|gb|ACI56424.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 480

 Score =  204 bits (517), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 182/449 (40%), Positives = 278/449 (61%), Gaps = 15/449 (3%)

Query: 16  AGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTI 75
           +GC VGP++  P MP LP +F  G +K++ ++ T  WW +FND  LN  VK  L QNLT+
Sbjct: 17  SGCVVGPDHVPPEMP-LPAKFGEGGTKSVGDVATAAWWTAFNDPKLNGYVKAGLDQNLTV 75

Query: 76  LQATERINAAKENILSVRADLFPSSYASISHRFIPN---------LKTNSTGQLDSDWKI 126
            QA ERINAA  N+ +  A   P+     SH               +  S G++   W +
Sbjct: 76  QQAIERINAASANVTTAGAGALPNLTVGGSHTVSGQRGELRTQFDTRNTSAGEVQLSWLL 135

Query: 127 D-LFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYK 185
           D     +R  ES+LA+LDSAYA  D+AKL ++  L+ SYID R++++R++++   L   +
Sbjct: 136 DLFGLYKRSTESALASLDSAYASADVAKLTLVQDLVSSYIDVRYYQQRLALSRANLKSRQ 195

Query: 186 KNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFL 245
           +  EL+  +   GA S+L +V+ E  ++S  ++IP LE + R++ H+I+TLLG PA+  +
Sbjct: 196 ETYELTKFQLEAGAASRLDVVQAEGLVQSTLAEIPGLETNIRISAHHIATLLGLPASALV 255

Query: 246 HYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSL 305
             +     + QP     IN GIPADLIRNRPD+R  E+ LA + A IG+A++ LYPS+SL
Sbjct: 256 DEL--LKGHGQPVFRGGINSGIPADLIRNRPDVRVAERDLAAATANIGVAQAQLYPSISL 313

Query: 306 NGSIALTHDNS--FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVL 363
           +GSI+ ++ N     G  T WSFGP L LPIFD G++++N++ A+S A   Y+ W+ TVL
Sbjct: 314 SGSISPSYINQRGIHGGLTPWSFGPTLNLPIFDGGRLRANVKSAQSDAATAYLNWKSTVL 373

Query: 364 NAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAK 423
            ++++VENAL ++  D + V+ LQ  V+  ++++ LS  +Y+ G  SLLD+LD +R  + 
Sbjct: 374 TSVEQVENALAAVRRDARTVSALQAQVKTTQETLELSTASYKDGASSLLDVLDAQRQVSL 433

Query: 424 VEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            +  L+ A +Q+AK YV L IA+G GY P
Sbjct: 434 AQASLAQAVQQMAKDYVSLNIAVGGGYAP 462


>gi|29345716|ref|NP_809219.1| outer membrane protein oprM [Bacteroides thetaiotaomicron VPI-5482]
 gi|253567704|ref|ZP_04845115.1| outer membrane protein oprM [Bacteroides sp. 1_1_6]
 gi|29337609|gb|AAO75413.1| outer membrane protein oprM precursor [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|251841777|gb|EES69857.1| outer membrane protein oprM [Bacteroides sp. 1_1_6]
          Length = 457

 Score =  204 bits (517), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 112/459 (24%), Positives = 205/459 (44%), Gaps = 17/459 (3%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
           N L     LF  +L  C VG  Y +P + L     S+   ++ ++     W E + D++L
Sbjct: 4   NKLYIAILLFAGILTSCKVGKSYVRPDLHLPD---SLAQHQDTVSFGDQDWEEIYTDSTL 60

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF--------IPNLK 113
             L+  AL  N  +L A  RI           A L P     ++                
Sbjct: 61  RSLIDRALDHNKDMLIAAARIKEMAAQKRISTAALLPDIKGKVTAERELENHGGDAFKKS 120

Query: 114 TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                Q    W++DL+G  R    +S+A    +       ++ +++++  +Y +      
Sbjct: 121 DTFEAQFLVSWELDLWGNLRWARSASIAEYLQSVEAQRALQMTIVAEVAQAYYELVALDT 180

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + I  Q L   ++ + L+ ++F  G TS+ S  + + E+    + +P LE+   +  ++
Sbjct: 181 ELDIVKQTLKAREEGVRLARIRFEGGLTSETSYRQAQVELARTATLVPDLERKISLKEND 240

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           I+ L G            Q  NF   L     IG+P+ L+  RPDIR  E+KL  + AK+
Sbjct: 241 IAFLAGEYPNRIARSRLLQEFNFPETLP----IGMPSTLLERRPDIRQAEQKLIAANAKV 296

Query: 293 GIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYL-PIFDKGKIKSNIRRAESSA 351
           G+A ++++P L+L G       +      + ++      L PIF  GK ++ ++  +++ 
Sbjct: 297 GVAYTNMFPRLALTGGFGSESTSLSELLKSPYAVMEGALLTPIFGWGKNRAALKGKKAAY 356

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           + +  ++++TVL A KE  NA+ + N+ K++     +     K  M L+ + Y  G  + 
Sbjct: 357 EAEIHSYEKTVLTAFKETRNAIVNFNKIKEVYALRANLERSAKSYMDLAQLQYINGVINY 416

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           LD+LD +R     ++ LS A R    + V LY A+G G+
Sbjct: 417 LDVLDAQRGYFDAQIGLSNAIRDELITVVQLYKALGGGW 455


>gi|293606422|ref|ZP_06688781.1| outer membrane multidrug efflux protein OprB [Achromobacter
           piechaudii ATCC 43553]
 gi|292815180|gb|EFF74302.1| outer membrane multidrug efflux protein OprB [Achromobacter
           piechaudii ATCC 43553]
          Length = 505

 Score =  204 bits (517), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 105/489 (21%), Positives = 203/489 (41%), Gaps = 42/489 (8%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLL----------------PTQFSIGNSKNL 44
           M    A+ +   V LAGC++ P+Y +P  P+                 PT      +  +
Sbjct: 5   MIKQSALSAFVAVALAGCSLAPDYQRPDAPVTGVWPDQPKVQYGGYNNPTSLGTQPASAV 64

Query: 45  IN-----IDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPS 99
           +         L W E F D  L +L+ ++L  N  +  A +R+  A+      R   +PS
Sbjct: 65  VPEAGIPAADLGWREFFRDPRLQRLISLSLVNNRDLRVAVQRVEEARAQYGVQRGAQWPS 124

Query: 100 SYASISHRFIPNLKTNSTGQLD--------------SDWKIDLFGQRRHIESSLANLDSA 145
             A I  +          G  D              + ++IDLFG+ R++  +      +
Sbjct: 125 IGAGIQGQRQHLPANMRAGGPDSSSISSSYQAGIGLTTFEIDLFGRLRNLSEAAYQQYLS 184

Query: 146 YAQVDIAKLNV-ISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLS 204
             Q         +  +  SY + R  + ++ +  + L   +++  L   +F  G  S+L 
Sbjct: 185 TEQAQKTVQITLVGSVAQSYFNLRAAEVQLDLTQRTLASRQESYNLVKRRFDGGVASELD 244

Query: 205 LVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPIN 264
           L + ++ + +  SD+  L ++    ++ +  L+G P       + + +   +  L   + 
Sbjct: 245 LNQSKSLLDTASSDLAQLARARAQALNALVLLVGTPLPAD---LPEAATFGRDQLLATVP 301

Query: 265 IGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYN 321
            G+P+DL+  RPDI   E +L  + A IG A++  +P++SL G + +      + F G  
Sbjct: 302 SGLPSDLLERRPDILAAENQLKSANANIGAARAAFFPTISLTGLLGVASPSLGDLFKGGQ 361

Query: 322 THWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKK 381
            +WSF P +  P+F  G I+  +  A++        +++T+  A +EV +AL        
Sbjct: 362 GYWSFSPSITTPLFAGGSIREGLNLAKARDNIAVAQYEQTIQQAFREVSDALAGEATYGA 421

Query: 382 IVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVD 441
            +   +   E   +++ LS + Y  G  S L +   +      ++ L         + V+
Sbjct: 422 QLDAQRALQESSSRTLELSNLRYTNGIDSYLQVQTAQVDFFNAQLSLVQTGLAALINRVE 481

Query: 442 LYIAIGSGY 450
           LY A+G G+
Sbjct: 482 LYKALGGGW 490


>gi|298384617|ref|ZP_06994177.1| RND efflux system, outer membrane protein, NodT family [Bacteroides
           sp. 1_1_14]
 gi|298262896|gb|EFI05760.1| RND efflux system, outer membrane protein, NodT family [Bacteroides
           sp. 1_1_14]
          Length = 457

 Score =  203 bits (516), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 111/459 (24%), Positives = 207/459 (45%), Gaps = 17/459 (3%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
           N L     LF  +L  C VG  Y +P + L     S+   ++ ++     W E + D++L
Sbjct: 4   NKLYIAILLFAGILTSCKVGKSYVRPELHLPD---SLAQHQDTVSFGDQDWEEIYTDSTL 60

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF--------IPNLK 113
             L+  AL+ N  +L A  RI           A L P     ++                
Sbjct: 61  RNLIDRALEHNKDMLIAAARIKEMAAQKRISTAALLPDIKGEVTVERELENHGGDAFRKS 120

Query: 114 TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                Q    W++DL+G  R    +S+A    +       ++ +++++  +Y +      
Sbjct: 121 DTFEAQFLVSWELDLWGNLRWARSASIAEYLQSIEAQRALRMTIVAEVAQAYYELVALDT 180

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            ++I  Q L   ++ + L+ ++F  G TS+ S  + + E+    + +P LE+   +  ++
Sbjct: 181 ELNIVKQTLKAREEGVRLARIRFEGGLTSETSYRQAQVELARTATLVPDLERKISLKEND 240

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           I+ L G            Q  NF   L     +G+P+ L+  RPDIR  E+KL  + AK+
Sbjct: 241 IAFLAGEYPNRIARSRLLQEFNFPETLP----VGMPSTLLERRPDIRQAEQKLIAANAKV 296

Query: 293 GIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYL-PIFDKGKIKSNIRRAESSA 351
           G+A ++++P L+L G       +      + ++      L PIF  GK ++ ++  +++ 
Sbjct: 297 GVAYTNMFPRLALTGGFGSESTSLSELLKSPYAVMEGALLTPIFGWGKNRAALKGKKAAY 356

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           + +  ++++TVL A KE  NA+ + N+ K++     +     K  M L+ + Y  G  + 
Sbjct: 357 EAEIHSYEKTVLTAFKETRNAIVNFNKIKEVYALRANLERSAKSYMDLAQLQYINGVINY 416

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           LD+LD +R     ++ LS A R    + V LY A+G G+
Sbjct: 417 LDVLDAQRGYFDAQIGLSNAIRDELITVVQLYKALGGGW 455


>gi|167035422|ref|YP_001670653.1| RND efflux system outer membrane lipoprotein [Pseudomonas putida
           GB-1]
 gi|166861910|gb|ABZ00318.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Pseudomonas putida GB-1]
          Length = 484

 Score =  203 bits (516), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 97/470 (20%), Positives = 197/470 (41%), Gaps = 24/470 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINID----TLKWWESF 56
           M       ++   +L GC++ P+Y  P  P+              + D       W + F
Sbjct: 1   MTKSLLSLAVTAFILGGCSLIPDYQTPEAPVAAQWPQGPAYSPTQSADVAAAEQGWRQFF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
           +D +L +L++ +L  N  +  A   ++A +      RADLFP+  A+ S          S
Sbjct: 61  HDPALQQLIQTSLVNNRDLRVAALNLDAYRAQYRIQRADLFPAVSATGSGSRQRVPANMS 120

Query: 117 TGQLD------------SDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPS 163
                            S +++DLFG+ R +         S+       ++ +++ +  +
Sbjct: 121 QTGESGITSQYSATLGVSAYELDLFGRVRSLTEQALETYLSSEQARRSTQIALVASVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y   +  +    +  + L  Y+++  L+      G  S L + +    ++         +
Sbjct: 181 YYTWQADQALFKLTEETLKTYEESYNLTRRSNEVGVASALDVSQARTAVEGARVKYSQYQ 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    +V++++ LLG      L    + + +    +      G+P+D+++ RPDI+  E 
Sbjct: 241 RLVAQDVNSLTVLLGTGIPADLAKPLELNADQLAEVP----AGLPSDILQRRPDIQEAEH 296

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKI 340
            L  + A IG A++  +PS+SL  +      +    F G    W F P++ LPIF+ G +
Sbjct: 297 LLKAANANIGAARAAFFPSISLTANAGSLSPDMGHLFAGGQGTWLFQPQINLPIFNAGSL 356

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           K+++  ++         +++T+  A +EV + L +    ++ +   +  V+ ++    L+
Sbjct: 357 KASLDYSKIQKDINVAKYEKTIQTAFQEVSDGLAARKTFEEQLQAQRDLVQANQDYYRLA 416

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              YR G  S L  LD +R     +  L   +     S V+LY A+G G+
Sbjct: 417 ERRYRIGIDSNLTFLDAQRNLFSAQQALIGDRLSQLTSEVNLYKALGGGW 466


>gi|226194757|ref|ZP_03790349.1| outer membrane efflux protein OprC [Burkholderia pseudomallei
            Pakistan 9]
 gi|225933101|gb|EEH29096.1| outer membrane efflux protein OprC [Burkholderia pseudomallei
            Pakistan 9]
          Length = 1576

 Score =  203 bits (516), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 103/465 (22%), Positives = 198/465 (42%), Gaps = 39/465 (8%)

Query: 20   VGPEYTKPHMPLLPTQFSIGN------------SKNLINIDTLKWWESFNDTSLNKLVKI 67
            VGP+Y +P +                       ++        +WW +F D  L+ L   
Sbjct: 1098 VGPDYRRPDVATPAAFKEAPALAPGEQAGTWKAAEPADAAHRGEWWRAFGDPVLDALETQ 1157

Query: 68   ALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI--------------PNLK 113
            AL  N  +  A  R+  A+    + R+  FP                         P   
Sbjct: 1158 ALAANQNLKAAAARVEQARAATRAARSQWFPQVGVGFGPTREGLSSASQFQPQGSGPTNA 1217

Query: 114  TNSTGQLDSDWKIDLFGQR-RHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
            T    Q    ++ DLFG+  R++E+S A+   + A     +L + + +  +Y + R    
Sbjct: 1218 TLWRAQGTVSYEADLFGRVGRNVEASRADEAQSQALFRSVQLALQADVAQNYFELRRLDS 1277

Query: 173  RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
               +  + + L ++ ++L   +F +G  S+L + + + E+ + ++D   + +    + H 
Sbjct: 1278 DQDLYRRTVGLREEALKLVQRRFAEGDISELDVSRAKNELATAQADAVGVARRRAASEHA 1337

Query: 233  ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
            ++ LLG    +F       +      + + +  G+P+ L+  RPDI   E+ +  + A+I
Sbjct: 1338 LAILLGKAPADFSFSETPIAP-----VAVRVPAGLPSALLERRPDIAAAERAMMAANARI 1392

Query: 293  GIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKL----YLPIFDKGKIKSNIR 345
            G+AKS  +P L + G+         N F   +  +  GP       LPIFD G+  + + 
Sbjct: 1393 GLAKSAYFPKLDITGAFGYEAATLGNLFLWSSRTFLLGPFAGTALTLPIFDGGRRSAGVA 1452

Query: 346  RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
            +A +   E+   +++ VL A +EVE+ L  +      +     AV   +++  LS   Y+
Sbjct: 1453 QARAKYDEEVANYRQQVLVAFREVEDNLADLRLLDDQIRAQSDAVNASRRAAKLSRTQYQ 1512

Query: 406  QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            +G  S LD++D ER+  + ++  +      A S V+L  A+G G+
Sbjct: 1513 EGAVSYLDVIDSERSVLESQLQSNQLTGTQAVSTVNLIRALGGGW 1557


>gi|134294075|ref|YP_001117811.1| RND efflux system outer membrane lipoprotein [Burkholderia
           vietnamiensis G4]
 gi|134137232|gb|ABO58346.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia vietnamiensis G4]
          Length = 490

 Score =  203 bits (516), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 107/461 (23%), Positives = 201/461 (43%), Gaps = 29/461 (6%)

Query: 16  AGCTVGPEYTKPHMPLLPTQFSIG-----------NSKNLINIDTLKWWESFNDTSLNKL 64
            GCT+ P YT+P  P+     + G            S N      + W E F D  L +L
Sbjct: 17  TGCTMAPHYTRPDAPVAQAYPAGGVYATQPAAAGTRSANGQAATAIGWREFFADPRLQRL 76

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSS-----------YASISHRFIPNLK 113
           ++IAL  N  +  A   I A++      RA LFP+             A +S    P + 
Sbjct: 77  IEIALNNNRDLRVAVLNIEASRAQYQITRAGLFPTLDGTGSGSIQRYPAGVSTTRQPLIT 136

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
              +  L + W++DLFG+ + + + +LA   S        +++++S++   Y+     ++
Sbjct: 137 RTYSVGLSASWELDLFGRVQSLKDQALAQYLSTSYARQATEISLVSQVADQYLTLLSTED 196

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + +    L   + + +L+ L+F  G  S+L L + +  ++   ++     ++    V+ 
Sbjct: 197 LLKVTENTLKTAQASYDLTKLQFDNGTGSELDLRQAQTVVEQALANQQAQARARAQAVNA 256

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G P  + L            NL   +  G+P+DL+  RPD+   E+ L  + A I
Sbjct: 257 LVLLIGEPLPDDLPAGMSLDA---QNLLTDVPAGLPSDLLTRRPDVMQAEQTLLAANANI 313

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL  +           F      WSF P+L +PIF+ G+  +N+  A  
Sbjct: 314 GAARAAFFPRISLTAAFGTASPTLGGLFKAGTAAWSFAPQLTMPIFEGGQNIANLNLANV 373

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             + +   +++ + +A +EV + L +       +  L+      ++   LS + Y+ G  
Sbjct: 374 QKRIEIANYEKAIQSAFREVSDGLAARGTYDLQIAALERNEHAQQRRFDLSDLRYKNGVD 433

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S L +L  +      +  L  A+     + VDLY A+G G+
Sbjct: 434 SYLSVLTAQTDLYSAQQSLISARLARWTNLVDLYRALGGGW 474


>gi|157412124|ref|YP_001481465.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli APEC O1]
 gi|218697184|ref|YP_002404851.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli 55989]
 gi|99867149|gb|ABF67794.1| SilC [Escherichia coli APEC O1]
 gi|218353916|emb|CAV00346.1| putative outer membrane lipoprotein silC precursor [Escherichia
           coli 55989]
          Length = 562

 Score =  203 bits (516), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 96/464 (20%), Positives = 209/464 (45%), Gaps = 19/464 (4%)

Query: 1   MNILRAIFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINI---DTLKWWESF 56
           M  L+ +    I +LAGC ++ PEY +P  P +P QFS+ ++     +       W   F
Sbjct: 102 MFKLKLLSISTIFILAGCVSLAPEYQRPAAP-VPQQFSLSHNSLTPAVNGYQDTGWRNFF 160

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP------ 110
            D  + +L+  AL  N  +  A  ++  A+       AD +P   AS    +        
Sbjct: 161 VDPQVTRLIGEALTNNRDLRMAALKVEEARAQFNVTDADRYPQLNASSGITYSGGLKGDK 220

Query: 111 NLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                   +L+  +++D FG+ +   ++   N  ++        + ++S +  SY   + 
Sbjct: 221 PTTQEYDARLELSYELDFFGKLKNMSDADRQNYFASEEARRAVHILLVSNVSQSYFSQQL 280

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
             E++ IA + L  Y+++      +   G+T+ L+L +   +I+S  ++I   E      
Sbjct: 281 AYEQLRIARETLKNYQQSYAFVEQQLVTGSTNVLALEQARGQIESTRAEIAKREGDLAQA 340

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            + +  +LG     +     ++         + +   + + ++  RPDI   E +L  + 
Sbjct: 341 NNALQLVLG----TYRALPSEKGMKGGEIAPVKLPPNLSSQILLQRPDIMEAEYQLKAAD 396

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           A IG A++  +PS++L   ++ +     + F   +  W+F PK+ +PIF+ G+ K+N++ 
Sbjct: 397 ANIGAARAAFFPSITLTSGLSASSTELSSLFTSGSGMWNFIPKIEIPIFNAGRNKANLKL 456

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
           AE   Q+  + +++ + +A K+V + L   +   + +   Q  ++  + ++  +   Y  
Sbjct: 457 AEIRQQQSVVNYEQKIQSAFKDVSDTLALRDSLSQQLESQQRYLDSLQITLQRARGLYAS 516

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           G  S +++LD ER+    +  +         + ++L+ A+G G+
Sbjct: 517 GAVSYIEVLDAERSLFATQQTILDLTYSRQVNEINLFTALGGGW 560


>gi|77458436|ref|YP_347941.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           fluorescens Pf0-1]
 gi|77382439|gb|ABA73952.1| putative cation transport lipoprotein [Pseudomonas fluorescens
           Pf0-1]
          Length = 472

 Score =  203 bits (516), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 101/452 (22%), Positives = 207/452 (45%), Gaps = 22/452 (4%)

Query: 18  CTVGPEYTKPHMPLLPTQFSIGN--SKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTI 75
           C++ P+Y +P  P            +++ +      W   FND +L +L++ AL  N  +
Sbjct: 18  CSLIPDYQRPASPSAAQYPQGPAYAAQSPVTPRVEDWRALFNDPALQQLIESALVNNRDL 77

Query: 76  LQATERINAAKENILSVRADLFPSSYASISHRFIPNLK-----------TNSTGQLDSDW 124
             A   + A +      RADL P+  A+ +                   T S     S +
Sbjct: 78  RVAALNVEAFQAQYRIQRADLLPAVSANANELRQRVPSSVTRTKAAITSTYSVNLGISAY 137

Query: 125 KIDLFGQRRHIESSLANLD-SAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDL 183
           ++D FG+ R +         S       A+L++++ +  +Y+  R  +E +++A + L  
Sbjct: 138 ELDFFGRVRSLSEQALLTWLSTEEARRSAQLSLVANVANAYLTWRADQELLALAQETLAA 197

Query: 184 YKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATE 243
            ++++ L+      G +S L  ++ +  + S  + +   ++    ++++++ L+G P  E
Sbjct: 198 DERSLHLTTRNREAGKSSALDQIQAQTSVDSTRASLARYQRQVAQDLNSLTLLVGAPVPE 257

Query: 244 FLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSL 303
            L      S+     L   +  G+P+DL++ RPDI   E KL  + A IG A++  +PS+
Sbjct: 258 HLPARPLDSD-----LVATVPAGLPSDLLQRRPDILQAEYKLRAANANIGAARAAFFPSV 312

Query: 304 SLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQE 360
           SL  +   +  +    F G +  W+F P++ LPIF+ G +++++  A+         +++
Sbjct: 313 SLTANAGTSSRDLSRLFKGGSGTWTFQPQINLPIFNAGSLRASLDYAKLQKDITVAEYEK 372

Query: 361 TVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERA 420
           T+  A +EV + L +    ++ +   +  V+  +    ++   YR G  S L  LD +R+
Sbjct: 373 TIQTAFQEVSDGLAARQTYEQQLQAQRDLVQATQDYYDMAQHRYRSGVDSSLTFLDAQRS 432

Query: 421 TAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
               +  L   +     + V+LY A+G G++P
Sbjct: 433 LFSSQQGLITDRLAQLVAQVNLYTALGGGWSP 464


>gi|254495971|ref|ZP_05108879.1| putative outer membrane transport protein involved in copper
           (silver) tolerance (cusC) [Legionella drancourtii
           LLAP12]
 gi|254354849|gb|EET13476.1| putative outer membrane transport protein involved in copper
           (silver) tolerance (cusC) [Legionella drancourtii
           LLAP12]
          Length = 479

 Score =  203 bits (515), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 113/459 (24%), Positives = 213/459 (46%), Gaps = 20/459 (4%)

Query: 7   IFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVK 66
           +F    V+L GC+  P+Y +P +P+          +   NI    W   F D +L +L+ 
Sbjct: 22  LFYCLSVILFGCSFAPKYIRPPIPVAEEYPRGTGPQKYTNIRQFGWNVFFTDPALKQLIA 81

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFPSSYASI------------SHRFIPNLKT 114
           ++L  N  +  A ER+  A+      +ADLFPS  A+              +        
Sbjct: 82  LSLNNNRDLRTAIERMGEARAMYGLQKADLFPSLNANALGLKAGVPGNLLPNMNPFVFSA 141

Query: 115 NSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
                  S W+ID +G+ R++ +++L +  +         +++I ++  +Y+      E 
Sbjct: 142 YLGALSVSSWEIDFWGRLRNLKDAALEHYLATEDAEHATFISLIEQVANTYLTEHELNEL 201

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
           I I  + +   K +  L   +F +G++SK  +V+ E  ++   S++  LE+   +N + +
Sbjct: 202 IHITLKTIKSRKHSYHLMKRRFEEGSSSKFEVVQAETLLQQANSELTVLERKRELNWNAM 261

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
           + L+G      +   Q +     P+    I+ G+P++L+ NRPD+   E +L  + A IG
Sbjct: 262 TLLVG----TQIPINQSRLARVAPSYIKEISPGLPSELLYNRPDVIAAEHRLKAANANIG 317

Query: 294 IAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESS 350
            A++  +P ++L G+   T    +N F      W++ P + LPIFD G+  S++  A++ 
Sbjct: 318 AARAAFFPRITLTGAYGTTSSELNNLFSPGTKIWTYFPNITLPIFDWGRNMSDLGLAKAR 377

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
                  ++ T+  A +EV +AL +     K +     A+   K+   L+   Y+ G   
Sbjct: 378 QNLAITEYEHTIQVAFREVADALANRTWLAKQIIVQNKALASQKERTHLAWARYKVGSSP 437

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
            L++LD ER     E  L   + +L  S ++LY+A+G G
Sbjct: 438 YLEVLDAERDKFVAEQSLVQTRYELLASQINLYVALGGG 476


>gi|301058705|ref|ZP_07199705.1| putative outer membrane efflux protein OprM [delta proteobacterium
           NaphS2]
 gi|300447190|gb|EFK10955.1| putative outer membrane efflux protein OprM [delta proteobacterium
           NaphS2]
          Length = 488

 Score =  203 bits (515), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 120/468 (25%), Positives = 217/468 (46%), Gaps = 21/468 (4%)

Query: 1   MNILRAIFSLFIVLLAGCT-VGPEYTKPH-MPLLPTQFSIGNSKNLINIDTLKWWESFND 58
           M     I +   +L+ GC  +GP++ KP  +   P +F     K +  +   +WWE FND
Sbjct: 4   MKAFWWILAASCLLMGGCVKMGPDFKKPDSVVAAPERFQYAPRKPMATLPEDRWWEVFND 63

Query: 59  TSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKT---- 114
             +N+LV+  L+ N  + QA  RI   +  ++  RAD FPS       +     K+    
Sbjct: 64  PEINRLVEKVLKNNPDLEQAAARILELEYQVVQTRADRFPSLGFKAGAQRQHEPKSIVGP 123

Query: 115 ---------NSTGQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSY 164
                      +  L + +++DL+G+    E +S A L  A         +++S+ I  Y
Sbjct: 124 GISVGGTVDQYSFSLPASYEMDLWGKYARAEEASRAQLLQAEENRLTLSQSLVSEAISLY 183

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           +  +  + RI I  Q L  Y+ ++     ++ +G TS L L +    +   + ++P L +
Sbjct: 184 LQIQSLERRIQITVQSLKNYEDSVTFVEQRYKRGLTSILDLRQARRTLNQAKGNLPQLRQ 243

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
                   ++ LLG        Y Q +           I  G+P++L+  RPD+R  E +
Sbjct: 244 ELGTAQQALAVLLGEYPKTRKPYPQPED---YYRKLRAIPPGLPSELLLRRPDVRAAEAQ 300

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTH--WSFGPKLYLPIFDKGKIKS 342
           L    A+IG+AK+  +PS+SL GS     +     ++    WS    L  P+FD G++K+
Sbjct: 301 LKTLNAQIGVAKASRFPSISLTGSYGYASEELSNLFDPGGIWSLAAGLVQPLFDAGRLKA 360

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
           N R AE+  ++ +  +++TVL A +EVENAL +  +  +    +Q  V   + +  ++  
Sbjct: 361 NQRAAEARYEQGFAAYRKTVLGAFREVENALLTRRKQLERRGDVQSFVVEARATQRVAET 420

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            Y +G    L +L+ ++   + E  L   +  +  + V L+ A+G G+
Sbjct: 421 RYMRGLVDYLTVLNAQQTRFQAEDQLLRVELTILANRVTLHRALGGGW 468


>gi|116254733|ref|YP_770569.1| nodulation protein NodT [Rhizobium leguminosarum bv. viciae 3841]
 gi|115259381|emb|CAK10516.1| putative outer membrane protein, similar to nodulation protein NodT
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 484

 Score =  203 bits (515), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 184/460 (40%), Positives = 278/460 (60%), Gaps = 16/460 (3%)

Query: 4   LRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNK 63
           LR   S   +LLAGC  GP++  P MP LP +F  G SK+  ++   +WW ++ D  L+ 
Sbjct: 12  LRYAASAITLLLAGCVSGPDHAPPQMP-LPAKFQEGGSKSNGDVVAAQWWTAYRDKQLDG 70

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST------ 117
           LV   L +NL +LQA ERIN+A  N+    A   PS     SH       +  T      
Sbjct: 71  LVAHGLSENLDVLQALERINSASANVTVAGAGGLPSLDVGASHTVYGEKGSQRTTIGTKN 130

Query: 118 ---GQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
              G+    W +D FGQ R  + S  A+L +AYA  D AKL  +  L+ SY+DAR++++R
Sbjct: 131 TTGGEASLSWLLDFFGQYRRSKESAIASLGAAYATADDAKLTFLKDLVSSYVDARYYQQR 190

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
           I+++   L   ++  EL+ L+   GA S+L +V+ E  ++S ++DIP LE+SF ++ H+I
Sbjct: 191 IALSQANLKSRQETYELTQLQLKAGAASRLDVVQAEGLVQSTKADIPGLEQSFTVSAHHI 250

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
           + LLG PA   ++ +Q+ +   QP     I  GIPADLIRNRPDIR  E+ LA +VA IG
Sbjct: 251 ALLLGMPAASLMNELQRSTG--QPVFRGDIRAGIPADLIRNRPDIRKAERDLAAAVADIG 308

Query: 294 IAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESS 350
            A++ LYPS+SL+       +    +  G  T WSFGP L LPIFD GK+++N+   +S 
Sbjct: 309 AAEAQLYPSISLSGSISPSWVKSSGASGGTMTSWSFGPTLNLPIFDGGKLRANVDIEKSD 368

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
           A+ QY+ W+E VLN ++EVENAL+++  D + +  L+  V+  ++S++LS  +Y+ G  S
Sbjct: 369 AKAQYLAWKEAVLNGVEEVENALSAVRRDTQTLAPLRRQVQTAEESLALSTTSYKDGASS 428

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           LLD+LD +R+ +  +  L+   +++AK YVDLY+AIG+GY
Sbjct: 429 LLDVLDAQRSVSDAQASLAATVQEVAKDYVDLYVAIGAGY 468


>gi|209521511|ref|ZP_03270214.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. H160]
 gi|209498041|gb|EDZ98193.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. H160]
          Length = 503

 Score =  203 bits (515), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 114/464 (24%), Positives = 215/464 (46%), Gaps = 26/464 (5%)

Query: 8   FSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSI-----GNSKNLINIDTLKWWESFNDTSL 61
            ++ I LLAGC ++ P + +P MP+  T            +N      + W + F D +L
Sbjct: 20  LAVLIALLAGCVSLAPPFERPPMPVPATFPDAHGNPTTGGENAPGAAAVGWQDYFIDPTL 79

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL--------- 112
            +L+  AL+ N  +  A +R+  A+      RAD FP+                      
Sbjct: 80  QRLIGEALEYNRDLRLAIQRVEEARAMYGIRRADQFPTIGMEADLARARVPADLSGVGRA 139

Query: 113 ---KTNSTGQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
                   G   + W++D +G+  +++ ++L N  ++ A      L VI ++  +Y++ R
Sbjct: 140 VTANQFQVGVGLASWELDFWGRVANLKEAALQNYLASDAARQAVTLTVIEQVANNYLNLR 199

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
              ERI + ++ +   +K+  +   ++  G+TS+L L ++E   +   +    L++    
Sbjct: 200 ELDERIMLMNETIASREKSYRIFKHRYEVGSTSRLDLKQVETLWRQAVALGTQLQQERAT 259

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
            ++ +  L+G P       ++   N    +L      G+P+DL+ NRPDI   E +L  +
Sbjct: 260 RLNALQVLVGKPVDLPHEDIRLNDNAVMADLP----AGLPSDLLVNRPDIVSAEYQLRAA 315

Query: 289 VAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
            A IG A+++ +P ++L GS        DN F G +  WSFGP + LPIFD G+ ++N+ 
Sbjct: 316 NANIGAARAEFFPKITLTGSFGTASTQLDNLFTGPSRAWSFGPSVSLPIFDMGRREANLD 375

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
             ++   +   +++  V +A ++V +A+ +     + V  L+   E   +   L+ + Y 
Sbjct: 376 VTKAQRDQAVTSYELAVQSAFRDVADAIAARQWLAEQVDALRATEEAQAERARLAQMRYD 435

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
            G    L++LD +R     +  L   +R L  S V L+ A+G G
Sbjct: 436 HGASPFLEVLDAQRDLLAAQQQLVETRRALLSSRVSLFSALGGG 479


>gi|282890149|ref|ZP_06298680.1| hypothetical protein pah_c013o060 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281500000|gb|EFB42288.1| hypothetical protein pah_c013o060 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 475

 Score =  203 bits (515), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 139/473 (29%), Positives = 230/473 (48%), Gaps = 28/473 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK--NLINIDTLKWWESFND 58
           M +++A+F L +  L GCTVGP+Y  P M  +PTQ+     +  N   +D   WW+S ND
Sbjct: 1   MKMIKALFFLSV-FLGGCTVGPKYEPPGME-MPTQWHSTTEEGMNAEPLDCFLWWKSLND 58

Query: 59  TSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK----- 113
             LN L++ A  QNL +  A  RI  A+     + A L+P    +I++  +         
Sbjct: 59  PLLNSLIEQASLQNLDVQIAISRILEARAAKKGISAQLYPHIDGTINYGHVQYNNKILKD 118

Query: 114 ---------------TNSTGQLDSDWKIDLFGQR-RHIESSLANLDSAYAQVDIAKLNVI 157
                                 D++W+IDLFG+    + ++ A + S+   +    +++ 
Sbjct: 119 ILGASCIDHHRKRNVNFFEIGFDAEWEIDLFGKTTHELNAARAEIGSSIESLRDLMVSLT 178

Query: 158 SKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIES 217
           +++  +YI+ R  +  + IA   +   K+   L+   F  G TS +   + E ++  +ES
Sbjct: 179 AEIAKNYIEIRGSQHLLDIAKSHIQTQKETTLLTTGLFEAGFTSIIDQWQTEEQLMLLES 238

Query: 218 DIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPD 277
           +IP LE S    +H +S LLG P  E    +++  +   P L     +GIP+ L+RNRPD
Sbjct: 239 EIPMLELSIEKGIHRLSILLGRPPAELFCVLREHHDL--PELPHYKPLGIPSALLRNRPD 296

Query: 278 IRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDK 337
           IR  E+ LA S  K+G A +DL+P  SL G I           +  W  GP+L  PIF+ 
Sbjct: 297 IRRAERNLAASTEKVGSAMADLFPRFSLRGFIGDVAT-HLSRSSFVWFAGPQLLAPIFNS 355

Query: 338 GKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSM 397
             I+ +I   +   Q+    +Q+TVL A++E EN + S + + +   KL  A++   +S 
Sbjct: 356 KLIQQDIDLNKIKTQQALYQYQKTVLEALEETENTIASYHHELEHNRKLFSAMQFSGESY 415

Query: 398 SLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +     Y+ G    L++L  +R+    E     +K QL   Y+ LY A+G G+
Sbjct: 416 NQLFHLYQTGFKGYLEVLVSQRSLLSTENAFLKSKIQLLMHYISLYKALGGGW 468


>gi|160882472|ref|ZP_02063475.1| hypothetical protein BACOVA_00423 [Bacteroides ovatus ATCC 8483]
 gi|260170919|ref|ZP_05757331.1| outer membrane protein oprM precursor [Bacteroides sp. D2]
 gi|293373512|ref|ZP_06619864.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [Bacteroides ovatus SD CMC 3f]
 gi|315919249|ref|ZP_07915489.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|156112184|gb|EDO13929.1| hypothetical protein BACOVA_00423 [Bacteroides ovatus ATCC 8483]
 gi|292631476|gb|EFF50102.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [Bacteroides ovatus SD CMC 3f]
 gi|313693124|gb|EFS29959.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 459

 Score =  203 bits (515), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 106/459 (23%), Positives = 204/459 (44%), Gaps = 17/459 (3%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
             L     L   +L  C VG  Y +P + L     S+  S++ ++     W + + D +L
Sbjct: 4   KKLYIAILLLAGVLTSCKVGKSYVRPDLHLPD---SLERSQDSVSFGDQDWRDIYTDATL 60

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF--------IPNLK 113
             L++ AL  N  +L A  R+           A L P     ++                
Sbjct: 61  RSLIERALDHNKDMLIAAARVKEMAAQKRISTAALLPDIKGKVTGERELENHGGDAFKRS 120

Query: 114 TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                Q    W++DL+G  R    +S+A    +       ++ +++++  +Y +      
Sbjct: 121 DTFEAQFLVSWEVDLWGNLRWARSASIAEYLQSIEAQRALQMTIVAEVAQAYYELVALDT 180

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + I  Q L   ++ + L+ ++F  G TS+ S  + + E+    + +P LE+   +  ++
Sbjct: 181 ELDIVKQTLKAREEGVRLARIRFAGGLTSETSYRQAQVELARTATLVPDLERKISLKEND 240

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           I+ L G    +       Q  N    L     +G+P+ L+  RPDIR  E+KL  + AK+
Sbjct: 241 IAYLAGEYPNKIARSRLLQEFNSPETLP----VGLPSTLLERRPDIRQAEQKLIAANAKV 296

Query: 293 GIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYL-PIFDKGKIKSNIRRAESSA 351
           G+A ++++P L+L G       +      + ++      L PIF  GK ++ ++  +++ 
Sbjct: 297 GVAYTNMFPRLALTGGFGSESTSLSELLKSPYAVMEGALLTPIFGWGKNRAALKAKKAAY 356

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           + +  +++++VL A KE  NA+ + N+ K++     +     K  M L+ + Y  G  + 
Sbjct: 357 EAEVHSYEKSVLEAFKETRNAIVNFNKIKEVYELRANLERSAKSYMDLAQLQYINGVINY 416

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           LD+LD +R     ++ LS A R    + V LY A+G G+
Sbjct: 417 LDVLDAQRGYFDAQIGLSNAIRDELIAVVQLYKALGGGW 455


>gi|256829950|ref|YP_003158678.1| NodT family RND efflux system outer membrane lipoprotein
           [Desulfomicrobium baculatum DSM 4028]
 gi|256579126|gb|ACU90262.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfomicrobium baculatum DSM 4028]
          Length = 479

 Score =  203 bits (514), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 118/466 (25%), Positives = 217/466 (46%), Gaps = 22/466 (4%)

Query: 1   MNILRAIFSLFIVLLAGCT-VGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDT 59
           M     +    ++LL+GC  + P Y  P +P+ P  ++  N+++  +   + W + F D 
Sbjct: 7   MRRGALLCIAAMILLSGCASMAPRYEAPALPVAPI-YAPDNAQDGASASAIGWRDYFIDP 65

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL------- 112
           SL  L++ AL  N  +  A  R+  A+      R++LFP+                    
Sbjct: 66  SLQNLIQRALDNNRDLRTAVLRVEEARAVHGIQRSELFPTVGIQAGEDRSRTPADLNMTG 125

Query: 113 -----KTNSTGQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYID 166
                     G   + W++D +G+ R ++ ++L N  +  A    A L +++++  SY  
Sbjct: 126 KTLFASQFQAGLGMASWELDFWGRVRSLQDAALENFLATDAARRAAALGLVAQVADSYFR 185

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
              F ERI++AHQ +    ++  +   +   G+TS+ SL +++  +   ++    LE+  
Sbjct: 186 LLEFDERIALAHQTIASRTESFRIFTRRVEVGSTSRFSLTQVQTLLTQAQALGAQLEQER 245

Query: 227 RMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLA 286
               H ++ L+G      +    +Q    + N  + +  G+P+DL+  RPDI   E +L 
Sbjct: 246 EAQFHALTLLVG----ATIDPPPEQDQPGERNTLVRVRPGLPSDLLFQRPDIVAAEHRLK 301

Query: 287 DSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSN 343
            + A IG A++  +P ++L GS+        + F   +  W F P + LPIFD G   +N
Sbjct: 302 AANANIGAARAAFFPRIALTGSLGTASAELGDLFAAGSLAWIFSPSISLPIFDGGLRSAN 361

Query: 344 IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
           +  AE         +++TV  A ++V +AL++ +   + V+  Q A+E   +   LS + 
Sbjct: 362 LSLAEIRLDMNVANYEKTVQAAFRDVADALSARHWLARQVSIAQAALETQTERARLSQLR 421

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           Y  G  + L++LD +R     E  L   +R L  S+V LY A+G G
Sbjct: 422 YDNGASAYLEVLDAQRDLLDTEQRLVQMRRALLTSHVSLYAALGGG 467


>gi|134293444|ref|YP_001117180.1| RND efflux system outer membrane lipoprotein [Burkholderia
           vietnamiensis G4]
 gi|134136601|gb|ABO57715.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia vietnamiensis G4]
          Length = 475

 Score =  203 bits (514), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 102/469 (21%), Positives = 189/469 (40%), Gaps = 22/469 (4%)

Query: 3   ILRAIFSLFIV-LLAGCTVGPEYTKPHMPLLPTQ---------FSIGNSKNLINIDTLKW 52
           + R + +L     L  C++ P Y +P  P+  T           +  ++        L W
Sbjct: 1   MKRTLIALLCAGALGACSLDPTYQRPAAPIDDTWSTAAAPAQPQTAQSTAAAPLGADLGW 60

Query: 53  WESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL 112
            + F D  L KL+++AL  N  +  A   +   +      RA+L P+  AS S       
Sbjct: 61  RDFFKDPRLQKLIELALANNRDMRVAALNVAQYEAQYRIARANLGPAIDASGSVTREHMA 120

Query: 113 KTNSTGQLD------SDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYI 165
            + S           + W+ID FG+ R ++        +  A     ++++I+ +   Y+
Sbjct: 121 GSTSAYSSSSASVGLTSWEIDFFGRLRSLKRQALEQYLATDAARTSTQISLIATVATDYL 180

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
                +  + IA   +   +   +L+      G+ S   + + E  + S  S + +  ++
Sbjct: 181 QLLSDEASLQIAQNTVAADQHTYDLTVNMMKLGSASLQDVRQAENSLASARSSLASYTRA 240

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
              + +++   +G P  +     Q  S     +    I  G+P+DL+  RPDI   E  L
Sbjct: 241 VAQDRNDLVAEIGAPLPD--DLPQGPSLMESEHTLADIGAGVPSDLLARRPDIVEAEHTL 298

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG A++  +P + L  S   T     N F      W+F P + +PIFD G  ++
Sbjct: 299 KAANANIGAARAAFFPKIELTASAGTTSSGLSNLFKAGTGAWAFAPSISVPIFDFGYNRA 358

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
           ++  A+         +++ +  A KEV NAL         V   +  V   ++   L+  
Sbjct: 359 SLDVAKVEKDIDVANYEKAIQTAFKEVSNALAGRTTYVTQVAADRDYVSSAQQYYDLAQA 418

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +YR G  S L +LD +R     +  L         + + LY  +G G++
Sbjct: 419 HYRSGTDSFLTLLDAQRTLYTAQQQLVTDMLAKQSNLITLYKVLGGGWS 467


>gi|117920439|ref|YP_869631.1| outer membrane efflux protein [Shewanella sp. ANA-3]
 gi|117612771|gb|ABK48225.1| outer membrane efflux protein [Shewanella sp. ANA-3]
          Length = 495

 Score =  203 bits (514), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 106/462 (22%), Positives = 216/462 (46%), Gaps = 22/462 (4%)

Query: 7   IFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLIN------IDTLKWWESFNDTS 60
           +  +  + +AGC +GP+Y +P + L     +   S+          +  L W   + D  
Sbjct: 33  LGLVTALSVAGCAMGPDYQRPELVLPNQYQAQMLSQTTAEQGNVKEVSALSWRHFYQDPV 92

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI---------PN 111
           L  L++ AL  NL +  A  R+ AA+  +  V + L+P       +            P+
Sbjct: 93  LISLIEHALANNLDLQMAQSRLLAARSKMTVVDSALWPEVSVKAGYERSLDSGATSTNPS 152

Query: 112 LKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
             T         W++DL+G  R   E+++A+  S   ++ +  +++IS +   Y +    
Sbjct: 153 PSTTLDLGGAVSWELDLWGANRRASEAAMADYLSEVEKLRLTYVSLISDIASRYYEWLDI 212

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           ++R S++   + L +K ++++ L+   G  S L + + E E++S +  +PTL+   +  +
Sbjct: 213 EQRYSVSIDTVGLRQKELDIAKLRHANGVISGLDVRQAEVELQSTKVTLPTLDYERKYKI 272

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG            Q       L   +N G+P++L+  RPD++  E+++  + A
Sbjct: 273 NQLHILLGEY---DYALPSPQGLPENMGLPYELNTGVPSELLTLRPDVKIAEQQMIAANA 329

Query: 291 KIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
           ++GIAK+  +P  +++G     +D   + F      WS    +  PIF++GKI +    A
Sbjct: 330 EVGIAKAAFFPKFTISGVYGRENDHLKDIFDSNGVTWSLLGGISAPIFNRGKIAAEYDIA 389

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
             +A++  ++++  VL A  +V +AL ++   ++ +   +  VE       L+ + Y+ G
Sbjct: 390 TEAAKQSMLSYRNVVLTAYFDVNDALNNLKRAQEAIKAQKELVESSSAYARLARLRYQNG 449

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
             + LD++D +R     ++  S   R    + + LY A+G G
Sbjct: 450 VATSLDLMDAQRQLFSAQLAYSEILRDKQLAKIALYRALGGG 491


>gi|237730524|ref|ZP_04561005.1| copper/silver efflux system outer membrane protein CusC
           [Citrobacter sp. 30_2]
 gi|226906063|gb|EEH91981.1| copper/silver efflux system outer membrane protein CusC
           [Citrobacter sp. 30_2]
          Length = 460

 Score =  203 bits (514), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 107/463 (23%), Positives = 210/463 (45%), Gaps = 18/463 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINI---DTLKWWESFN 57
           M+  + +    I +LAGC++ P+Y +P +P +P QFS+  +  +          W   F 
Sbjct: 1   MSKFKLLTLSAIFVLAGCSLAPDYQRPALP-VPQQFSLSQNSLVSAPGEYQDTGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST 117
           D  +  L+  AL  N  +  AT ++  A+       AD +P   A  S  +   LK +S+
Sbjct: 60  DDQVKALIGEALINNRDLRMATLKVQEARAQYGVTDADRYPQITAGSSGTYSGKLKGDSS 119

Query: 118 ------GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                   L+  + +D FG+ +   E+   N  ++        + +IS +  SY + R  
Sbjct: 120 TDREFEAGLNLSFDLDFFGRLKNMSEAERQNFFASEEARRAVHILLISNVSQSYFNQRLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ +A + L  Y+++      +   G+T+ L+L +    I+S  S+I   +       
Sbjct: 180 YAQLQVAEETLQNYQRSYAFVEKQLITGSTNVLALEQARGVIESTRSEIAKRKGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +      Q+ +      + +   + + ++  RPDI   E  L  + A
Sbjct: 240 NALQLLLG----TYGKLPDDQARSRGDIKPVTLPPSLSSQILLQRPDIMEAEHGLLAANA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS++L  S++ +     N F   +  W+F PK+ +PIF+ G+ +SN+  A
Sbjct: 296 NIGAARAAFFPSITLTSSVSSSSSDLSNLFNASSGMWNFVPKIDIPIFNAGRNQSNLDLA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + NA KEV +AL         ++  Q  ++  + ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKIQNAFKEVADALVLRQSIADQISGQQRYLDSLQITLQRARALYQNG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             S +++LD ER+       L         + + L+ A+G G+
Sbjct: 416 AVSYIEVLDAERSLFATRQSLLDLNYAQQVNEIKLFAALGGGW 458


>gi|224824201|ref|ZP_03697309.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Lutiella nitroferrum 2002]
 gi|224603620|gb|EEG09795.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Lutiella nitroferrum 2002]
          Length = 488

 Score =  203 bits (514), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 110/457 (24%), Positives = 205/457 (44%), Gaps = 26/457 (5%)

Query: 17  GCTVGPEYTKPHMPLLPTQFS-------IGNSKNLINIDTLKWWESFNDTSLNKLVKIAL 69
           GC++ P Y +P  P+     S               N   + W E F D  L KL+++AL
Sbjct: 17  GCSLAPTYQRPAAPVAGQWPSGPAYGGDTATQATKGNAADIGWREFFADARLQKLIELAL 76

Query: 70  QQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL--------- 120
             N  +  A   +   +      RADLFP+  A+ S          S+            
Sbjct: 77  ANNRDLRVAMLNVEKTRAQYQIQRADLFPAIDATGSGTRQRLPADLSSSGRAGVSGKYSA 136

Query: 121 ---DSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISI 176
               + +++DLFG+ + +   +L    ++      A+++++S++   Y+  R   E+  +
Sbjct: 137 SVGFTAYELDLFGRVQSLKNEALEQYFASGEAQKSAQISLVSEVASQYLTLRALDEQQKV 196

Query: 177 AHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL 236
               L   + + +L+  +F  G  + L L   ++++++ +S++ +L +      + +  L
Sbjct: 197 VTDTLTAQQSSYDLTKKRFDVGTVTALDLSTADSQVQTAKSNLASLMQQRAQAENALVLL 256

Query: 237 LGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
           +G P    L             L   +  G+P+DL+  RPDI   E +L  + A IG A+
Sbjct: 257 VGQPLPADLPQGNAFDA---QGLLADLPAGLPSDLLERRPDIAQAEHQLKAANADIGAAR 313

Query: 297 SDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQE 353
           +  +PS+SL GS         N F G    WSF P++ LPIFD GK  + +  + +  + 
Sbjct: 314 AAFFPSISLTGSYGTASSELSNLFKGGQLAWSFIPQINLPIFDWGKNAAGLDVSTTGKKI 373

Query: 354 QYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLD 413
               ++++V +A +EV +ALT+    ++ +   +  V+   +   L+ + YR G  S L 
Sbjct: 374 AVAQYEKSVQSAFREVSDALTARAMLEQQIAAQEALVKSETQRYQLAELRYRNGVDSALT 433

Query: 414 ILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +LD +R+    +  L  A+     + V LY A+G G+
Sbjct: 434 LLDAQRSLYSAQQGLIQARLARLTNQVTLYKALGGGW 470


>gi|163857338|ref|YP_001631636.1| outer membrane efflux protein [Bordetella petrii DSM 12804]
 gi|163261066|emb|CAP43368.1| probable outer membrane efflux protein [Bordetella petrii]
          Length = 485

 Score =  203 bits (514), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 98/458 (21%), Positives = 198/458 (43%), Gaps = 24/458 (5%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGN-------SKNLINIDTLKWWESFNDTSLNKLVKIAL 69
           GCT+ P Y +P  P+     S              +    + W + F D  L +L+ +AL
Sbjct: 20  GCTLAPTYERPAAPVSGAYPSGPAYGQQGQDGSPDVVAADIGWRDFFADPLLQRLISMAL 79

Query: 70  QQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL------------KTNST 117
           + N  +  A   +  A+      RADL P    +                     ++   
Sbjct: 80  EANRDLRVAALNVEEARAQYRIQRADLLPGVGVAGQGSVQRLPGDLTQSGEPGISRSYQV 139

Query: 118 GQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISI 176
           G   S W++DLFG+ R + E +L    +        +L +I++   +Y+  R  +E +S+
Sbjct: 140 GGAISSWELDLFGRIRSLSEQALETYLAQDETRTATQLALIAETAGAYLALRADQELLSL 199

Query: 177 AHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL 236
               L   + +  L+   +  G  ++L L + E  +++ + ++    +    + + +  L
Sbjct: 200 TQSTLAAQQDSYRLTKQSYDLGVATELDLSQAEIALRTAQRNLSQYTRLAARDRNALVLL 259

Query: 237 LGYP-ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIA 295
           +G P   +    + + ++     +   +  G+P+DL+  RPDIR  E +L  + A IG A
Sbjct: 260 VGQPLPADVAAQLDQATSLPDGIMPRMLPAGLPSDLLARRPDIRAAEHQLKAANANIGAA 319

Query: 296 KSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQ 352
           ++  +P++SL GS      +    F   +  WSF P + +PIF  G +++++  ++    
Sbjct: 320 RAAFFPTISLTGSAGTASASLGGLFDAGSGAWSFAPSITVPIFAGGALRASLDASKVRKN 379

Query: 353 EQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLL 412
            Q   +++++  A +EV +AL      +  +   +  V   +++  LS   + QG  + L
Sbjct: 380 IQVAQYEKSIQTAFREVSDALAGRATLETQIEAQRLLVNASQRAYDLSQQRFEQGIDNYL 439

Query: 413 DILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            +LD +R+    +  L   +     + V LY  +G G+
Sbjct: 440 SVLDAQRSLYSSQQVLVETRLARLSNLVTLYRTLGGGW 477


>gi|53804520|ref|YP_113823.1| outer membrane efflux family protein [Methylococcus capsulatus str.
           Bath]
 gi|53758281|gb|AAU92572.1| outer membrane efflux family protein [Methylococcus capsulatus str.
           Bath]
          Length = 558

 Score =  203 bits (514), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 118/470 (25%), Positives = 226/470 (48%), Gaps = 24/470 (5%)

Query: 6   AIFSLFIVLLAGCT--VGPEYTKPHMPLLPTQFSIGNSK-NLINIDTLKWWESFNDTSLN 62
            +  +  VL  GC+  +GP+Y  P   + P      + + +    D  +WW  F D  LN
Sbjct: 44  LLLIIPAVLAGGCSTKIGPDYQTPETRVSPDWLESEDRRVSRKEGDFREWWRVFKDPVLN 103

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHR-----------FIPN 111
           KLV+ A  QNL +  A  RI  ++  +     +LFP S A                 + +
Sbjct: 104 KLVETAYSQNLPLQIAAVRILGSRAELGIATGNLFPQSQAFQGQTEDFGMPLLRNLGLGD 163

Query: 112 LKTNSTGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
               +   + S+W+ID++G+ R  IES+ A L ++ A+ D   + + + +  +Y+  R  
Sbjct: 164 SLWYTRIGVMSNWEIDIWGKYRRAIESADAQLMASVAEYDDILVTLTADVANTYVQIRTL 223

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           ++R+ IA   ++   +++ ++  KF  G +++  + +    + S ++ IP LE   R   
Sbjct: 224 EKRLDIARHNVETQSESLRIADAKFHGGTSTQRDVEQARTVLASTQATIPVLEGQLRQAK 283

Query: 231 HNISTLLGYPATEFLHYMQKQSNN-FQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
           + +  LLG    +    +  ++     P   + + +GIPADL+R RPD+R  E+  A   
Sbjct: 284 NTLCYLLGMTPEKLDEPLGGEAQFGQIPAPPVQVAVGIPADLLRRRPDVRRAERSAAAQS 343

Query: 290 AKIGIAKSDLYPSLSLN--------GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIK 341
           A+IGIAK+ LYP+ S++         S   +  + F     +++FGP +   +F+ G++ 
Sbjct: 344 ARIGIAKASLYPAFSISGSFGFIATNSQGHSLSDIFNWGQHYYAFGPSVQWNLFNYGQLT 403

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           + +R  ++  QE  +++Q TVL A +E E+AL    + +     L  +    ++S+ L+ 
Sbjct: 404 NQVRAQDARFQELALSYQNTVLKAQQEAESALIGFLKAQNSAQFLAESTAAAQRSLDLAT 463

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           + YR+G      +L  E+   K + + +     +A + V +Y  +G G+ 
Sbjct: 464 LQYREGITDFTTVLTAEQDLLKQQDNFAQTLGNIATNLVGVYRTLGGGWQ 513


>gi|119713716|gb|ABL97766.1| outer membrane RND efflux family transporter [uncultured marine
           bacterium EB0_41B09]
          Length = 489

 Score =  203 bits (514), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 115/462 (24%), Positives = 213/462 (46%), Gaps = 18/462 (3%)

Query: 6   AIFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK--WWESFNDTSLN 62
            ++ L    + GC  VGP+Y       +P  ++   S   +     +  WW   +D  LN
Sbjct: 16  LLYLLVFSAITGCKAVGPDYEGSPEMDVPENWNNDLSNEFVEQSDTQKQWWTLLDDPILN 75

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN---------LK 113
            L+  A   NL    A  R+  A+ N   V A  FP   A        N           
Sbjct: 76  DLIDRAAIDNLDAKIALSRVEEARANYGVVEAAKFPQIDAVGDVSRKSNSKSATGEKNTD 135

Query: 114 TNSTGQLDSDWKID-LFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
             ++  LD  W+ID     RR IE++ A LD+         + + +++  +YI  R  + 
Sbjct: 136 NYTSIGLDLSWEIDIFGYVRRSIEAADAQLDATIENYRDVMVILYAEIARNYIALRTSQL 195

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
           R+  A + +   ++ + + + +++    S++ +++ E  + + ES +P          ++
Sbjct: 196 RLQFALENVKSQRETLNIVNARYSAELVSEVDVLQSEQNLAAAESYVPLFYADIDELFNS 255

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           ++ LLG         ++   N   P++     + +P +++R RPDIR  E +L    A++
Sbjct: 256 LAVLLGKNPGSLNQELK--GNKGIPHIPEKTIVMLPREILRQRPDIRKAESRLVQETAEV 313

Query: 293 GIAKSDLYPSLSLNGSIALT---HDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           GIA ++ YP  +LNG+        D+ F   + +WSFGP     +FD G  +S I+  ++
Sbjct: 314 GIATAEQYPRFNLNGTFGYDARGSDSQFSSNSRYWSFGPNFRWDLFDAGAEESAIKVQDA 373

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             ++  + +++TVL A +EVENAL S  E+K+    L+ +V+  KK   +++  Y  G  
Sbjct: 374 QLEQARVNYEKTVLTAFEEVENALKSYKEEKQRNASLRASVKAAKKVNKITVARYTSGLI 433

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
              ++ D ER     E +L+ +   L +  + LY A+G G++
Sbjct: 434 DFQEVQDAERVIFFQEDELAKSDGSLVQFIIQLYKAMGGGWD 475


>gi|116253616|ref|YP_769454.1| nodulation protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115258264|emb|CAK09366.1| putative exported nodulation like protein [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 477

 Score =  203 bits (514), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 184/464 (39%), Positives = 280/464 (60%), Gaps = 15/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M  LR      ++LL+GC VGP++  P MP LP +F  G +K+  ++ T+ WW +F D  
Sbjct: 1   MVSLRFATPALLLLLSGCVVGPDHVPPEMP-LPAKFGEGGTKSDGDVTTVAWWSAFKDRK 59

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN--------- 111
           L+ LV+  L QNL++ QA ERIN+A  N+    A   P+     SH              
Sbjct: 60  LDGLVQSGLDQNLSVQQAIERINSASANVTVAGAGALPNLTVGASHTVSGQKGELRTQFD 119

Query: 112 LKTNSTGQLDSDWKID-LFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
            +  S G+    W +D     +R+ ES+LA+LDSAYA  D+AKL ++  L+ SYID R++
Sbjct: 120 TRNTSGGEAQLTWLLDIFGLYKRNTESALASLDSAYASADVAKLTLVQDLVSSYIDVRYY 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           ++R++++   L   ++  EL+  +   GA S+L +V+ E  ++S  ++IP LE + R++ 
Sbjct: 180 QQRLALSKANLKSRQETYELTKFQLEAGAASRLDVVQAEGLVQSTLAEIPGLETNIRISA 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           H+I+TLLG PA   +          QP     I  GIPADLIRNRPDIR  E+ LA + A
Sbjct: 240 HHIATLLGLPAATLVD--DLLKGYGQPVFRGGITSGIPADLIRNRPDIRVAERDLAAATA 297

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS--FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
           +IG+A++ LYPS+SL+GSI+  + N     G  T WSFGP L LPIFD G +++ ++ A+
Sbjct: 298 QIGVAQAQLYPSISLSGSISPAYINQRGIHGGLTPWSFGPTLNLPIFDGGTLRAGVKTAQ 357

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           S+A   Y+ W+ TVL AI++VENAL+++  D + V+ LQ  V+  ++++ LS  +Y+ G 
Sbjct: 358 SNAAAAYLNWKSTVLTAIEQVENALSAVRRDARTVSALQAQVKTTQETLELSTASYKDGA 417

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            SLLD+LD +R  +  +  L+ A +Q+AK YV L IAIG G+ P
Sbjct: 418 SSLLDVLDAQRQVSLAQASLAAAVQQMAKDYVSLNIAIGGGFAP 461


>gi|325917711|ref|ZP_08179901.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [Xanthomonas vesicatoria ATCC 35937]
 gi|325536073|gb|EGD07879.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [Xanthomonas vesicatoria ATCC 35937]
          Length = 491

 Score =  203 bits (514), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 103/475 (21%), Positives = 198/475 (41%), Gaps = 27/475 (5%)

Query: 4   LRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINID---------TLKWWE 54
           +         +L+GCT+ P YT+P  P +P  F+   S    +            + W E
Sbjct: 1   MTLAAIAVASVLSGCTMMPRYTRPDAP-VPDHFAGAGSAPTPDAAETEQARSVADIGWRE 59

Query: 55  SFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL-- 112
            F D +L +++ +ALQ N  +  A   I  A+      RA L P+   + +         
Sbjct: 60  VFTDPALQQVIALALQNNRDLRVAALNIEVARAQYRVERAALVPAIDGTGTANNSRTPTE 119

Query: 113 ----------KTNSTGQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLI 161
                     +T S     S +++DLFG+ R ++        S         +++++++ 
Sbjct: 120 LAIPGQPAVFRTYSANIGISAYELDLFGRVRSLKEQALQQFLSTAEARRSTHISLVAEVA 179

Query: 162 PSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPT 221
            +Y+     +  + +A   L     +  L    F  G  S+L+L + +  +++   D+  
Sbjct: 180 TAYLTLAADQASLQLAQSTLSSQSDSYRLQQRSFELGVASQLTLRQAQTTVETARVDVER 239

Query: 222 LEKSFRMNVHNISTLLGYP-ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRY 280
                  + + +  L+G       L        +   N+   +  G+P+ L++ RPDI  
Sbjct: 240 YTAQVAQDRNALVLLVGTAVPESLLPRALPDGASVDGNVLASVPAGLPSQLLQRRPDILE 299

Query: 281 QEKKLADSVAKIGIAKSDLYP---SLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDK 337
            E+ L  +   IG A++  +P        GS + +  N F      WSF P L LPIF+ 
Sbjct: 300 AERNLRAANGNIGAARAAFFPSISLTGSVGSSSSSLSNLFDSGTRAWSFVPTLTLPIFNA 359

Query: 338 GKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSM 397
           G+ ++N+  A+++   +   +++++ +A +EV +AL   +   + +   Q  V+    S 
Sbjct: 360 GRNRANLDMAKANRDIEVARYEKSIQSAFREVSDALAQRDTLGRQLQAQQALVDATADSY 419

Query: 398 SLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            LS   + +G  S L  LD +R+    +  L   +     + V  Y A+G G+ P
Sbjct: 420 RLSQARFERGIDSYLQALDAQRSLYSAQQTLISTQLSRFTNLVTFYKAMGGGWLP 474


>gi|51245973|ref|YP_065857.1| outer membrane lipoprotein [Desulfotalea psychrophila LSv54]
 gi|50877010|emb|CAG36850.1| related to outer membrane lipoprotein [Desulfotalea psychrophila
           LSv54]
          Length = 476

 Score =  203 bits (514), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 123/470 (26%), Positives = 224/470 (47%), Gaps = 27/470 (5%)

Query: 2   NILRAIFS--LFIVLLAGCTVGPEYTKPHMPLLPTQFSIGN----SKNLINIDTLKWWES 55
             +R +F   + ++ L+ CT+G +Y +P   L+P QF  G     ++    +    WWE 
Sbjct: 5   KKIRNLFFGGVLLLALSACTLGQDYQRPET-LVPIQFKNGAPWKEARPSDAVAKGNWWEL 63

Query: 56  FNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTN 115
           ++D  LN L + ALQ N  +  A  R++  + N+   R++  P    + +        + 
Sbjct: 64  YHDPVLNGLEENALQANQNLRAAYARLSQVQANLGISRSNQLPRLDLNANGGRQRTAASL 123

Query: 116 STGQLD-----------SDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPS 163
           ++   D             +++DL+G+ RR IE+S A+++SA A      L + ++L  +
Sbjct: 124 TSPGQDQLSTQLNLPLVLSYEVDLWGRVRRSIEASTADVESARADYQSLMLTLQAELARN 183

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y   R       +  Q ++L +  + L   KF  G  S+L L + E+E+ ++E++   L+
Sbjct: 184 YFTLRAVDNETRLLQQTIELRRSTLSLVKSKFENGRVSQLDLSQAESELATVEAEAIGLK 243

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           K      + I+ L+G PA+ F         +           G+P+DL+  RPD+   E+
Sbjct: 244 KRRGELENLIAVLMGLPASNFSLAQVSLRLSPPTIAP-----GLPSDLLERRPDVAAAER 298

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKI 340
           K+A + A+IG+AK+  +P++SL GS     +   + F   N  W  GP + LPIFD G+ 
Sbjct: 299 KMAAASARIGVAKTAFFPAISLTGSTGFASNETSSLFNWDNRTWGLGPAISLPIFDYGRN 358

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
            + + ++ +  +E    +++ VL A +EVEN L  +    +    LQ A      +  +S
Sbjct: 359 SAKLDKSRAVYEEAIANYRQQVLVAFQEVENGLNGLQVLHEQGKALQRATTTATLAWEIS 418

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              YR G  S L+++D +R+    E  L   + +   + V L  A+G  +
Sbjct: 419 EKRYRSGLVSYLEVVDTQRSALLRERALVQLRGEQMSTSVLLIKALGGSW 468


>gi|264676483|ref|YP_003276389.1| RND efflux system, outer membrane lipoprotein [Comamonas
           testosteroni CNB-2]
 gi|262206995|gb|ACY31093.1| RND efflux system, outer membrane lipoprotein [Comamonas
           testosteroni CNB-2]
          Length = 477

 Score =  203 bits (514), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 96/459 (20%), Positives = 204/459 (44%), Gaps = 10/459 (2%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
             L  +     +L +GC+  P   +P  P+     +            + W + + D  L
Sbjct: 3   KTLLPVALAGALLASGCSFIPTLERPAAPVAEHYSATDEQAGATAAADIPWQQFYTDPRL 62

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP------NLKTN 115
            +++++AL+ N  +  A   I  A+      RA  FP    + S    P         + 
Sbjct: 63  QQVIQLALENNRDLRVAVLNIEKAQAQYQIQRAGQFPEFGVAGSASRQPSATTGRYANSY 122

Query: 116 STGQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
             G     W+ID +G+   ++    A   +       A++++I+ +  ++++ +  +E +
Sbjct: 123 MVGLSMPSWEIDFWGRIGSLKQQALAQYLATEEGRKAAQISLIATVANTWLNLQADEELL 182

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
           +I+ + L   +++I+L+ L+   G  S+L   + ++  +S  + +         +V+ ++
Sbjct: 183 AISRRTLGTREQSIKLTKLRLDSGVASELDYRQAQSLTESARATLAQQAGQRERDVNALT 242

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
            L+G      L    +            +  G+P+DL+  RPDIR  E+ +  + A IG 
Sbjct: 243 LLVGQTLPADLLTSMQGKQLRDLPALADVPSGLPSDLLLRRPDIRQAEQSMIAANASIGA 302

Query: 295 AKSDLYPSLSLNGSIALTHDNSFP---GYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           A++  +P++SL  S      +        +  ++  P LYLPIF+ G+ ++N++ AE+S 
Sbjct: 303 ARALFFPNISLTASAGFASSDISDLLKSDSAAFTIAPSLYLPIFNAGRNRANLQVAEASQ 362

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           +     ++ ++ +A +EV + L +    K  +      +E  +    LS + Y  G  S 
Sbjct: 363 KIAVAQYEGSIQSAFREVSDTLVNRQALKDQLDAQSRQLEAEQVRYKLSDLRYTNGVASY 422

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           LD+LD +R+   +E  +   +    ++ V+LY  +G G+
Sbjct: 423 LDLLDAQRSLFALEQSVVQVRLAQLQNQVNLYKVLGGGW 461


>gi|313669429|ref|YP_004049856.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Sulfuricurvum kujiense DSM 16994]
 gi|313156626|gb|ADR35303.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Sulfuricurvum kujiense DSM 16994]
          Length = 463

 Score =  202 bits (513), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 111/465 (23%), Positives = 209/465 (44%), Gaps = 20/465 (4%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M    ++     + + GC++ P       P LP   + G++     I T +WW+ + D  
Sbjct: 1   MKRNISLLLAIALSIGGCSLAPNLQI-QTPELPA--AKGDTNATERIVTAEWWKRYQDPF 57

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI----------- 109
           L+ L+  AL+ +  +  +   +N AK  +    A  +P+  AS S               
Sbjct: 58  LDALIDEALRNSDDLKLSISNVNTAKALLGLSEAQRYPTLNASASATRQKTSEESLSPMG 117

Query: 110 PNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
             +           ++ID +G+ +    ++L+   +  A+ D  ++ ++S +  +Y +  
Sbjct: 118 GMIYNTYGLSATLGYEIDFWGKLKNQENAALSEFTATQAERDTVRITLVSSVAEAYFNLV 177

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
             K +I I  Q ++ +K+  E    +   G    ++  +      + +  +  L++S  +
Sbjct: 178 AIKRQIEITEQSVEAFKEGYEYRLRQHRFGEIDPMTAEQAHTLYANAKLSLEGLKESKSL 237

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
           N + ++ L+G    E               L   I  GIP+DL++ RPDIR  E+ L  +
Sbjct: 238 NENALALLVGRTPKEIGEMGFTTVTELPKPLS--IPAGIPSDLLQRRPDIRSAEEMLRAA 295

Query: 289 VAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
            A IG+AK+  +PS+SL+G+I L     +         W  GP L +P+ D G+IK+ + 
Sbjct: 296 NANIGVAKAAYFPSISLSGNIGLESSELNRLMQNSAGVWGIGPSLNVPLLDFGRIKNQVE 355

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
             ES  +   I + ++V NA KEV ++L  I      +T  +   + + K +SLS + Y 
Sbjct: 356 STESKKETAQIQYAKSVKNAFKEVYDSLKKIESSNAKITAQEEGKDAYVKLLSLSQMRYD 415

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            G    L++LD +R     +V+L   + Q   + + LY A+G G+
Sbjct: 416 AGYVDYLNVLDAKRGELDAQVNLVGLQVQQLANQITLYKALGGGW 460


>gi|186472343|ref|YP_001859685.1| RND efflux system outer membrane lipoprotein [Burkholderia phymatum
           STM815]
 gi|184194675|gb|ACC72639.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia phymatum STM815]
          Length = 503

 Score =  202 bits (513), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 107/462 (23%), Positives = 199/462 (43%), Gaps = 30/462 (6%)

Query: 16  AGCTVGPEYTKPHMPLL------------PTQFSIGNSKNLINIDTLKWWESFNDTSLNK 63
           +GCT+ P Y +P  P+             P + +   + N      + W E F D  L +
Sbjct: 16  SGCTLAPTYERPAAPVAATYPQGDVYDNQPAKGAATRTANDHAAIDIGWREFFIDPRLQR 75

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL----------- 112
           L+++ALQ N  +  +  ++  A+      RADL PS     +                  
Sbjct: 76  LIELALQNNRDLRVSALKVEEARAQYRIQRADLMPSVSVDGTGTRSRTPKDLSYVGRATV 135

Query: 113 KTNSTGQLDSDWKIDLFGQRRHIESSLANLDSAYAQVDIAK-LNVISKLIPSYIDARHFK 171
            ++      + W++D FG+ R +         + AQ   A+ + ++S++   Y+    + 
Sbjct: 136 GSDYQVAASASWELDFFGKVRSLTEQSMQTYFSTAQARKAEEILLVSQVADQYLTLVAYG 195

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
           E ++      D  +++ EL+ L++  G  S+L L +    ++  +++  + ++S     +
Sbjct: 196 EMLASTKNTYDTARRSYELTKLQYDMGTGSELDLREAAGTMQQAQANYESQQRSRAQAEN 255

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
            +  L+G P    L      ++     L   I  G+P+DL+  RPDI   E  L  + A 
Sbjct: 256 ALVLLVGAPLAADLPQGLPLAS---QQLLADIPAGLPSDLLTRRPDIMEAEATLIGANAN 312

Query: 292 IGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
           IG A++  +PS+SL G       +    F      WSFGP + +PIF  G+ ++N+  A+
Sbjct: 313 IGAARAAFFPSISLTGDFGTASASLGTLFKPGQLAWSFGPTISVPIFKGGENRANLDLAK 372

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
                    +++ +  A +EV + L +     + +  LQ  VE  ++   LS + YR G 
Sbjct: 373 LEKNVAVAQYEKAIQTAFREVSDGLAARGTYDRQIKALQENVESQQRRYDLSDVRYRNGA 432

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            S L++L  +      +  L  A      + VDLY  +G G+
Sbjct: 433 DSYLNVLTAQTDLYSAQQSLITASLNRLTNLVDLYQYLGGGW 474


>gi|265756231|ref|ZP_06090560.1| outer membrane protein oprM [Bacteroides sp. 3_1_33FAA]
 gi|263233822|gb|EEZ19431.1| outer membrane protein oprM [Bacteroides sp. 3_1_33FAA]
          Length = 457

 Score =  202 bits (513), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 115/461 (24%), Positives = 214/461 (46%), Gaps = 16/461 (3%)

Query: 1   MN-ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDT 59
           M   L  I    + LL  C +G  YT+P +  LP Q      ++ ++I  ++WWE + DT
Sbjct: 2   MKHTLLYIAVSGMTLLTSCQLGKHYTRPDL-HLPQQLDTLRQQDTLSIADMQWWEIYTDT 60

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST-- 117
           +L  L++  L  N  +  A  R+           A+LFP        +   +    +   
Sbjct: 61  TLQSLIEKTLDNNKDMKIAAARVKELAAMKRIDFANLFPQLNGGAYAQKEGSNYGGNNYK 120

Query: 118 ------GQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                 G+L   W++DL+G  R   + S+A    +       K++++S++  +Y +    
Sbjct: 121 NDPELGGKLTVTWELDLWGNLRWAKDKSIAQFLGSIEAQRALKMSIVSEVAQAYFELVAL 180

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
              ++I  Q L   K+ + L+ L+F  G TS+ S  + + E     + +P LE+   +  
Sbjct: 181 DNELNIVRQTLYARKEGVRLAKLRFEGGLTSETSYQQAQVEYARTATLVPELERKISLKE 240

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           ++I+ L G       H +Q+     +  L   + +G+P+ L+  RPD+R  E+KL  + A
Sbjct: 241 NDIAFLAGEYP----HRIQRSILPEEVKLPETLPVGLPSTLLERRPDVREAEQKLIAANA 296

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNSFPGYN-THWSFGPKLYLPIFDKGKIKSNIRRAES 349
            +GIA ++++P LSL     +  +     +          L  P+F  GK ++ ++  ++
Sbjct: 297 SVGIAYTNMFPRLSLTAQYGVESEEFSDFFKSPIHYISGNLLTPLFAMGKYRATLKAKKA 356

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
           + +++  +++++VL A KE  NA+   N+ K I           K +M L+ + Y  G  
Sbjct: 357 AYEQECYSYEKSVLTAFKEARNAIVDFNKIKDIYESRLQLERSSKATMELAQLQYINGVI 416

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             LD+LD +R+    ++ LS A R    + V LY A+G G+
Sbjct: 417 GYLDVLDAQRSYFDAQIGLSNAIRDKQITLVKLYKALGGGW 457


>gi|54298518|ref|YP_124887.1| hypothetical protein lpp2582 [Legionella pneumophila str. Paris]
 gi|53752303|emb|CAH13735.1| hypothetical protein lpp2582 [Legionella pneumophila str. Paris]
          Length = 520

 Score =  202 bits (513), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 107/470 (22%), Positives = 211/470 (44%), Gaps = 23/470 (4%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLN 62
           +L+ +  L  ++L+ C VGP + +P         +   +          WW+ F D +L 
Sbjct: 4   MLKILALLSCLILSSCLVGPNFKEPKKDAANYWLTSSPAIKQSAFQNANWWKVFKDPTLT 63

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI------------P 110
            L+      NL++  A  R+  A+  +     +L+P   A +                 P
Sbjct: 64  ALIDNGYHNNLSLQMAGVRVLQARAQLAQSVGELYPQQQAMVGDYNYNRVGGNQLQGLLP 123

Query: 111 NLKTNSTGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                ++    + W++D +G+ R  I+S+ A   ++ A  D A + + S +  ++I  R 
Sbjct: 124 PDFLTASLGFSASWELDFWGKYRRAIQSNDALFLASLAAYDSALVTLTSDIASTFIKIRT 183

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
            +E I +    + +   +++++  ++  G TS L + +   E+   +S +P      +  
Sbjct: 184 SEELIKVTKTNIQVQAMSLKIAKDRYYGGQTSLLDVEQAATELAETQSKLPQYVSDLQHQ 243

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
              ++ LLG    +    ++K      P     + +GIP ++I  RPD+     +     
Sbjct: 244 KDILAVLLGTTPDKVDDLLKKNKG--IPKASAVVEVGIPKEVIARRPDVYQARMEAIAQS 301

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHDNS--------FPGYNTHWSFGPKLYLPIFDKGKIK 341
           A IG  K++LYPSLSL G+     +N         F   N +   GP L  P+ + G+I 
Sbjct: 302 AAIGAVKANLYPSLSLVGTFVFASNNIGNSTISDIFNWSNRNIVAGPSLTWPLLNYGQIT 361

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           + +R  +++ Q+  + +   VL   +EV++ +T   E +K V+ L+ A     +S  L++
Sbjct: 362 NAVRAQDAAFQQALLNYLNLVLKVQQEVQDNITRYVEGQKTVSSLKKANASAIESTRLAL 421

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           + Y++G  +   +L+ E+   +V+  L  A  +LA S V LY ++G G+ 
Sbjct: 422 VRYKEGEANYTTVLNAEQQQLRVQTSLVNATGELALSLVGLYRSLGGGWQ 471


>gi|207366715|emb|CAR82064.1| putative RND-family outer membrane protein [Serratia sp. ATCC
           39006]
          Length = 491

 Score =  202 bits (513), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 100/460 (21%), Positives = 193/460 (41%), Gaps = 19/460 (4%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQF-SIGNSKNLINIDTLKWWESFNDTSLNKLVK 66
             +    L GCT+ PEY +P  P+            +  ++  + W   F D  L ++V+
Sbjct: 22  AVVLATFLTGCTLVPEYHRPVAPVASAWPIKAKTGVSDTSVAAITWQTLFVDPKLRQVVQ 81

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL------ 120
           +AL  N  +  A   I  A+      R+ L P    + + +      + S   +      
Sbjct: 82  LALDNNRDLKIAILNIEKAQAQYRIQRSALMPQIGIAGAEQAQRTPASVSYTGIGGVTRG 141

Query: 121 ------DSDWKIDLFGQRRHIESS-LANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
                  S +++DLFG+ R ++     +  S        ++++I+++  SY+     ++ 
Sbjct: 142 YSLDVGISAYELDLFGRIRSLKEEAQQDYLSTVWSRQATQISLIAEVAESYLSLAADQDL 201

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
             +A   L   +   +L       G +S+L L + E+E++S    +   +K    + + +
Sbjct: 202 QRLAQDTLRSRQAAYDLQQSLTNVGKSSQLPLHQAESELESARYQLLLADKLVMSDSNAL 261

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
           + L+G         +    +        P++ G+P+DL++ RPDI   E  L  + A IG
Sbjct: 262 TLLVGTSLPA--SLLPSTDSLANMVSNKPLSAGLPSDLLQQRPDIMSAEHNLLAANADIG 319

Query: 294 IAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESS 350
            A++  +PS+SL  S     +     F      WSF P++ LPIF  G++ + +  ++  
Sbjct: 320 AARAAFFPSISLTTSAGRASNALGELFDAGGRSWSFAPQVNLPIFSGGRLMAQLETSKVE 379

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
                  +++T+  A +EV +AL   +         Q  V+  K +     I Y  G   
Sbjct: 380 RNIAVAEYEKTIQTAFREVSDALAERSVVDDETQAQQKNVQAAKAAFDFVQIQYTNGATD 439

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            L++LD +R     +  L  ++     S + LY A+G G+
Sbjct: 440 YLNVLDAQRTLFAAQQSLIQSRLSQQNSLITLYKALGGGW 479


>gi|78059728|ref|YP_366303.1| RND efflux system outer membrane lipoprotein [Burkholderia sp. 383]
 gi|77964278|gb|ABB05659.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia sp. 383]
          Length = 510

 Score =  202 bits (513), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 104/460 (22%), Positives = 195/460 (42%), Gaps = 29/460 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIG-----------NSKNLINIDTLKWWESFNDTSLNKLV 65
           GCT+ P Y +P  P+  T  + G            S N      + W E F D  L +L+
Sbjct: 21  GCTMAPHYKRPDAPVAQTYPAGGVYATQPGATGARSANGQAATAIGWREFFVDPRLQRLI 80

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK-----------T 114
           +IAL+ N  +  +   I AA+      RA LFP+     +                   T
Sbjct: 81  EIALKNNRDLRVSVLNIEAARAQYQITRAGLFPTLDGIGTGSRQRLPNALTSVSGRNITT 140

Query: 115 NSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
                L + W++DLFG+ + + + +LA   S        +++++S++   Y+      + 
Sbjct: 141 TYNVGLSASWELDLFGRVQSLKDQALAQYLSTSYARQAQEISLVSQVADQYLTLLSSDDL 200

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
           + +    L   + +  L+ LKF  G  S+L L + +  +++  +   +  +     ++ +
Sbjct: 201 LKVTEDTLKSAQASYNLTKLKFDNGTGSELDLRQAQTVVETALASQQSQARDRAQALNYL 260

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
             L+G P  + L            NL   +  G+P+DL+  RPD+   E+ L  + A IG
Sbjct: 261 VLLIGEPLPDDLPAGMPLDA---QNLLTDVPAGLPSDLLTRRPDVMQAEQTLLAANANIG 317

Query: 294 IAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESS 350
            A++  +P +SL  +           F      WSF P + LPIF+ G   +N+  A   
Sbjct: 318 AARAAFFPKISLTAAFGTASPTLGGLFKAGTAAWSFAPNIALPIFEGGSNLANLDLAHVQ 377

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
            + +  ++++ + +A +EV + L +     + +  L+      ++   LS + Y+ G  S
Sbjct: 378 KRIEIASYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRFDLSDLRYKNGVDS 437

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            L +L  +      +  L  A+     + V LY A+G G+
Sbjct: 438 YLSVLTAQTDLYNAQQSLISARLARWTNLVTLYRALGGGW 477


>gi|299146293|ref|ZP_07039361.1| RND efflux system, outer membrane protein, NodT family [Bacteroides
           sp. 3_1_23]
 gi|298516784|gb|EFI40665.1| RND efflux system, outer membrane protein, NodT family [Bacteroides
           sp. 3_1_23]
          Length = 459

 Score =  202 bits (513), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 106/459 (23%), Positives = 204/459 (44%), Gaps = 17/459 (3%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
             L     L   +L  C VG  Y +P + L     S+  S++ ++     W + + D +L
Sbjct: 4   KKLYIAILLLAGVLTSCKVGKSYVRPDLHLPD---SLERSQDSVSFGDQDWRDIYTDATL 60

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF--------IPNLK 113
             L++ AL  N  +L A  R+           A L P     ++                
Sbjct: 61  RSLIERALDHNKDMLIAAARVKEMAAQKRISTAALLPDIKGKVTGERELENHGGDAFKRS 120

Query: 114 TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                Q    W++DL+G  R    +S+A    +       ++ +++++  +Y +      
Sbjct: 121 DTFEAQFLVSWEVDLWGNLRWARSASIAEYLQSIEAQRALQMTIVAEVAQAYYELVALDT 180

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + I  Q L   ++ + L+ ++F  G TS+ S  + + E+    + +P LE+   +  ++
Sbjct: 181 ELDIVKQTLKAREEGVRLARIRFAGGLTSETSYRQAQVELARTATLVPDLERKISLKEND 240

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           I+ L G    +       Q  N    L     +G+P+ L+  RPDIR  E+KL  + AK+
Sbjct: 241 IAYLAGEYPNKIARSRLLQEFNSPETLP----VGLPSTLLERRPDIRQAEQKLIAANAKV 296

Query: 293 GIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYL-PIFDKGKIKSNIRRAESSA 351
           G+A ++++P L+L G       +      + ++      L PIF  GK ++ ++  +++ 
Sbjct: 297 GVAYTNMFPRLALTGGFGSESTSLSELLKSPYAVMEGALLTPIFGWGKNRAALKARKAAY 356

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           + +  +++++VL A KE  NA+ + N+ K++     +     K  M L+ + Y  G  + 
Sbjct: 357 EAEVHSYEKSVLEAFKETRNAIVNFNKIKEVYELRANLERSAKSYMDLAQLQYINGVINY 416

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           LD+LD +R     ++ LS A R    + V LY A+G G+
Sbjct: 417 LDVLDAQRGYFDAQIGLSNAIRDELIAVVQLYKALGGGW 455


>gi|56554391|pdb|1WP1|A Chain A, Crystal Structure Of The Drug-Discharge Outer Membrane
           Protein, Oprm
 gi|56554392|pdb|1WP1|B Chain B, Crystal Structure Of The Drug-Discharge Outer Membrane
           Protein, Oprm
          Length = 474

 Score =  202 bits (513), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 97/455 (21%), Positives = 189/455 (41%), Gaps = 25/455 (5%)

Query: 18  CTVGPEYTKPHMPLLPTQ-----FSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQN 72
           C++ P+Y +P  P+         +        +    + W E F D  L +L+ +AL+ N
Sbjct: 1   CSLIPDYQRPEAPVAAAYPQGQAYGQNTGAAAVPAADIGWREFFRDPQLQQLIGVALENN 60

Query: 73  LTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDS---------- 122
             +  A   + A +      RADLFP      S          ST    +          
Sbjct: 61  RDLRVAALNVEAFRAQYRIQRADLFPRIGVDGSGTRQRLPGDLSTTGSPAISSQYGVTLG 120

Query: 123 --DWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQ 179
              W++DLFG+ R +   +L    +       A+  +++ +  +Y+  +  + ++ +   
Sbjct: 121 TTAWELDLFGRLRSLRDQALEQYLATEQAQRSAQTTLVASVATAYLTLKADQAQLQLTKD 180

Query: 180 ILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGY 239
            L  Y+K+ +L+   +  G  S L L + +  ++   + +    +    + + +  LLG 
Sbjct: 181 TLGTYQKSFDLTQRSYDVGVASALDLRQAQTAVEGARATLAQYTRLVAQDQNALVLLLG- 239

Query: 240 PATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDL 299
                +     Q       L   +  G+P+DL++ RPDI   E +L  + A IG A++  
Sbjct: 240 ---SGIPANLPQGLGLDQTLLTEVPAGLPSDLLQRRPDILEAEHQLMAANASIGAARAAF 296

Query: 300 YPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYI 356
           +PS+SL  +           F   +  W F P + LPIF  G +++++  A+        
Sbjct: 297 FPSISLTANAGTMSRQLSGLFDAGSGSWLFQPSINLPIFTAGSLRASLDYAKIQKDINVA 356

Query: 357 TWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILD 416
            +++ +  A +EV + L +     + +   +  V+   +   L+   YR G  + L +LD
Sbjct: 357 QYEKAIQTAFQEVADGLAARGTFTEQLQAQRDLVKASDEYYQLADKRYRTGVDNYLTLLD 416

Query: 417 IERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            +R+    +  L   +     S V+LY A+G G+N
Sbjct: 417 AQRSLFTAQQQLITDRLNQLTSEVNLYKALGGGWN 451


>gi|71153534|sp|O31101|SRPC_PSEPU RecName: Full=Solvent efflux pump outer membrane protein srpC;
           Flags: Precursor
 gi|2605915|gb|AAD12177.1| outer membrane channel protein [Pseudomonas putida]
 gi|256033035|gb|ACU57135.1| outer membrane channel protein [Pseudomonas putida]
          Length = 470

 Score =  202 bits (513), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 104/471 (22%), Positives = 201/471 (42%), Gaps = 25/471 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQ-----FSIGNSKNLINIDTLKWWES 55
           M   +++    +++L GC++ P+Y +P  P+         +     +  I     K  E 
Sbjct: 1   MK-FKSLPMFALLMLGGCSLIPDYQQPAAPMQAQWPTGQAYGGQGDQRSIATALPKAKEF 59

Query: 56  FNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK-- 113
           F D +L +L+  AL+ N  +  A + + + +      RA+ FP+     S          
Sbjct: 60  FKDPALVRLLDAALENNRDLRIAAKNVESYRALYRIQRAERFPTLDGQASGNRTRLPDDL 119

Query: 114 ---------TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPS 163
                    +     L + +++DLFG+ R +   +L    +        ++ +I  +  +
Sbjct: 120 SPTGDSRIDSQYQVGLVTAYELDLFGRIRSLSNQALEKYLATEEAQRSVQIALIGDVATT 179

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y   R  +  + +    L  Y +++ +       G +S+L + +    +   ++      
Sbjct: 180 YFLWRTDQALLELTEATLTSYVESLAMIESSAWAGTSSELDVRQARTLVNQAQAQQALYT 239

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    +V+ +  LLG      L      + +    +      G+PADL+ NRPDIR  E 
Sbjct: 240 RRIAQDVNALELLLGSKIPTDLPKNSPLAMSALGKVP----AGLPADLLLNRPDIRSAEH 295

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKI 340
           +L  + A IG A++  +P +SL  S      +    F   +  WSF P++ +PIF+ GK+
Sbjct: 296 QLMAANANIGAARAAFFPRISLTASAGSASSDLDGLFNSGSDSWSFAPQISVPIFNAGKL 355

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++N+  AE        T+++++  A +EV + L +     K ++     V+ +K   SL+
Sbjct: 356 RANLDYAELQKDVGVATYEKSIQTAFREVADGLAARGTYGKQLSAQSELVDNYKAYFSLA 415

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
              Y QG  S L +LD +R     +  L   +     S V LY A+G G++
Sbjct: 416 QQRYDQGVDSYLTVLDAQRELFSSQQKLLNDQLDQINSEVQLYKALGGGWS 466


>gi|294665294|ref|ZP_06730587.1| outer membrane protein [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|292604930|gb|EFF48288.1| outer membrane protein [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
          Length = 503

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 105/485 (21%), Positives = 208/485 (42%), Gaps = 36/485 (7%)

Query: 1   MNILRAIFSLF--IVLLAGCTVGPEYTKPHMPLLPTQFS----------------IGNSK 42
           M  +R          +L+GCT+ P YT+P  P +P QF+                 G++ 
Sbjct: 1   MTTIRTTLCALGVASVLSGCTLMPRYTRPDAP-VPAQFAGTDVSVAPPAAAATADTGSNA 59

Query: 43  NLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYA 102
           +  +I  + W + F D +L +++ +AL  N  +  A   I  A+      RA L P+   
Sbjct: 60  DTAHIADIGWRQVFTDPALQQVIALALDNNRDLRVAALNIEVARAQYRVDRAALLPAIDG 119

Query: 103 SISHRFIPNLK------------TNSTGQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQV 149
           + +                    T S     S +++DLFG+ R ++        S     
Sbjct: 120 TGTANNARTPSELAIPGQPQVFRTYSANIGISAYELDLFGRVRSLKEQALQQFLSTAEAR 179

Query: 150 DIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLE 209
               +++++++  +Y+     ++ + +A   L     +  L    F  G  S+L+L + +
Sbjct: 180 RSTHISLVAEVATAYLTLAADQQLLQLAQSTLTSQSDSYRLQQRSFELGVASQLTLRQAQ 239

Query: 210 AEIKSIESDIPTLEKSFRMNVHNISTLLGYP-ATEFLHYMQKQSNNFQPNLYIPINIGIP 268
             +++   D+         + + +  L+G     E L +    + + + N+   +  G+P
Sbjct: 240 TTVETARVDVERYTAQVAQDRNAMVLLVGTQVPVELLPHALPDNASVEGNVLASVPAGLP 299

Query: 269 ADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYP---SLSLNGSIALTHDNSFPGYNTHWS 325
           + L++ RPDI   E+ L  + A IG A++  +P     +  GS + +    F      WS
Sbjct: 300 SQLLQRRPDILEAERNLRAANANIGAARAAFFPSISLTASTGSSSSSLSRLFDAGTRAWS 359

Query: 326 FGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTK 385
           F P L LPIF+ G+ ++N+  A+++   +   +++++ +A +EV +AL   +   + +  
Sbjct: 360 FVPTLTLPIFNAGRNRANLDMAKANRDIEVARYEKSIQSAFREVSDALAQRDTLGRQLQA 419

Query: 386 LQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIA 445
            Q  V+    S  LS   + +G  S L  LD +R+    +  L   +     + V  Y A
Sbjct: 420 QQALVDATADSYRLSQARFERGIDSYLQALDAQRSLYSAQQTLINTQLSRFTNLVTFYKA 479

Query: 446 IGSGY 450
           +G G+
Sbjct: 480 MGGGW 484


>gi|19352357|ref|NP_598115.1| OprJ protein [uncultured bacterium]
 gi|19070024|emb|CAD24340.1| OprJ protein [uncultured bacterium]
          Length = 475

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 110/464 (23%), Positives = 205/464 (44%), Gaps = 19/464 (4%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLN 62
           + R    +  + +AGC++ P Y +P  P+  +      +      D L W     D  L+
Sbjct: 6   LFRPALLVLTLTVAGCSLAPNYQRPEAPVAASWTPTVEATGSFAADVLDWKTFIIDPQLH 65

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKT-------- 114
           ++V  AL  N ++ QA   I AA+      RAD  PS  A+ +                 
Sbjct: 66  RVVDAALSNNRSLRQALLDIEAARAQYRVQRADRLPSINANATGSRQRLPADLSSSGRSD 125

Query: 115 ----NSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                  G   +++++DLFG+ R++ ES+L    +        ++++I+++I +Y+    
Sbjct: 126 VSSSYQVGPGLTEYEVDLFGRVRNLSESALETYLATEEATRATQVSLIAEVIEAYLTRDG 185

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
            + R+++  Q L   + ++EL   +   G  + L   +     +  +++  +  +  +  
Sbjct: 186 AQRRLALVEQTLKTREDSLELISRRRQAGTATALDYQEALGLAEQAKAERESTLRLLQQT 245

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            + +  L+G P    L     + +     +   I  G P+ LI  RPDI   E +L    
Sbjct: 246 DNALVLLVGTPDANSLLPAAPRDSLL---VLQDIAPGTPSTLIERRPDILASEHRLKARN 302

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           A IG A++  +P LSL GS+  +       F G +  WSF P L LPIF  G+ ++N+  
Sbjct: 303 ADIGAARAAFFPRLSLTGSVGSSSTELSGLFDGGSRAWSFAPSLSLPIFAGGRNRANLDL 362

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
           AE         ++ T+  A +EV +ALT+ +  ++     +   +    +M+L+   Y  
Sbjct: 363 AEVRKDAAVAAYEGTIQVAFREVADALTATDTLRREEAARRALADSSVAAMTLAKARYDG 422

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           G    L  LD +R+T   +V L     +   + VDL+ ++G G+
Sbjct: 423 GVDDYLRYLDAQRSTFGNQVTLIQISTERQIALVDLFKSLGGGW 466


>gi|114047530|ref|YP_738080.1| RND efflux system outer membrane lipoprotein [Shewanella sp. MR-7]
 gi|113888972|gb|ABI43023.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Shewanella sp. MR-7]
          Length = 486

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 107/463 (23%), Positives = 215/463 (46%), Gaps = 23/463 (4%)

Query: 7   IFSLFIVLLAGCTVGPEYTKPHMPLLPT-------QFSIGNSKNLINIDTLKWWESFNDT 59
           +  L  + +AGC +GP+Y +P + L          Q S     +L  +  L W   + D 
Sbjct: 23  LCILTALTVAGCAMGPDYERPELTLPSQYQAQILSQTSAEQGSSLKEVSALSWRHFYQDP 82

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI---------P 110
            L  L++ AL  NL +  A  R+ AA+  +  V + L+P   AS               P
Sbjct: 83  VLILLIEHALSSNLDLQMAQSRLLAARSKMTVVDSALWPEISASAGFERSLDSGTTSKDP 142

Query: 111 NLKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
           +  T         W++DL+G  R   E++ A+  S   ++ +  +++IS +   Y +   
Sbjct: 143 SPGTTLDLAGTVSWELDLWGANRRASEAAKADYLSEVEKLRLTYVSLISDIASRYYEWLD 202

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
            ++R S++   + + +K ++++ L+   G  S L + + E E++S +  +PTL+   +  
Sbjct: 203 IEQRYSVSIDTVGIRQKELDIAKLRHANGVISGLDVRQAEVELQSTKVTLPTLDYERKYK 262

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
           ++ +  LLG            Q       L   ++ G+P++L+  RPD++  E+ +  + 
Sbjct: 263 INQLHILLGEY---DYALPSPQGLPENVGLPYELSAGVPSELLTLRPDVKMSEQAMIAAN 319

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           A++GIAK+  +P  +++G     ++   + F      WS    +  PIF++GKI +    
Sbjct: 320 AQVGIAKAAFFPKFTISGQYGRENNHLKDIFDSNGVTWSLLGGISAPIFNRGKIAAEYDI 379

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
           A   A++  ++++  VL A  +V +AL ++   ++ +   +  V+       L+ + Y+ 
Sbjct: 380 ATEEAKQSMLSYRNVVLTAYFDVNDALNNLKRAQEAIKAQRELVQSSSAYARLARLRYQN 439

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           G  + LD++D +R     ++  S   R    + + LY A+G G
Sbjct: 440 GVATSLDLMDAQRQLFSAQLAYSEILRDKQLAKIALYRALGGG 482


>gi|254883855|ref|ZP_05256565.1| outer membrane protein oprM [Bacteroides sp. 4_3_47FAA]
 gi|254836648|gb|EET16957.1| outer membrane protein oprM [Bacteroides sp. 4_3_47FAA]
          Length = 460

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 116/461 (25%), Positives = 214/461 (46%), Gaps = 16/461 (3%)

Query: 1   MN-ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDT 59
           M   L  I    + LL  C +G  YT+P +  LP Q      ++ ++I  ++WWE + DT
Sbjct: 5   MKHTLLYIAVSGMTLLTSCQLGKHYTRPDL-HLPQQLDTLRQQDTLSIADMQWWEIYTDT 63

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST-- 117
           +L  L++  L  N  +  A  R+           A+LFP    S   +   +        
Sbjct: 64  TLQSLIEKTLDNNKDMKIAAARVKELAAMKRIDFANLFPQLNGSAYAQKEGSNYGGDNYK 123

Query: 118 ------GQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                 G+L   W++DL+G  R   + S+A    +       K++++S++  +Y +    
Sbjct: 124 NDPELGGKLTVTWELDLWGNLRWAKDKSIAQFLGSIEAQRALKMSIVSEVAQAYFELVAL 183

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
              ++I  Q L   K+ + L+ L+F  G TS+ S  + + E     + +P LE+   +  
Sbjct: 184 DNELNIVRQTLYARKEGVRLAKLRFEGGLTSETSYQQAQVEYARTATLVPELERKISLKE 243

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           ++I+ L G       H +Q+     +  L   + +G+P+ L+  RPD+R  E+KL  + A
Sbjct: 244 NDIAFLAGEYP----HRIQRSILPEEVKLPETLPVGLPSTLLERRPDVREAEQKLIAANA 299

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNSFPGYN-THWSFGPKLYLPIFDKGKIKSNIRRAES 349
            +GIA ++++P LSL     +  +     +          L  P+F  GK ++ ++  ++
Sbjct: 300 SVGIAYTNMFPRLSLTAQYGVESEEFSDFFKSPIHYISGNLLTPLFAMGKYRATLKAKKA 359

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
           + +++  +++++VL A KE  NA+   N+ K I           K +M L+ + Y  G  
Sbjct: 360 AYEQECYSYEKSVLTAFKEARNAIVDFNKIKDIYESRLQLERSSKATMELAQLQYINGVI 419

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             LD+LD +R+    ++ LS A R    + V LY A+G G+
Sbjct: 420 GYLDVLDAQRSYFDAQIGLSNAIRDKQITLVKLYKALGGGW 460


>gi|209966990|ref|YP_002299905.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhodospirillum centenum SW]
 gi|209960456|gb|ACJ01093.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhodospirillum centenum SW]
          Length = 467

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 97/464 (20%), Positives = 194/464 (41%), Gaps = 21/464 (4%)

Query: 4   LRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNK 63
           +R       + L+ C++ P+  KP +P+     S     +      L W   F D  L +
Sbjct: 1   MRLTIFALSLALSACSLTPDPVKPGLPVPDAYPSPVTVADGEPAADLDWRVMFGDPRLQR 60

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI-----PNLKTNSTG 118
           L+++AL+ N  +  A   + A +      RA   P+  A+           P     + G
Sbjct: 61  LIELALRNNRDLRLAALNVEAVQAQYTIQRAARLPAVNATGGVTRQRIAADPQADPATDG 120

Query: 119 QLDSDWKIDLFGQRRHIE----------SSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
           ++ +   +D+      I+          ++ A   ++       ++ ++  +  +Y   R
Sbjct: 121 RIQTQHTLDIGVSAFEIDLFGRVRSLSDAAFARYLASEEGRRAVQIALVGTVADAYFAER 180

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
             +E++ +A + LD ++++++L+         S L + + E +  + E+D+    ++   
Sbjct: 181 LAEEQLDLARRTLDDWRQSLDLARRLKAADQNSDLDVAQAEGQAATAEADLEERARTLAR 240

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
             + +  L+G    + L        +    +   +  G+P+DL+  RPDIR  E  L  +
Sbjct: 241 ATNALILLVGAELPDELPPPWPLDGHA---VRTRLPAGLPSDLLTRRPDIRKAEHDLVAA 297

Query: 289 VAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
            A IG A++  +P LSL  S+          F G    WSF P++  P+F  G++++ +R
Sbjct: 298 NADIGAARAAFFPRLSLTTSLGYASPILGRLFDGEQRGWSFTPQITQPLFMGGQLRAELR 357

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
            AE    E    ++  +  A +EV + L       + +      V   ++ ++LS + YR
Sbjct: 358 LAEIRKSEAIAEYERAIQTAFREVADGLAGSATYGRQIEAQNRTVASAERRLALSTLRYR 417

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
            G    L++LD +R            KR    + + LY A+G G
Sbjct: 418 AGLEGRLELLDAQRQLYAARQTRLDLKRDEIGNAISLYKALGGG 461


>gi|332883873|gb|EGK04153.1| hypothetical protein HMPREF9456_01181 [Dysgonomonas mossii DSM
           22836]
          Length = 459

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 109/459 (23%), Positives = 208/459 (45%), Gaps = 14/459 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           MN L  I  +   L + C +G +Y +P M  +P  F    + N  N   + W   + D+ 
Sbjct: 1   MNKLTYILLISTALFSSCKIGRKYEQPEMN-IPQTFDAKIT-NQGNASDIGWSALYQDSV 58

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASI--------SHRFIPNL 112
           L  L+  AL  N  +L A  RI     N     A+LFP   A +                
Sbjct: 59  LQGLITKALDHNKDMLIAAARIKEMAANKRISFANLFPEIGAEVAGQKEYLNYGGDSKKY 118

Query: 113 KTNSTGQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
                  L+  W++D++G+ R    + +A             L +++++  +Y + +   
Sbjct: 119 SPELRANLNVSWELDIWGKLRWANEAGVAAYLQTVEAQRAMHLTIVAQVAQAYFELKALD 178

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
           + + I  Q LD  ++ +  + L++  G TS++   +   E+   E+ IP LE   ++  +
Sbjct: 179 KELVIVKQTLDARREGVRFAKLRYEGGLTSEIPYRQSLVELARTETLIPNLENEIKLKEN 238

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
           ++  L+G       +  + + +     +   + I +P+ L++ RPD+   E+KL ++ AK
Sbjct: 239 DLFVLVGEFP--IGNIPRGKDDISHLQVPASLPIDLPSSLLKRRPDMIQAEQKLIEANAK 296

Query: 292 IGIAKSDLYPSLSLNGSIALTHDNSFPG-YNTHWSFGPKLYLPIFDKGKIKSNIRRAESS 350
           +G+A +D++PSL L G +   +        +  W     L  PIF+ GK K+    A+++
Sbjct: 297 VGMAYTDMFPSLRLTGRLGGENTELTDFLKSPTWFISGVLTGPIFNMGKNKAKHNAAKAT 356

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
            +++  +++++VLN  KEV N++ + N+ K++    +           L+ + Y  G   
Sbjct: 357 YEQEVYSYEKSVLNVFKEVNNSIITFNKMKEVYLSQEALYNSANSYHELAKLQYVNGAVK 416

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
            +D+LD +R     E+ L+ A      S V LY A+G G
Sbjct: 417 YIDVLDAQRQLFDAEIALNNATLNELYSLVALYKALGGG 455


>gi|167624092|ref|YP_001674386.1| RND efflux system outer membrane lipoprotein [Shewanella
           halifaxensis HAW-EB4]
 gi|167354114|gb|ABZ76727.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Shewanella halifaxensis HAW-EB4]
          Length = 512

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 114/455 (25%), Positives = 205/455 (45%), Gaps = 13/455 (2%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKI 67
            +  I+LL+GC +GP+Y +P + +           +  N+    W E + D  L  L++ 
Sbjct: 33  VACGILLLSGCAMGPDYQRPDLEIPEQFHHELQQTDEQNVGLKHWREFYLDPELQVLIEH 92

Query: 68  ALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI---------PNLKTNSTG 118
           AL QNL +     R+ AA+  +    A LFP      +             P  +     
Sbjct: 93  ALDQNLDLEGVRSRLLAARAGVTVTDAALFPVVGLDANGERALDSALTSTDPVKEDTFYV 152

Query: 119 QLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIA 177
                W++DL+G  R    +  AN  S+   +++A +++IS +   Y +    ++R  I+
Sbjct: 153 AGTVSWELDLWGANRRRSEAEFANFISSQEALNLATISLISDVASRYYEWLDIEQRYQIS 212

Query: 178 HQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLL 237
              ++L KK  +L+ L+   G  S L + + E E +S    +P L+       + +  LL
Sbjct: 213 LNTVELRKKERDLARLRKQNGVISGLQVRQAEVEYQSARVTLPDLDYERSEKANQLRILL 272

Query: 238 GYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKS 297
           G      +   + Q             +G+P+ ++  RPD++  E+ L  + A +G+AK+
Sbjct: 273 GEFKYPLIPKTEAQLKAEGALFPDSFAVGVPSQMLSQRPDVKSAEQALVAANANVGVAKT 332

Query: 298 DLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQ 354
             +P  +++GS     +   + F      WS    +  PIF+ GKI +    A+  A++ 
Sbjct: 333 AFFPKFTISGSYGSESESLSDIFDSQGITWSLLGGITAPIFNAGKITAQYDIAQEDAKQA 392

Query: 355 YITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDI 414
            ++++ TVL A  EV +A+ S    +  +   Q  V    +   L+ + YR G  S LD+
Sbjct: 393 MLSYRSTVLGAYFEVNDAMNSFRRSELAIDAQQELVVASTEYTRLATLRYRNGVSSSLDL 452

Query: 415 LDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           +D +R+    E+ LS  KR    S + LY A+G G
Sbjct: 453 MDAQRSLFSAELTLSQVKRDQLLSMITLYRALGGG 487


>gi|237722260|ref|ZP_04552741.1| cation/multidrug efflux pump [Bacteroides sp. 2_2_4]
 gi|229448070|gb|EEO53861.1| cation/multidrug efflux pump [Bacteroides sp. 2_2_4]
          Length = 459

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 106/459 (23%), Positives = 204/459 (44%), Gaps = 17/459 (3%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
             L     L   +L  C VG  Y +P + L     S+  S++ ++     W + + D +L
Sbjct: 4   KKLYIAILLLAGVLTSCKVGKSYVRPDLHLPD---SLERSQDSVSFGDQDWRDIYADATL 60

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF--------IPNLK 113
             L++ AL  N  +L A  R+           A L P     ++                
Sbjct: 61  RSLIERALDHNKDMLIAAARVKEMAAQKRISTAALLPDIKGKVTGERELENHGGDAFKRS 120

Query: 114 TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                Q    W++DL+G  R    +S+A    +       ++ +++++  +Y +      
Sbjct: 121 DTFEAQFLVSWEVDLWGNLRWARSASIAEYLQSIEAQRALQMTIVAEVAQAYYELVALDT 180

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + I  Q L   ++ + L+ ++F  G TS+ S  + + E+    + +P LE+   +  ++
Sbjct: 181 ELDIVKQTLKAREEGVRLARIRFAGGLTSETSYRQAQVELARTATLVPDLERKISLKEND 240

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           I+ L G    +       Q  N    L     +G+P+ L+  RPDIR  E+KL  + AK+
Sbjct: 241 IAYLAGEYPNKIARSRLLQEFNSPETLP----VGLPSTLLERRPDIRQAEQKLIAANAKV 296

Query: 293 GIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYL-PIFDKGKIKSNIRRAESSA 351
           G+A ++++P L+L G       +      + ++      L PIF  GK ++ ++  +++ 
Sbjct: 297 GVAYTNMFPRLALTGGFGSESTSLSELLKSPYAVMEGALLTPIFGWGKNRAALKAKKAAY 356

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           + +  +++++VL A KE  NA+ + N+ K++     +     K  M L+ + Y  G  + 
Sbjct: 357 EAEVHSYEKSVLEAFKETRNAIVNFNKIKEVYELRANLERSAKSYMDLAQLQYINGVINY 416

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           LD+LD +R     ++ LS A R    + V LY A+G G+
Sbjct: 417 LDVLDAQRGYFDAQIGLSNAIRDELIAVVQLYKALGGGW 455


>gi|255010520|ref|ZP_05282646.1| putative puter membrane protein [Bacteroides fragilis 3_1_12]
 gi|313148326|ref|ZP_07810519.1| outer membrane protein [Bacteroides fragilis 3_1_12]
 gi|313137093|gb|EFR54453.1| outer membrane protein [Bacteroides fragilis 3_1_12]
          Length = 458

 Score =  202 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 106/463 (22%), Positives = 209/463 (45%), Gaps = 19/463 (4%)

Query: 1   MNI--LRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFND 58
           M    L     L    L  C +G  Y +P + L     S+   ++ ++    +WW+ + D
Sbjct: 1   MKRSYLYITLLLTAFTLGSCKIGKSYVRPDLNLPD---SLAQHQDTLSFGDREWWQIYTD 57

Query: 59  TSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN------- 111
           ++L  L+  AL+ N  +L A  R+           A+L P    +++             
Sbjct: 58  STLRSLIDRALEHNKDMLIAAARVKEMAAQKRISTANLLPDIKGTVTAERENENHGGDAF 117

Query: 112 -LKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                   QL   W++DL+G  R    +S+A    +       ++ +++++  +Y +   
Sbjct: 118 KRSDTFEAQLLFSWELDLWGNLRWARSASIAEYLQSVEAQRALRMTIVAEVAQAYYELVA 177

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
               + I  Q L   ++ + L+ ++F  G TS+ S  + + E+    + +P LE+   + 
Sbjct: 178 LDTELDIVRQTLKAREEGMRLARIRFEGGLTSETSYRQSQVELARTATLVPDLERKISLK 237

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            ++I+ L G    +       Q  NF   L     +G+P+ L+  RPDIR  E+KL  + 
Sbjct: 238 ENDIAFLAGEYPNKITRSRLLQEFNFPQELP----VGLPSGLLERRPDIRQAEQKLIAAN 293

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYL-PIFDKGKIKSNIRRAE 348
           A++G+A ++++P +SL G +            + +S      L PIF  GK ++ ++  +
Sbjct: 294 ARVGVAYTNMFPRISLTGRVGSESTALSELLKSPYSIMEGALLTPIFGWGKNRAALKAKK 353

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           ++ + +  +++++VL A KE  NA+ + N+ K++           K  + L+ + Y  G 
Sbjct: 354 AAYEAEVHSYEKSVLTAFKETRNAIVNFNKIKEVYDLRAKLERSAKSYVDLAQLQYINGV 413

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            + LD+LD +R     ++ LS A R    + V +Y A+G G+ 
Sbjct: 414 TNYLDVLDAQRGYFDAQIGLSNAMRDELIAVVQVYKALGGGWQ 456


>gi|187925229|ref|YP_001896871.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia phytofirmans PsJN]
 gi|187716423|gb|ACD17647.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia phytofirmans PsJN]
          Length = 525

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 105/496 (21%), Positives = 207/496 (41%), Gaps = 49/496 (9%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLL---------------------------- 32
           M     I     +  AGCT+ P+Y +P  P                              
Sbjct: 1   MQKHSLIAVAVALFAAGCTMAPKYERPAPPTTSTFPTGGVYDTQPGATQPGAGQTDATQT 60

Query: 33  ----PTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKEN 88
               P   +   S N      + W + F D  + +L++IAL+ N  +  +   + A+   
Sbjct: 61  GKQQPGATNAARSANGQAAVDIGWRDFFVDPRMQRLIEIALKNNRDLRVSVLNMQASAAQ 120

Query: 89  ILSVRADLFPSSYASISHRFIPNL----------KTNSTGQLDSDWKIDLFGQRRHI-ES 137
              VRA L P+  A+ S                     +  L++ W+ID FG+ + + + 
Sbjct: 121 YRIVRAGLLPTLDAAASQSKQRTPKNLSFAGQTITNTYSVGLNASWEIDFFGRIQSLKDQ 180

Query: 138 SLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQ 197
           +LA   +       A+++++S++   Y+      + + +    L   +++  ++ L+F  
Sbjct: 181 ALAQYLATAQARKAAEISLVSQVATQYMTVLELDDLLKVTQNTLKTSQESYRIAKLQFDN 240

Query: 198 GATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQP 257
           G  S+L L + +  ++  ++++    +      + +  L+G P  +    +         
Sbjct: 241 GTGSELDLRQSQTVVEQAQANLQQQMRLRAQADNALVLLIGEPLPDD---LPPGMTLDNQ 297

Query: 258 NLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS- 316
           NL   I  G+P+DL+  RPDI   E+ L  + A IG A++  +P +SL GS      +  
Sbjct: 298 NLLTDIPAGLPSDLLTRRPDIMEAEENLLAANANIGAARAAFFPKVSLTGSFGTLSPSLG 357

Query: 317 --FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALT 374
             F   +  WSF P + LPIF+ G+  +N+  A    + Q  T+++ + +A ++V +AL 
Sbjct: 358 GLFKPGSAAWSFAPSITLPIFEGGQNLANLDLANIQKKVQIATYEKAIQSAFRDVADALA 417

Query: 375 SINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQ 434
           +     + +  L+      ++ + LS + Y  G  S L +L  +      +  L  A+ +
Sbjct: 418 ARGTYDQQIQALERNTFAEQRRLDLSNLRYTNGVDSYLTVLTAQTDLYSSQQLLVTARME 477

Query: 435 LAKSYVDLYIAIGSGY 450
             ++ V LY  +G G+
Sbjct: 478 RLQNLVTLYQVLGGGW 493


>gi|311107562|ref|YP_003980415.1| outer membrane protein OprM 4 [Achromobacter xylosoxidans A8]
 gi|310762251|gb|ADP17700.1| outer membrane protein OprM 4 [Achromobacter xylosoxidans A8]
          Length = 495

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 103/491 (20%), Positives = 205/491 (41%), Gaps = 44/491 (8%)

Query: 1   MNILR----AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGN---------------- 40
           M  L+    A+ +   V LAGC++ P+Y +P  P+                         
Sbjct: 1   MKALKFKQTALSAFVAVALAGCSLAPDYKRPDAPVTDAWPDQPKVQYGGYAKPTSLGTQP 60

Query: 41  -----SKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRAD 95
                 ++      L W E F D  L  L++++L  N  +  A ER+  A+      R  
Sbjct: 61  STAVMPQDGTPAANLGWREFFRDPRLQSLIELSLVNNRDLRVAVERVEEARAQYGIQRGA 120

Query: 96  LFPSSYASISHRFIPNLKTNST------------GQLDSDWKIDLFGQRRHIESSLANLD 143
            +PS  A I  +     +                G   + ++IDLFG+ R++  +     
Sbjct: 121 QWPSIGAGIQGQRQHLPQNMRQPGSGSISSSYQAGIGLTTFEIDLFGRLRNLSEAAYQQY 180

Query: 144 SAYAQVD-IAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSK 202
            +  Q    A++ ++  +  SY + R  + ++ +  + L   +++ +L   +F  G  S+
Sbjct: 181 LSTEQAQKSAQITLVGAVAQSYFNLRAAEVQLELTQRTLASRQESYDLVKRRFDGGVASE 240

Query: 203 LSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIP 262
           L L + +  + +  SD+  L ++    ++ +  L+G   T     +   +   +  L   
Sbjct: 241 LDLNQAKTLLDTASSDLAQLARAQAQAMNALVLLVG---TPLPPDLPAPAVFGRDQLLAT 297

Query: 263 INIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPG 319
           +  G+P+DL+  RPDI   E +L  + A IG A++  +P++SL G + +      + F G
Sbjct: 298 VPAGLPSDLLERRPDIMAAENQLLSANANIGAARAAFFPTISLTGLLGVASPSLGDLFKG 357

Query: 320 YNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINED 379
              +WSF P +  P+F  G I+  +  A++        +++++  A +EV +AL      
Sbjct: 358 GQGYWSFSPSITTPLFAGGSIREGLNLAKARDNIAVAQYEQSIQQAFREVSDALAGEATY 417

Query: 380 KKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSY 439
              +   +   +   +++ LS + Y  G  S L +   +      ++ L         + 
Sbjct: 418 GAQLDAQRALQDASGRTLELSNLRYTNGIDSYLQVQTAQVDFFNAQLSLVQTGLAALINR 477

Query: 440 VDLYIAIGSGY 450
           V+LY A+G G+
Sbjct: 478 VELYKALGGGW 488


>gi|4321267|gb|AAD15665.1| outer membrane protein TbtM [Pseudomonas stutzeri]
          Length = 476

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 104/470 (22%), Positives = 199/470 (42%), Gaps = 26/470 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGN----SKNLINIDTLKWWESF 56
           M  L+ +     + L+GC++ P+Y +P MP+             +        L W E F
Sbjct: 1   MR-LKHLTVAMTLALSGCSLIPDYQRPDMPVQAQWPEGAAYEQGAAASTTTAELGWREFF 59

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
            D +L +L+ ++L+ N  + QA   + A +      R+DLFPS     S +        S
Sbjct: 60  VDPTLQRLIVLSLENNRDLRQAALTVEAYRAQYRISRSDLFPSIGIDGSGQRQRLPADLS 119

Query: 117 TGQL------------DSDWKIDLFGQRRHIES-SLANLDSAYAQVDIAKLNVISKLIPS 163
                            S +++D FG+ R +E  +LA   +        ++ ++S++  +
Sbjct: 120 NTGEADIASQYGVTLGVSAYELDFFGRLRSLEEGALARYLATEEAQRSVQIGLVSEVAMA 179

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  R  +  + + H  L  Y K++ L       G  S L + +  + ++          
Sbjct: 180 YLTWRTDQGLLELTHDTLYSYGKSLSLVQAAHDVGTASALDVRQARSLVEQARVQFARYS 239

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    + + +  LLG      +             ++  + +G+PADL+  RPDI   E 
Sbjct: 240 RLVAQDANLLRLLLGTELPADIT-----DEPGSDRMFAELPVGMPADLLLRRPDIIAAEF 294

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKI 340
           +L  + A IG A++  +PS+ L  +        D  F G +  WSF P++ +PIF  G++
Sbjct: 295 RLHAANANIGAARAAFFPSIRLTAAAGTLSGELDGLFEGGSGTWSFMPQINIPIFTAGRL 354

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           K+N+  AE         +++T+  A +EV + L +    ++ +          ++ + L+
Sbjct: 355 KANLDYAEVQKDINIAEYEQTIQTAFREVADGLAARGTFEEQLQAQADLTTTTQEYLELA 414

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
              Y +G  + L +LD +R     +  L   +     S V L+ A+G G+
Sbjct: 415 QQRYDEGVDNYLAVLDAQRELFSAQQQLLSDRLLQLNSEVQLFRALGGGW 464


>gi|54293646|ref|YP_126061.1| hypothetical protein lpl0699 [Legionella pneumophila str. Lens]
 gi|53753478|emb|CAH14933.1| hypothetical protein lpl0699 [Legionella pneumophila str. Lens]
          Length = 489

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 120/476 (25%), Positives = 234/476 (49%), Gaps = 31/476 (6%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK--WWESFNDT 59
             L  +FS+  +   GCTVGP+Y +P + +     +    K + +   +   WW++F+D 
Sbjct: 3   RKLALLFSISCLF--GCTVGPDYQRPDIKIQEKWPTSKVEKKISSSAPVHLTWWKAFHDP 60

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASI--------------- 104
            L++ +  A   NL I  A  RI  A+       A+ +P    S                
Sbjct: 61  LLDRYISEAATNNLDIKAAEARIRQARAMKQISLANFYPQINGSASANSLQISKGTLEGI 120

Query: 105 -----SHRFIPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVIS 158
                ++  I   +       D+ W++DLFG+ RR +E+S A+L+ AY       L+ I+
Sbjct: 121 FANSPTYTLIDRNQWIYNLGFDAQWELDLFGKTRRKVEASKASLEEAYESRRTILLSTIA 180

Query: 159 KLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESD 218
           ++  SYI+ R  ++   IA + ++L +K + L   ++  G +S++ +   E ++K+ ES 
Sbjct: 181 EIARSYIELRGAQQLYGIAQKNVELQRKTLALVRQRYKAGVSSEVDVSLAEGQLKNTESV 240

Query: 219 IPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDI 278
           +P      ++N + I+ +LG      L  + K  +  +P     + +G+ +D++R RPDI
Sbjct: 241 LPNYIAQIQVNAYQIAVMLGKDPQTILKDIAKIQSLPKP--PQKVPMGLRSDILRQRPDI 298

Query: 279 RYQEKKLADSVAKIGIAKSDLYPSLSLNG----SIALTHDNSFPGYNTHWSFGPKLYLPI 334
           R  E++LA +VA+IG+A +D +P  +L+       + + D  F   +  W  GP++ LPI
Sbjct: 299 RATERQLASAVAEIGVAVADFFPQFNLSVSNLAFQSTSVDTLFQSSSGFWLMGPQVSLPI 358

Query: 335 FDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHK 394
           F  G+I++N+   ++  Q+  I +++ +L A++E ++AL   ++       L+ A+  +K
Sbjct: 359 FHGGQIRANVESKKAVVQQAAIQYKKIILQALQEAQSALVRYSQSLDTNHSLRAAIIANK 418

Query: 395 KSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +++  +   ++ G    L +L  E A    E     ++     + + LY A+G G+
Sbjct: 419 RAVQFAKKRFQYGEDDYLSLLQSEAALLNAETQEVNSEVSSLTALISLYKALGGGW 474


>gi|319796112|ref|YP_004157752.1| rnd efflux system, outer membrane lipoprotein, nodt family
           [Variovorax paradoxus EPS]
 gi|315598575|gb|ADU39641.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Variovorax paradoxus EPS]
          Length = 473

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 99/451 (21%), Positives = 192/451 (42%), Gaps = 18/451 (3%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTIL 76
           GC++ P Y +P  P+  T     +         L W + F D  L  L++ AL  N  + 
Sbjct: 18  GCSLIPTYERPAAPVPTTFPGDPSQPAGQAAAALPWQDFFTDPRLAGLIQTALANNRDLR 77

Query: 77  QATERINAAKENILSVRADLFPSSYASISHRFIPN-------------LKTNSTGQLDSD 123
            +   I  A+      R+ LFP+   + S                       S     + 
Sbjct: 78  VSVLNIEQARAQFQIERSALFPALGLTGSGSRSSPNSFQAFDSSVGSVSSQYSVNFGFTA 137

Query: 124 WKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILD 182
           W++D FG+ R + + +LA   +       A++++I+ +   +I      E + I  Q + 
Sbjct: 138 WELDFFGRIRALKDQALAQYLATEETRKAAQISLIASVATGWITLMADDELLEITRQTMV 197

Query: 183 LYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPAT 242
             ++++ L+ L+F  G +S++         +S  +     +++   + + ++ LLG P  
Sbjct: 198 TREESVRLAKLRFDNGVSSEIDFQAANTAAESARATYAQQQRARMQDENALALLLGAPVP 257

Query: 243 EFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPS 302
                   +  +    +      G+P+D++  RPDIR  E++L  + A IG A+++ +P 
Sbjct: 258 ADALSGGAKGLDGIKPMPDVP-AGLPSDMLIERPDIRAAEQQLIAANANIGAARANFFPR 316

Query: 303 LSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQ 359
           +SL   I          F   +  WSF P + LPIFD G+  + ++ +++  +     ++
Sbjct: 317 VSLTSGIGTASTEFSGLFDRGSKAWSFAPTVTLPIFDAGRNWATLQSSKAGREIAVAQYE 376

Query: 360 ETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIER 419
           +++  A +EV +AL       + V   +           LS + YR G  S LD+LD +R
Sbjct: 377 KSIQTAFREVADALAGRATLGEEVRAQRAQATAEAVRFKLSDLRYRNGIASALDLLDAQR 436

Query: 420 ATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +    +     A+    ++ V LY  +G G+
Sbjct: 437 SLFTAQQLAVNARLLQLQNQVTLYKTLGGGW 467


>gi|320105434|ref|YP_004181024.1| NodT family RND efflux system outer membrane lipoprotein
           [Terriglobus saanensis SP1PR4]
 gi|319923955|gb|ADV81030.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Terriglobus saanensis SP1PR4]
          Length = 498

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 108/473 (22%), Positives = 209/473 (44%), Gaps = 32/473 (6%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFS-------IGNSKNLINIDTLKWWESFND 58
           A+  L  +++ GC VGP Y +P M   P  +           ++   ++   +W   F D
Sbjct: 31  ALAGLLTLMIVGCRVGPNYARP-MGTTPQSYRGALAPEIAPATQAGASLGDRQWAAVFQD 89

Query: 59  TSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKT---- 114
             L +LV  ALQ NL +  A +R+  A+  +   R+   P+     S+  +    +    
Sbjct: 90  PVLQRLVAEALQNNLDLRVAAQRVLEAQAQVGITRSQQMPTINGGGSYSALQIPSSLAGN 149

Query: 115 ------------NSTGQLDSDWKIDLF-GQRRHIESSLANLDSAYAQVDIAKLNVISKLI 161
                              + W +D +   RR  E++ A L ++       ++ ++ ++ 
Sbjct: 150 KSDGTPANSFFSGGGFSASAAWNLDFWGMYRRQTEAARAELLASAWGQRATRVTLVQEVA 209

Query: 162 PSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPT 221
            +Y   R   E++ I +  +   + +++L+      G  S+    + E  + S  +++P 
Sbjct: 210 EAYFRLRSLDEQLEITNNTIKARQDSLQLTQSLEKYGFGSRADTRQAEELLHSALANLPE 269

Query: 222 LEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQ 281
           + +   +  + IS LLG+        ++         +      G+P+ L+  RPDI+  
Sbjct: 270 IRRQIAVQENTISILLGHNPDGVERGLKVADQPHPEEVP----TGVPSQLLERRPDIQRA 325

Query: 282 EKKLADSVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKG 338
           E  L  + A+IG+AK+  +P +SL            N F   N +W     L  PIFD G
Sbjct: 326 EATLIAANARIGVAKAQFFPQISLTSMGGSASNQLQNIFSSKNAYWYAAGSLSEPIFDGG 385

Query: 339 KIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMS 398
           +I+SN   +++  QE  + +++T+L A+KEV N+L +  E ++   +    V     ++ 
Sbjct: 386 RIRSNYHYSQAQQQEMLLEYRKTILTALKEVSNSLVAYKETRERRAEQTALVVSATDAVR 445

Query: 399 LSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           L+ + Y  G  S L++L  +      ++ L++++ Q A S V LY A+G G+ 
Sbjct: 446 LARLRYSGGNTSYLEVLTNDTNLYDAQLQLALSQEQEAVSLVQLYAALGGGWQ 498


>gi|319641471|ref|ZP_07996162.1| outer membrane protein oprM [Bacteroides sp. 3_1_40A]
 gi|317386904|gb|EFV67792.1| outer membrane protein oprM [Bacteroides sp. 3_1_40A]
          Length = 457

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 116/461 (25%), Positives = 214/461 (46%), Gaps = 16/461 (3%)

Query: 1   MN-ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDT 59
           M   L  I    + LL  C +G  YT+P +  LP Q      ++ ++I  ++WWE + DT
Sbjct: 2   MKHTLLYIAVSGMTLLTSCQLGKHYTRPDL-HLPQQLDTLRQQDTLSIADMQWWEIYTDT 60

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST-- 117
           +L  L++  L  N  +  A  R+           A+LFP    S   +   +        
Sbjct: 61  TLQSLIEKTLDNNKDMKIAAARVKELAAMKRIDFANLFPQLNGSAYAQKEGSNYGGDNYK 120

Query: 118 ------GQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                 G+L   W++DL+G  R   + S+A    +       K++++S++  +Y +    
Sbjct: 121 NDPELGGKLTVTWELDLWGNLRWAKDKSIAQFLGSIEAQRALKMSIVSEVAQAYFELVAL 180

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
              ++I  Q L   K+ + L+ L+F  G TS+ S  + + E     + +P LE+   +  
Sbjct: 181 DNELNIVRQTLYARKEGVRLAKLRFEGGLTSETSYQQAQVEYARTATLVPELERKISLKE 240

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           ++I+ L G       H +Q+     +  L   + +G+P+ L+  RPD+R  E+KL  + A
Sbjct: 241 NDIAFLAGEYP----HRIQRSILPEEVKLPETLPVGLPSTLLERRPDVREAEQKLIAANA 296

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNSFPGYN-THWSFGPKLYLPIFDKGKIKSNIRRAES 349
            +GIA ++++P LSL     +  +     +          L  P+F  GK ++ ++  ++
Sbjct: 297 SVGIAYTNMFPRLSLTAQYGVESEEFSDFFKSPIHYISGNLLTPLFAMGKYRATLKAKKA 356

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
           + +++  +++++VL A KE  NA+   N+ K I           K +M L+ + Y  G  
Sbjct: 357 AYEQECYSYEKSVLTAFKEARNAIVDFNKIKDIYESRLQLERSSKATMELAQLQYINGVI 416

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             LD+LD +R+    ++ LS A R    + V LY A+G G+
Sbjct: 417 GYLDVLDAQRSYFDAQIGLSNAIRDKQITLVKLYKALGGGW 457


>gi|152981001|ref|YP_001354628.1| drug efflux lipoprotein [Janthinobacterium sp. Marseille]
 gi|151281078|gb|ABR89488.1| drug efflux lipoprotein [Janthinobacterium sp. Marseille]
          Length = 481

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 110/466 (23%), Positives = 207/466 (44%), Gaps = 22/466 (4%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQ-FSIGNSKNLINIDTLKWWESFNDT 59
           M  +  +  L   +L+ C++ P+Y +P  P+            N +    + W   F D 
Sbjct: 1   MKTI-TLALLAAGVLSACSMAPKYVRPDAPVAADYGVPSKADNNQVRAVDIGWRNFFTDP 59

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL------- 112
            L  L+  A+  N  +  A  RI  A+       ADL P+   + +              
Sbjct: 60  RLQVLIGNAIANNRDLRVAALRIEEARALYNIQSADLLPTLNVNATGSRARVPASISNTG 119

Query: 113 -----KTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYID 166
                     G   + +++D FG+ R + +++LA   S       A+++++S++  +Y+ 
Sbjct: 120 SSVVSSNYQVGLGLAAFELDFFGRVRSLSDAALAAYLSTEEAQRAAQISLVSEVAKAYLS 179

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
            R F E+  +A Q  +   +  +LS  +F  GA+S L L   EA +++  +     ++  
Sbjct: 180 ERSFAEQQDLARQTYESRVEAYKLSKQRFEVGASSALDLRNDEALLQTARAAELLAQRQR 239

Query: 227 RMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLA 286
              ++ ++ L+G P T+        S     ++      G+P+DL+  RPDIR  E+ L 
Sbjct: 240 AQAMNALTLLVGQPLTDLPPAQALSSQTILTDIP----AGLPSDLLTQRPDIRSAEQTLL 295

Query: 287 DSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSN 343
            + A IG A++  +P +SL   +  + +     F G +  WSF P+L LPIFD G+ + N
Sbjct: 296 SANANIGAARAAFFPRISLTAGLGTSSNELAGLFEGGSRSWSFAPQLVLPIFDAGRNRGN 355

Query: 344 IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
           +  AE         +++++  A +EV +AL + +   + V   +   E   +    +   
Sbjct: 356 LNLAEVRKDIAVANYEKSIQVAFREVSDALVARDLLDQQVEAQRLVQEAQAERFKFATQR 415

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           ++ G  S LD+LD +R     ++ L   +     + VDLY ++G G
Sbjct: 416 FQNGIASSLDVLDAQRELFTAQLSLVQVRLTRLTNAVDLYRSLGGG 461


>gi|212691876|ref|ZP_03300004.1| hypothetical protein BACDOR_01371 [Bacteroides dorei DSM 17855]
 gi|237708081|ref|ZP_04538562.1| outer membrane protein oprM [Bacteroides sp. 9_1_42FAA]
 gi|212665548|gb|EEB26120.1| hypothetical protein BACDOR_01371 [Bacteroides dorei DSM 17855]
 gi|229457909|gb|EEO63630.1| outer membrane protein oprM [Bacteroides sp. 9_1_42FAA]
          Length = 457

 Score =  201 bits (511), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 115/461 (24%), Positives = 214/461 (46%), Gaps = 16/461 (3%)

Query: 1   MN-ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDT 59
           M   L  I    + LL  C +G  YT+P +  LP Q      ++ ++I  ++WWE + DT
Sbjct: 2   MKHTLLYIAVSGMTLLTSCQLGKHYTRPDL-HLPQQLDTLRQQDTLSIADMQWWEIYTDT 60

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST-- 117
           +L  L++  L  N  +  A  R+           A+LFP        +   +    +   
Sbjct: 61  TLQSLIEKTLDNNKDMKIAAARVKELAAMKRIDFANLFPQLNGGAYAQKEGSNYGGNNYK 120

Query: 118 ------GQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                 G+L   W++DL+G  R   + S+A    +       K++++S++  +Y +    
Sbjct: 121 NDPELGGKLTVTWELDLWGNLRWAKDKSIAQFLGSIEAQRALKMSIVSEVAQAYFELVAL 180

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
              ++I  Q L   K+ + L+ L+F  G TS+ S  + + E     + +P LE+   +  
Sbjct: 181 DNELNIVRQTLYARKEGVRLAKLRFEGGLTSETSYQQAQVEYARTATLVPELERKISLKE 240

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           ++I+ L G       H +Q+     +  L   + +G+P+ L+  RPD+R  E+KL  + A
Sbjct: 241 NDIAFLAGEYP----HRIQRSILPEEVKLPETLPVGLPSTLLERRPDVREAEQKLIAANA 296

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNSFPGYN-THWSFGPKLYLPIFDKGKIKSNIRRAES 349
            +GIA ++++P LSL     +  +     +          L  P+F  GK ++ ++  ++
Sbjct: 297 SVGIAYTNMFPRLSLTAQYGVESEEFSDFFKSPIHYISGNLLTPLFAMGKYRATLQAKKA 356

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
           + +++  +++++VL A KE  NA+   N+ K I           K +M L+ + Y  G  
Sbjct: 357 AYEQECYSYEKSVLTAFKEARNAIVDFNKIKDIYESRLQLERSSKATMELAQLQYINGVI 416

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             LD+LD +R+    ++ LS A R    + V LY A+G G+
Sbjct: 417 GYLDVLDAQRSYFDAQIGLSNAIRDKQITLVKLYKALGGGW 457


>gi|237800664|ref|ZP_04589125.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. oryzae str. 1_6]
 gi|331023523|gb|EGI03580.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. oryzae str. 1_6]
          Length = 487

 Score =  201 bits (511), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 111/470 (23%), Positives = 213/470 (45%), Gaps = 26/470 (5%)

Query: 3   ILRAI-FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL---KWWESFND 58
           ++R I   L IVLL+ C VGP+Y KP         +    +     D +    WWE + D
Sbjct: 14  LIRPIGLGLCIVLLSACAVGPDYQKPSAAAPVHFKAAAGWRAATPSDAMVKGAWWEVYGD 73

Query: 59  TSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN------- 111
             LN LV+     N T+ Q   +   A+  + S R   FP+   +               
Sbjct: 74  PQLNALVERLNTSNQTVAQYDAQYRQAQALVRSSRGAFFPTLDLTTGKTRSGQGTGTSNS 133

Query: 112 ------LKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSY 164
                 ++ +   QL   W+ D++G+ RR +E+  A+  ++ A +   +L++ S+L+ +Y
Sbjct: 134 GNSVSGIRNSYNAQLGVSWEADIWGKLRRGLEADTASAQASLADLAAMRLSLQSELVQNY 193

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           +  R   E+  +    ++ Y++++ L+  ++  G +   ++ + + ++KS ++D+  L  
Sbjct: 194 LQLRVIDEQKRLLESTVEAYQRSLNLTRNQYRAGISGSDAVAQAQTQLKSTQADLIDLAW 253

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
                 + I+ L+G    EF                     G+P+ L+  RPDI   E+ 
Sbjct: 254 QRAQFENAIAVLMGMAPAEFSLAATTSIPQLPQIPP-----GLPSQLLERRPDIAAAERS 308

Query: 285 LADSVAKIGIAKSDLYPSLSLNG---SIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIK 341
           +  + A IG+AK+  YP  +L+      + T  N     N  WS GP+L + +FD G+  
Sbjct: 309 VMAANANIGVAKAAYYPDFTLSMSGGYNSSTFANWISLPNRFWSVGPQLAMTLFDGGRRT 368

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           + + R+E+   +    +++TVLN  +EVEN L  +   ++     Q A+   + S+ L+ 
Sbjct: 369 AEVDRSEAVYDQTVAQYRQTVLNGFQEVENYLIQLKVYEQEAAVRQEALVSARDSLRLTS 428

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             Y+ G    LD+++++      E  +    +    + V L  A+G G++
Sbjct: 429 NQYKAGLIGYLDVVNVQATALSNERSVLSVLQSRLIASVQLIAALGGGWD 478


>gi|150006273|ref|YP_001301017.1| outer membrane protein oprM precursor [Bacteroides vulgatus ATCC
           8482]
 gi|149934697|gb|ABR41395.1| outer membrane protein oprM precursor [Bacteroides vulgatus ATCC
           8482]
          Length = 460

 Score =  201 bits (511), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 116/461 (25%), Positives = 213/461 (46%), Gaps = 16/461 (3%)

Query: 1   MN-ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDT 59
           M   L  I    + LL  C +G  YT+P +  LP Q      ++ ++I  ++WWE + DT
Sbjct: 5   MKHTLLYIAVSGMTLLTSCQLGKHYTRPDL-HLPQQLDTLRQQDTLSIADMQWWEIYTDT 63

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHR--------FIPN 111
           +L  L++  L  N  +  A  R+           A+LFP    S   +            
Sbjct: 64  TLQSLIEKTLDNNKDMKIAAARVKELAAMKRIDFANLFPQLNGSAYAQKEGSNYGGDNYK 123

Query: 112 LKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                 G+L   W++DL+G  R   + S+A    +       K++++S++  +Y +    
Sbjct: 124 NDPEQGGKLTVTWELDLWGNLRWAKDKSIAQFLGSIEAQRALKMSIVSEVAQAYFELVAL 183

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
              ++I  Q L   K+ + L+ L+F  G TS+ S  + + E     + +P LE+   +  
Sbjct: 184 DNELNIVRQTLYARKEGVRLAKLRFEGGLTSETSYQQAQVEYARTATLVPELERKISLKE 243

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           ++I+ L G       H +Q+     +  L   + +G+P+ L+  RPD+R  E+KL  + A
Sbjct: 244 NDIAFLAGEYP----HRIQRSILPEEVKLPETLPVGLPSTLLERRPDVREAEQKLIAANA 299

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNSFPGYN-THWSFGPKLYLPIFDKGKIKSNIRRAES 349
            +GIA ++++P LSL     +  +     +          L  P+F  GK ++ ++  ++
Sbjct: 300 SVGIAYTNIFPRLSLTAQYGVESEEFSDFFKSPIHYISGNLLTPLFAMGKYRATLKAKKA 359

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
           + +++  +++++VL A KE  NA+   N+ K I           K +M L+ + Y  G  
Sbjct: 360 AYEQECYSYEKSVLTAFKEARNAIVDFNKIKDIYESRLQLERSSKATMELAQLQYINGVI 419

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             LD+LD +R+    ++ LS A R    + V LY A+G G+
Sbjct: 420 GYLDVLDAQRSYFDAQIGLSNAIRDKQITLVKLYKALGGGW 460


>gi|298483503|ref|ZP_07001679.1| RND efflux system, outer membrane protein, NodT family [Bacteroides
           sp. D22]
 gi|295085123|emb|CBK66646.1| efflux transporter, outer membrane factor (OMF) lipoprotein, NodT
           family [Bacteroides xylanisolvens XB1A]
 gi|298270260|gb|EFI11845.1| RND efflux system, outer membrane protein, NodT family [Bacteroides
           sp. D22]
          Length = 459

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 106/459 (23%), Positives = 203/459 (44%), Gaps = 17/459 (3%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
             L     L   +L  C VG  Y +P + L     S+  +++ I+     W + + D +L
Sbjct: 4   KKLYIAILLLAGVLTSCKVGKSYVRPDLHLPD---SLERAQDSISFGDQDWRDIYTDATL 60

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF--------IPNLK 113
             L++ AL  N  +L A  R+           A L P     ++                
Sbjct: 61  RSLIERALDHNKDMLIAAARVKEMAAQKRISTAALLPDIKGKVTAERELENHGGDAFKRS 120

Query: 114 TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                Q    W++DL+G  R    +S+A    +       ++ +++++  +Y +      
Sbjct: 121 DTFEAQFLVSWELDLWGNLRWARSASIAEYLQSIEAQRALRMTIVAEVAQAYYELVALDT 180

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + I  Q L   ++ + L+ ++F  G TS+ S  + + E+    + +P LE+   +  ++
Sbjct: 181 ELDIVKQTLKAREEGVRLARIRFAGGLTSETSYRQAQVELARTATLVPDLERKISLKEND 240

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           I+ L G    +       Q  N    L     +G+P+ L+  RPDIR  E+KL  + AK+
Sbjct: 241 IAYLAGEYPNKIARSRLLQEFNSPETLP----VGLPSTLLERRPDIRQAEQKLIAANAKV 296

Query: 293 GIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYL-PIFDKGKIKSNIRRAESSA 351
           G+A ++++P L+L G       +      + ++      L PIF  GK ++ ++  +++ 
Sbjct: 297 GVAYTNMFPRLALTGGFGSESTSLSELLKSPYAVMEGALLTPIFGWGKNRAALKAKKAAY 356

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           + +  ++++ VL A KE  NA+ + N+ K++     +     K  M L+ + Y  G  + 
Sbjct: 357 EAEVHSYEKAVLEAFKETRNAIVNFNKIKEVYELRANLERSAKSYMDLAQLQYINGVINY 416

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           LD+LD +R     ++ LS A R    + V LY A+G G+
Sbjct: 417 LDVLDAQRGYFDAQIGLSNAIRDELIAVVQLYKALGGGW 455


>gi|157375420|ref|YP_001474020.1| outer membrane efflux protein [Shewanella sediminis HAW-EB3]
 gi|157317794|gb|ABV36892.1| outer membrane efflux protein [Shewanella sediminis HAW-EB3]
          Length = 501

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 115/457 (25%), Positives = 202/457 (44%), Gaps = 13/457 (2%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
                   LLAGC +GP+Y +P + L     +        NI   +W + + D  L  L+
Sbjct: 26  IALMGCTTLLAGCAMGPDYQQPELDLPGQYHNELQQGEGDNIGKTQWRDFYLDPQLQPLI 85

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI---------PNLKTNS 116
             AL QNL +     R+ AA++ I    A L+P                    P+ +   
Sbjct: 86  NHALAQNLDLEAMRSRLIAARQRITVTDAALYPKVGIDAYGERSLDSGLTNTEPSSEDEF 145

Query: 117 TGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERIS 175
                  W++D++G  R   E+  AN  SA   +++A +++IS +   Y +    ++R  
Sbjct: 146 NLSGVVSWELDIWGANRRRSEAEYANFLSAQESLNLATISLISDVASRYYEWLDIEQRYQ 205

Query: 176 IAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIST 235
           I+   + L KK ++L+ L+   G  S L + + E E +S +  +P L+       + +  
Sbjct: 206 ISTNTVALRKKELDLARLRKENGVISGLEVRQAEVEFQSAKVTLPDLDFERGEKANQLRI 265

Query: 236 LLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIA 295
           LLG          + +            N+G+P++++  RPD++  E+ L    AK+G+A
Sbjct: 266 LLGEFGYPLQLQTEAELRVEDALFPAQFNVGVPSEMLSQRPDVKAAEQALIAMNAKVGVA 325

Query: 296 KSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQ 352
           K+  +P  +++GS     D   N        WS    +  PIF+ G I +    A+  ++
Sbjct: 326 KTAFFPKFTISGSFGRESDELSNLLDSEGVTWSLLGGITAPIFNAGSISAQYEIAKEESK 385

Query: 353 EQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLL 412
           +  + ++ TVL A  EV +A+ S    +  +   Q  V    +   L+ + YR G  S L
Sbjct: 386 QALLAYRNTVLRAYFEVNDAMNSFRRSELAINAQQELVAASSEYNRLAGLRYRNGVASSL 445

Query: 413 DILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           D++D +R     ++ LS  KR    S + LY A+G G
Sbjct: 446 DLMDAQRKLFSAQLALSQIKRDRLLSMITLYRALGGG 482


>gi|194335297|ref|YP_002017091.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Pelodictyon phaeoclathratiforme BU-1]
 gi|194307774|gb|ACF42474.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Pelodictyon phaeoclathratiforme BU-1]
          Length = 469

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 103/472 (21%), Positives = 206/472 (43%), Gaps = 24/472 (5%)

Query: 1   MNILRAI-FSLFIVLLAGCTVGPEYTKPHMPLL---PTQFSIGNSKNLINIDTLKWWESF 56
           MN    I   L    L  C++ P Y +P  P+    P   +   S    +   + W   F
Sbjct: 1   MNTKLLIPLCLAATTLTACSLAPTYVRPTAPVTKEWPVASAAPQSVEESHTADIGWRSMF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP------ 110
               L  L++ +L  N  +  A   I AA+      R+DL PS  +S ++          
Sbjct: 61  RSPKLQSLIEASLANNRDLRIAALNIEAARHTWRIQRSDLLPSINSSGNYTRQQLSTSMS 120

Query: 111 ------NLKTNSTGQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPS 163
                    T S G   + +++DLFG+ R + +       +       A+ ++++++  +
Sbjct: 121 GTGKTEITSTYSAGIGTTAYELDLFGRVRSLSNRAINQYLATEEGRKAAQTSLVAEVANA 180

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+      E + +    L   +   +L    F  GA S+L + +    ++S  +     +
Sbjct: 181 YLTYLADVELLRLTESTLKTRQDACDLIKRSFDLGAKSRLDVAQSATLVESARASRAQYQ 240

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    + + ++ L+G      L   Q  ++     +   + +GIP+ ++ +RPD+R  E 
Sbjct: 241 RHVEQDKNALTLLVGKEIDPTLLEPQPLADV---EVMERLPVGIPSVVLLDRPDVRQAEY 297

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTH----WSFGPKLYLPIFDKGK 339
            L    A IG A++  +PS+SL GS      +    +       WSF P++ LPIF  G+
Sbjct: 298 ALKAENANIGAARASFFPSISLTGSAGFASASLSDLFEAGSSGVWSFAPQVTLPIFQGGR 357

Query: 340 IKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSL 399
           ++SN++ AE++       +++ + +A +EV +AL +     + +   Q  V+   ++ ++
Sbjct: 358 LRSNLKLAETNRDIAVTRYEKAIQSAFREVADALVARATYTEQLQAQQALVKESDQACTI 417

Query: 400 SMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +   Y  G  S   +LD +R+  + + +  +  +Q   + +DLY A+G G+ 
Sbjct: 418 TKARYDHGIDSSFALLDAQRSLFEAQQNEILIHQQTLANLIDLYKALGGGWQ 469


>gi|295690919|ref|YP_003594612.1| NodT family RND efflux system outer membrane lipoprotein
           [Caulobacter segnis ATCC 21756]
 gi|295432822|gb|ADG11994.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Caulobacter segnis ATCC 21756]
          Length = 467

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 108/466 (23%), Positives = 196/466 (42%), Gaps = 20/466 (4%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSI-GNSKNLINIDTLKWWESFNDT 59
           M     +  L    ++ CT+ P+Y +P +P+  T  +        +    L W +   D 
Sbjct: 1   MFRNLTLILLASTAVSACTLAPKYERPVLPVAQTWSTPKAEPAGQVTAADLDWRQVLVDP 60

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL------- 112
            L  +V +AL+QN  +  A   I  A+      RA+LFP+   ++S              
Sbjct: 61  RLQGVVDLALKQNRDLRVAVLNIEKARATYGVQRANLFPAIDGALSGNRSRTPAGVSQTG 120

Query: 113 -----KTNSTGQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYID 166
                +T S     + +++DLFG+ R +      +  +        ++++I++   +++ 
Sbjct: 121 QAIETETYSATIGFTAYELDLFGRVRSLNQQALQSFFATEETARSTRISLIAETANAWLT 180

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
               ++R+++A   L   ++++ L+  +   G  S L L   E   +S  SDI T     
Sbjct: 181 LAADQDRLALARNTLAAREESLALTRRQVDGGVGSLLDLRNAETLAESARSDIATYTAQV 240

Query: 227 RMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLA 286
             + + +  L G    E    +          +   +  G+P+D++  RPD+   E  L 
Sbjct: 241 AQDRNALVLLAG---GEVPAELLPSGQVETAKILADLPAGLPSDVLARRPDVLSAEHSLQ 297

Query: 287 DSVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSN 343
            + A IG A++  +P +SL GS   T    ++ F      WSF P++ LPIF  G   + 
Sbjct: 298 GANANIGAARAAFFPRISLTGSTGATSGDLNDLFKNGTGSWSFTPQISLPIFAGGANVAG 357

Query: 344 IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
           +  A++S      T+++TV  A +EV +AL+        +   +  V     S  LS   
Sbjct: 358 LDSAKASRDIAVATYEKTVQTAFREVSDALSVRQTVSDRLAAQERLVAAAADSERLSRQR 417

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
              G  S L +LD +R     +  L  A+   A + V LY  +G G
Sbjct: 418 RDAGVDSALTLLDSQRTLYSAQQGLITARLDRATNLVTLYKTLGGG 463


>gi|294776525|ref|ZP_06741999.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [Bacteroides vulgatus PC510]
 gi|294449654|gb|EFG18180.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [Bacteroides vulgatus PC510]
          Length = 457

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 116/461 (25%), Positives = 213/461 (46%), Gaps = 16/461 (3%)

Query: 1   MN-ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDT 59
           M   L  I    + LL  C +G  YT+P +  LP Q      ++ ++I  ++WWE + DT
Sbjct: 2   MKHTLLYIAVSGMTLLTSCQLGKHYTRPDL-HLPQQLDTLRQQDTLSIADMQWWEIYTDT 60

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHR--------FIPN 111
           +L  L++  L  N  +  A  R+           A+LFP    S   +            
Sbjct: 61  TLQSLIEKTLDNNKDMKIAAARVKELAAMKRIDFANLFPQLNGSAYAQKEGSNYGGDNYK 120

Query: 112 LKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                 G+L   W++DL+G  R   + S+A    +       K++++S++  +Y +    
Sbjct: 121 NDPEQGGKLTVTWELDLWGNLRWAKDKSIAQFLGSIEAQRALKMSIVSEVAQAYFELVAL 180

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
              ++I  Q L   K+ + L+ L+F  G TS+ S  + + E     + +P LE+   +  
Sbjct: 181 DNELNIVRQTLYARKEGVRLAKLRFEGGLTSETSYQQAQVEYARTATLVPELERKISLKE 240

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           ++I+ L G       H +Q+     +  L   + +G+P+ L+  RPD+R  E+KL  + A
Sbjct: 241 NDIAFLAGEYP----HRIQRSILPEEVKLPETLPVGLPSTLLERRPDVREAEQKLIAANA 296

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNSFPGYN-THWSFGPKLYLPIFDKGKIKSNIRRAES 349
            +GIA ++++P LSL     +  +     +          L  P+F  GK ++ ++  ++
Sbjct: 297 SVGIAYTNIFPRLSLTAQYGVESEEFSDFFKSPIHYISGNLLTPLFAMGKYRATLKAKKA 356

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
           + +++  +++++VL A KE  NA+   N+ K I           K +M L+ + Y  G  
Sbjct: 357 AYEQECYSYEKSVLTAFKEARNAIVDFNKIKDIYESRLQLERSSKATMELAQLQYINGVI 416

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             LD+LD +R+    ++ LS A R    + V LY A+G G+
Sbjct: 417 GYLDVLDAQRSYFDAQIGLSNAIRDKQITLVKLYKALGGGW 457


>gi|237715963|ref|ZP_04546444.1| hydrophobe/amphiphile efflux-1 HAE1 [Bacteroides sp. D1]
 gi|262407576|ref|ZP_06084124.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|294645738|ref|ZP_06723424.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [Bacteroides ovatus SD CC 2a]
 gi|294808339|ref|ZP_06767094.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [Bacteroides xylanisolvens SD CC 1b]
 gi|229443610|gb|EEO49401.1| hydrophobe/amphiphile efflux-1 HAE1 [Bacteroides sp. D1]
 gi|262354384|gb|EEZ03476.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|292638944|gb|EFF57276.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [Bacteroides ovatus SD CC 2a]
 gi|294444415|gb|EFG13127.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [Bacteroides xylanisolvens SD CC 1b]
          Length = 459

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 106/459 (23%), Positives = 203/459 (44%), Gaps = 17/459 (3%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
             L     L   +L  C VG  Y +P + L     S+  +++ I+     W + + D +L
Sbjct: 4   KKLYIAILLLAGVLTSCKVGKSYVRPDLHLPD---SLERAQDSISFGDQDWRDIYTDATL 60

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF--------IPNLK 113
             L++ AL  N  +L A  R+           A L P     ++                
Sbjct: 61  RSLIERALDHNKDMLIAAARVKEMAAQKRISTAALLPDIKGKVTAERELENHGGDAFKRS 120

Query: 114 TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                Q    W++DL+G  R    +S+A    +       ++ +++++  +Y +      
Sbjct: 121 ETFEAQFLVSWELDLWGNLRWARSASIAEYLQSIEAQRALRMTIVAEVAQAYYELVALDT 180

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + I  Q L   ++ + L+ ++F  G TS+ S  + + E+    + +P LE+   +  ++
Sbjct: 181 ELDIVKQTLKAREEGVRLARIRFAGGLTSETSYRQAQVELARTATLVPDLERKISLKEND 240

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           I+ L G    +       Q  N    L     +G+P+ L+  RPDIR  E+KL  + AK+
Sbjct: 241 IAYLAGEYPNKIARSRLLQEFNSPETLP----VGLPSTLLERRPDIRQAEQKLIAANAKV 296

Query: 293 GIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYL-PIFDKGKIKSNIRRAESSA 351
           G+A ++++P L+L G       +      + ++      L PIF  GK ++ ++  +++ 
Sbjct: 297 GVAYTNMFPRLALTGGFGSESTSLSELLKSPYAVMEGALLTPIFGWGKNRAALKAKKAAY 356

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           + +  ++++ VL A KE  NA+ + N+ K++     +     K  M L+ + Y  G  + 
Sbjct: 357 EAEVHSYEKAVLEAFKETRNAIVNFNKIKEVYELRANLERSAKSYMDLAQLQYINGVINY 416

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           LD+LD +R     ++ LS A R    + V LY A+G G+
Sbjct: 417 LDVLDAQRGYFDAQIGLSNAIRDELIAVVQLYKALGGGW 455


>gi|116748894|ref|YP_845581.1| RND efflux system outer membrane lipoprotein [Syntrophobacter
           fumaroxidans MPOB]
 gi|116697958|gb|ABK17146.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Syntrophobacter fumaroxidans MPOB]
          Length = 480

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 100/461 (21%), Positives = 198/461 (42%), Gaps = 20/461 (4%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
            +  L +   +GC +GP Y +P +       S        ++  L WW  F D +L KL+
Sbjct: 9   ILAVLLVSFASGCALGPNYKRPAVSAPENFRSALTPAEQASLADLPWWTIFQDETLQKLI 68

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL----- 120
             AL+ N  +  A  R+  A++     R+  FP      +     N    S         
Sbjct: 69  TEALENNYDLRVAVTRVEQARQIAAQARSLFFPQIGYDGAVATGRNSFLTSPSPNGGQTT 128

Query: 121 -------DSDWKIDLFGQRRHIESS-LANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                     W++DL+G+ R +     A   +         ++++S +  +Y +      
Sbjct: 129 DSALLDLSVFWEVDLWGRIRRLNEEARAQFLATDEARRGVVVSLVSSVAQAYFELLELDL 188

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + IA +    ++  + L   +   G  SKL     E  + ++ +++P LE+   +  + 
Sbjct: 189 ELEIARRNTKSFEDTLTLFSRRLEYGVASKLETSSAEGLLGTVAANVPELERQIVIKENQ 248

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           I+ LLG         +++ ++         I  G+P+ L+  RPDIR  E+ L  + A++
Sbjct: 249 INVLLGRNPG----PVERNADLLDQESPPEIPAGLPSALLERRPDIRQAEQNLRAANARV 304

Query: 293 GIAKSDLYPSLSLNGSIALTHDNSFPGYNTH---WSFGPKLYLPIFDKGKIKSNIRRAES 349
           G+A ++ +P + L   +                 W+    +  PIF  G + +  R+A++
Sbjct: 305 GVAVTNFFPQIGLTTLLGKVSPELSAFSAGTANLWAVAGTMTGPIFRGGALVAEYRQAKA 364

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
           + +E  +T+++T LNA KEV NAL S  + +    +   +V+ + +++ +S+  Y  G+ 
Sbjct: 365 AWEEARLTYEQTALNAFKEVSNALISREKLELARAQQSRSVKAYDQAVGVSLKRYVAGKA 424

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S  ++L  ++     E  L+  +     + V LY A+G G+
Sbjct: 425 SYYEVLQNQQNLFPAETTLARTQLNQLLAVVQLYKALGGGW 465


>gi|237809204|ref|YP_002893644.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Tolumonas auensis DSM 9187]
 gi|237501465|gb|ACQ94058.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Tolumonas auensis DSM 9187]
          Length = 495

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 110/466 (23%), Positives = 212/466 (45%), Gaps = 22/466 (4%)

Query: 2   NILRAIFSLFIVLLAGC-TVGPEYTKPHMPLLPTQF-SIGNSKNLINIDTLKWWESFNDT 59
            +  A  +L  V+L GC ++ P    P +P+       + +S    +   L W   F D 
Sbjct: 12  KLRTASLALSAVVLTGCMSLAPAPDTPPLPVPEVWPGHLESSTEGAHAGELAWQAYFTDP 71

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQ 119
            L +L++ AL+ N  +  A  R+  A       R+D FP+                +   
Sbjct: 72  LLQRLIETALENNRDLRLAALRVEEASAAFRIQRSDRFPAVGVGAQGGRARVPGDLNMSG 131

Query: 120 LD------------SDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYID 166
                         S W++DL+G+ R++ +++L    ++ A      L +I+++   Y+ 
Sbjct: 132 RSQVGGEYRAEVGLSTWELDLWGRVRNLEDAALQRWLASDAARQAVHLALIAQVADGYLG 191

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
            R   ER++IA Q +   +++  +   +   G+TSKL L +++  +   ++ +  LE++ 
Sbjct: 192 LREIDERVAIARQTVATREESYRIFRRRVEVGSTSKLDLTQVQTLLNQAQALLTQLEQAR 251

Query: 227 RMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLA 286
              +H ++ L+G         +  ++   +  +   +  G+P++L+ +RPDI   E +L 
Sbjct: 252 ATQLHALALLVGADPG----PLPTKAPFDETTVLAELRTGLPSELLVSRPDIIAAEHQLR 307

Query: 287 DSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSN 343
              A IG A++   P ++L GS      +    F   +  W+F P L LPIFD G+ ++N
Sbjct: 308 AGDANIGAARAAFLPRIALTGSFGTASSDLDGLFDSGSRAWTFMPTLSLPIFDGGRRRAN 367

Query: 344 IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
           +  +E         +++T+  A +EV +AL++     + +T  +  +E   +   L+ + 
Sbjct: 368 LELSEVRRDIAVAGYEKTIQTAFREVADALSAKYWLAEQLTIQRANLEAQSERARLAQLR 427

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           Y  G  + L++LD +R        L  A+R L  S V LY A+G G
Sbjct: 428 YDNGSAAFLEVLDAQRDLLDAGQQLVQARRALLSSQVALYAALGGG 473


>gi|154491095|ref|ZP_02031036.1| hypothetical protein PARMER_01017 [Parabacteroides merdae ATCC
           43184]
 gi|154088515|gb|EDN87559.1| hypothetical protein PARMER_01017 [Parabacteroides merdae ATCC
           43184]
          Length = 456

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 110/462 (23%), Positives = 220/462 (47%), Gaps = 19/462 (4%)

Query: 1   MNILRAIFSLFIVLLA--GCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFND 58
           M     IF +  + LA   C +G +Y +P + L      I    +  +ID++ W   + D
Sbjct: 1   MKRNIYIFIVLSLALALPSCKIGKKYARPELDLPE---EIVAGADTASIDSISWQSLYVD 57

Query: 59  TSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHR--------FIP 110
           T+L +L+ IAL  N  +  A  ++     +     AD FP   A I  +          P
Sbjct: 58  TTLQRLITIALDNNKDMKIAVAKVKEMIASKRITFADQFPEIGARIYGQKERLNYGGDNP 117

Query: 111 NLKTNSTGQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
              +    +L   W++DL+G  R    + +A    +       ++ +++++  +Y +   
Sbjct: 118 KPDSEYGAKLALSWELDLWGNLRWANEAGIAAYLQSVEARHALQMTLVAEVAAAYYELCA 177

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
             +   I    L   ++ + L+ L+F  G TS+ S  + + E+   E+ +P+LE+  ++ 
Sbjct: 178 LDQEQDIVRHTLAARREGVRLAKLRFEGGLTSETSYSQAQVELARTETLLPSLEQKIKIK 237

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            ++++ LLG  + +    +  +  +    L     +G+P+ L+  RPD+R  E+KL ++ 
Sbjct: 238 ENDLAFLLGQYSGDIPRGLPLREQHLLETLP----VGLPSSLLERRPDMRQAEQKLREAN 293

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHDNSFPG-YNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
           A +G+A++DL+P +SL G++   ++       +  W     L  P+F  GK K+ ++ A 
Sbjct: 294 AGVGVAQTDLFPKISLTGNLGFENEELTNFIKSPAWFLAGDLLQPLFAMGKNKAKLKAAR 353

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           +  +++   +Q++VL+  KEV NA+ +I + K++    +  +      + L+ + Y  G 
Sbjct: 354 ARYEQEVYNYQKSVLSVFKEVNNAIVTIRKAKEVRMSYEKLLNAADTYLQLAQLQYINGV 413

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            S +D+LD +R     ++ L+ A      S V LY A+G G+
Sbjct: 414 TSYMDVLDAQRGLLDAQLSLNKAMLDELLSTVYLYKALGGGW 455


>gi|21243569|ref|NP_643151.1| outer membrane protein [Xanthomonas axonopodis pv. citri str. 306]
 gi|21109137|gb|AAM37687.1| outer membrane protein [Xanthomonas axonopodis pv. citri str. 306]
          Length = 503

 Score =  201 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 106/485 (21%), Positives = 207/485 (42%), Gaps = 36/485 (7%)

Query: 1   MNILRAIFSLF--IVLLAGCTVGPEYTKPHMPLLPTQFS----------------IGNSK 42
           M  +R          +L+GCT+ P YT+P  P +P QF+                 GN+ 
Sbjct: 1   MTTIRTTLCALGVASVLSGCTLMPRYTRPDAP-VPAQFAGTDVSVAPPAAAATADTGNNA 59

Query: 43  NLINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYA 102
           +   I  + W + F D +L +++ +AL  N  +  A   I  A+      RA L P+   
Sbjct: 60  DTAYIADIGWRQVFTDPTLQQVIALALDNNRDLRVAALNIEVARAQYRVDRAALLPAIDG 119

Query: 103 SISHRFIPNLK------------TNSTGQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQV 149
           + +                    T S     S +++DLFG+ R ++        S     
Sbjct: 120 TGTANNARTPSELAIPGQPQVFRTYSANIGISAYELDLFGRVRSLKEQALQQFLSTAEAR 179

Query: 150 DIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLE 209
               +++++++  +Y+     ++ + +A   L     +  L    F  G  S+L+L + +
Sbjct: 180 RSTHISLVAEVATAYLTLAADQQLLQLAQSTLTSQSDSYRLQQRSFELGVASQLTLRQAQ 239

Query: 210 AEIKSIESDIPTLEKSFRMNVHNISTLLGYP-ATEFLHYMQKQSNNFQPNLYIPINIGIP 268
             +++   D+         + + +  L+G     E L +    + + + N+   +  G+P
Sbjct: 240 TTVETARVDVERYTAQVAQDRNALVLLVGTQVPVELLPHALPDNASVEGNVLASVPAGLP 299

Query: 269 ADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYP---SLSLNGSIALTHDNSFPGYNTHWS 325
           + L++ RPDI   E+ L  + A IG A++  +P     +  GS + +    F      WS
Sbjct: 300 SQLLQRRPDILEAERNLRAANANIGAARAAFFPSISLTASTGSSSSSLSRLFDAGTRAWS 359

Query: 326 FGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTK 385
           F P L LPIF+ G+ ++N+  A+++   +   +++++ +A +EV +AL   +   + +  
Sbjct: 360 FVPTLTLPIFNAGRNRANLDMAKANRDIEVARYEKSIQSAFREVSDALAQRDTLGRQLQA 419

Query: 386 LQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIA 445
            Q  V+    S  LS   + +G  S L  LD +R+    +  L   +     + V  Y A
Sbjct: 420 QQALVDATADSYRLSQARFERGIDSYLQALDAQRSLYSAQQTLINTQLSRFTNLVTFYKA 479

Query: 446 IGSGY 450
           +G G+
Sbjct: 480 MGGGW 484


>gi|271501228|ref|YP_003334253.1| RND efflux system outer membrane lipoprotein [Dickeya dadantii
           Ech586]
 gi|270344783|gb|ACZ77548.1| RND efflux system, outer membrane lipoprotein, NodT family [Dickeya
           dadantii Ech586]
          Length = 465

 Score =  201 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 101/466 (21%), Positives = 204/466 (43%), Gaps = 23/466 (4%)

Query: 4   LRAIFSLF--IVLLAGCTVGPEYTKPHMPLLPTQFSIG----NSKNLINIDTLKWWESFN 57
           +R I  +    +LL+GC++ P Y +P  P+             ++     + + W E   
Sbjct: 1   MRVIMMVLGGSLLLSGCSLDPHYQRPSAPVPAAWPQGASYPATAQAPQPAEDIPWREVVV 60

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL----- 112
           D  L ++V++AL  N  + +A   + AA+  +   RA L P+  A ++     +L     
Sbjct: 61  DDKLRQVVEMALSDNRDLRKAIADVEAARAQLGEQRATLLPTINAGMNGDRSRSLISGSD 120

Query: 113 -----KTNSTGQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYID 166
                 +       S + +DLFG+ R +  ++     S+ A     +L +I+    +++ 
Sbjct: 121 STVLSSSYGASLSTSAFTLDLFGKNRSLTGAAREAYLSSAATATSTRLTLIADTATAWVA 180

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
               +  +++A Q ++   +++ ++  +   G  S + + + E   +   +D+ +   + 
Sbjct: 181 LATARSNLALARQTMESAGQSLAVTRSRLRNGVVSAVDVAQAETVYQQARADVASALTTE 240

Query: 227 RMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLA 286
             + + +  L G    E L      S +       P+  GI + ++  RPD++  E  L 
Sbjct: 241 AQDKNALDLLAGRSVPEALLPTDVASLS---QAVKPVAAGISSAVLLRRPDVQAAEHTLK 297

Query: 287 DSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSN 343
            + A IG A++  +PS++L  S  L+ +   + F G    WS  P + LP+FD G   S 
Sbjct: 298 SANANIGAARAAFFPSITLTASNGLSSEALSSLFSGGAHVWSLAPSVSLPLFDGGSNLSA 357

Query: 344 IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
           +R AE+  Q    ++++TV  A +EV +AL       +     +  V   ++S  L+   
Sbjct: 358 LRYAEAEKQGYVASYEKTVQTAFREVADALARKGTIDEQQAAQRDYVTAAERSYQLASNR 417

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           Y+ G  + L++LD +R        L   ++    + + LY  +G G
Sbjct: 418 YQAGVDTYLNVLDAQRTLYSARQSLFSLEQSRLDNLITLYNVLGGG 463


>gi|114332123|ref|YP_748345.1| RND efflux system, outer membrane lipoprotein, NodT family protein
           [Nitrosomonas eutropha C91]
 gi|114309137|gb|ABI60380.1| RND efflux system, outer membrane lipoprotein, NodT family protein
           [Nitrosomonas eutropha C91]
          Length = 464

 Score =  201 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 110/451 (24%), Positives = 206/451 (45%), Gaps = 19/451 (4%)

Query: 13  VLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQN 72
           +L+  C +GP+Y++P +     +F +  ++   +I  L WWE   D  L  L+  AL +N
Sbjct: 1   MLITSCAMGPDYSRPQIDTT-EKFRLSQTEGR-SIANLPWWELLRDEKLQLLIDQALTEN 58

Query: 73  LTILQATERINAAKENILSVRADLFPSSY---------ASISHRFIPNLKTNSTGQLDSD 123
             + QA   +   +  +   + D  P+                R       N  GQ   +
Sbjct: 59  KDLKQAAASVEELQARLGITQMDFIPNITIDGNAPIETLGGFSRKGFPTPYNYFGQTILN 118

Query: 124 WKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILD 182
           W++D++G+ R    ++ A+L +         L ++S +  SY D   F  ++ IAH  L 
Sbjct: 119 WELDIWGRIRRSNEAARADLLAREENRRAVVLTLVSSVAQSYFDLLQFDTQLKIAHHALT 178

Query: 183 LYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPAT 242
            +++++ +S  +   G T++L L + EAE  +  + +  LE+      + +S L G    
Sbjct: 179 SWEESVAISSAQLEGGLTTRLDLDQFEAERAAAAAQVAELERQIAQKENELSVLAGRTPA 238

Query: 243 EFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPS 302
                      +  P++      G+P++L++ RPDI   E+ L  ++A+IG+AK+  +P 
Sbjct: 239 PVARGYSLSGQSTPPDIPP----GLPSELLQRRPDILQAEQTLKAAIARIGVAKATRFPR 294

Query: 303 LSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQ 359
           ++L G    +     +     +   + G  L  P+ +   +    R AE+ A++    ++
Sbjct: 295 ITLTGFFGFSSPALASLLDSDSKFGAAGFGLAGPLLNAQTLGYEQRAAEAQAKQALAQYE 354

Query: 360 ETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIER 419
           +T+L A KEVE+AL +I          Q  VE    ++ ++ + Y+ G  S +D+L  +R
Sbjct: 355 QTILVAFKEVEDALAAIRTANDQYKAKQKQVEALSSALQIANLRYQGGITSYVDVLLTKR 414

Query: 420 ATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
                E  L IA+     S V LY A+G G+
Sbjct: 415 KLFDAESALVIARHLHLVSVVQLYKALGGGW 445


>gi|300718172|ref|YP_003742975.1| RND efflux system, outer membrane protein [Erwinia billingiae
           Eb661]
 gi|299064008|emb|CAX61128.1| RND efflux system, outer membrane protein [Erwinia billingiae
           Eb661]
          Length = 470

 Score =  201 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 109/466 (23%), Positives = 214/466 (45%), Gaps = 22/466 (4%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLN 62
            L A+    +++L+GCT+ P Y +P +P+       G  +   N   + W   F D  +N
Sbjct: 7   TLAALPMAMMLVLSGCTMEPTYQRPALPVAADYGQQGKDRAG-NGADISWQNFFTDPVMN 65

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS------ 116
           KL+ ++L+ N  +  A   ++ A+  +   RA L PS   S S                 
Sbjct: 66  KLIALSLENNRDLRVAALNVDVARSQVQIDRAALLPSVDLSASQTAAHLPGNLYNTASTG 125

Query: 117 --------TGQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
                   T    + W++D FG+ R +   +L +  +  A     ++++IS++   Y+  
Sbjct: 126 PVTYHELNTSLGVTAWELDFFGRLRSLRDQTLESYLATAATQRATQISLISEVASGYLSL 185

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
               E + +A   +   + +  L+      G +S+  LV+ E  +++ ++D+ +  +  R
Sbjct: 186 CADNELLKLAMDTVKSQQDSYNLTKRSVDGGVSSEQDLVQAETSVRTAQADVASYTRQVR 245

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
            +V+ ++ L+G      +    + + N+          G+P+DL+  RPDI   E +L  
Sbjct: 246 QDVNALALLVGTNLPSDMLANARLNKNWHFPATP---SGLPSDLLTRRPDIIAAEHELKA 302

Query: 288 SVAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNI 344
           + A IG A++  +PS+SL    GS + +  +   G    WSFGP + LPIFD G   +N+
Sbjct: 303 ANANIGAARAAFFPSISLTASGGSTSSSLGHLLEGGTAAWSFGPSINLPIFDGGVNSANL 362

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
             A    + +   +++++  A KEV +AL   +  K  +T  +   + ++++   + I Y
Sbjct: 363 DIAHLQKRIEIADYEKSIQTAFKEVGDALAGQDTYKDELTAREQDEQANQRNYDFAHIRY 422

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +QG  + L++L  +R+    +  L   +       + LY A+G G+
Sbjct: 423 QQGVDNYLNVLVAQRSLYAAQQSLITTQLGRLNQQITLYKALGGGW 468


>gi|291514058|emb|CBK63268.1| efflux transporter, outer membrane factor (OMF) lipoprotein, NodT
           family [Alistipes shahii WAL 8301]
          Length = 456

 Score =  201 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 90/455 (19%), Positives = 190/455 (41%), Gaps = 14/455 (3%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLN 62
           + + +       L GC +   YT+P +      +    + +   +  ++W E F D  L 
Sbjct: 1   MKKILIICAAAALTGCGIYKPYTRPEV-TTAGLYGSAETADTTTLGDIRWQEMFTDPQLQ 59

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTN----STG 118
            L+ +AL+ N  +L A  R+  A+  + S R    PS   +                 + 
Sbjct: 60  ALIALALENNTDLLSAGWRVKEAEATLKSARLAYLPSFNFAPQGSLSSFDGGPTAKTYSI 119

Query: 119 QLDSDWKIDLFGQRRHIESS-LANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIA 177
            + + W+ID+F    + +    A    +       K  +IS +   Y        +  + 
Sbjct: 120 PVTASWQIDIFNGLTNAKRKAKALYAQSKEYEQAVKTQLISGVANLYYTLLMLDSQYEVT 179

Query: 178 HQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLL 237
            +    +++++E        G  ++  + + EA   +IE+ +  L        +++ +LL
Sbjct: 180 EETAAKWRQSVEAMRALKEAGYANEAGVAQYEANTLAIEASLHDLGYQRTQAENSLCSLL 239

Query: 238 GYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKS 297
           G                    L   + +G+P  ++ NRPD+R  E  L  S      A+S
Sbjct: 240 GEVPHTIAR-----GRLENQQLPDDLTVGVPLLMLSNRPDVRSAEYSLMQSYYATASARS 294

Query: 298 DLYPSLSLNGSIALTHDN---SFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQ 354
            LYPS++L+G++  T+++           W+    L  PIF+    ++ ++ A++  +E 
Sbjct: 295 ALYPSITLSGTVGWTNNSGAGIVNPGKLIWNAAGSLLQPIFNANANRARVKIAKAQQEES 354

Query: 355 YITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDI 414
            +++Q+T+LNA  EV NALT     +      +  +E  ++++  + +  + G  + L++
Sbjct: 355 KLSFQQTLLNAGAEVNNALTQCQSARAKADLRERQIEALERAVESTELLMQHGSTTYLEV 414

Query: 415 LDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           L  +++    ++     +    +  V+LY A+G G
Sbjct: 415 LTAQQSLLSAQLSQIADRFDEIQGTVNLYQALGGG 449


>gi|218887252|ref|YP_002436573.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218758206|gb|ACL09105.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 489

 Score =  201 bits (509), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 115/452 (25%), Positives = 218/452 (48%), Gaps = 21/452 (4%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTIL 76
           GC+ GP++ +P M  LP  +  G +      D   WW+ F D +L+ LV  AL  N  + 
Sbjct: 13  GCSFGPDHARPAMD-LPDAWRPGTADTGTVQD--GWWKGFGDPALDALVASALDHNRDLA 69

Query: 77  QATERINAAKENILSVRADLFPSSYASISHRFIPNL-------------KTNSTGQLDSD 123
           +A   ++ A+  +   RA+  P   A  + +                  +          
Sbjct: 70  KAIANVDEARAQLGLARANQMPRVDAQGASQRQRYSLEGFNSFDESTRVQDLHNAGGVLS 129

Query: 124 WKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILD 182
           +++DL+G+ R   E++ A+L S  A  D  +L + +++  +Y D R + +++ +A   L 
Sbjct: 130 YEMDLWGRYRRASEAARADLLSTMAARDTVRLALTAQVARTYFDLRAYDQQLQVARDTLA 189

Query: 183 LYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPAT 242
             +   EL  ++F  G TS+L   +  AE  +  S + TL+ +   +   +  L G    
Sbjct: 190 SRESTQELRKVRFELGLTSELDYRQAIAEAAAARSTVHTLQYNVSASEAALGVLTGKSPR 249

Query: 243 EFLH-YMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYP 301
           + +   +++        +   +  G+P+ L+  RPDI   E++LA + A IG+AK+  +P
Sbjct: 250 DIVTGTVERGLAVDAVPVPPSVPAGLPSALLERRPDIVQAEQQLAAASANIGVAKAAYFP 309

Query: 302 SLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITW 358
           S+SL G +     +    F G    W +   + +PIFD G+IK+ +  AE+  +     +
Sbjct: 310 SISLTGLLGYESSDLTRLFTGPAGTWRYAGSVSMPIFDFGRIKAGVEAAEARQRAALAGY 369

Query: 359 QETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIE 418
           ++ V +A +E ++AL +  + + +V      V   ++S+ L+ + Y  G  S L++LD E
Sbjct: 370 EKAVQDAFREAQDALVANRKARGVVEAQTTQVTALRRSLHLAKLRYDNGYSSYLEVLDAE 429

Query: 419 RATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           R+   VE+ L+ A+R    + V++Y A+G G+
Sbjct: 430 RSLFDVEISLASAQRDQLVAVVEVYRALGGGW 461


>gi|317484531|ref|ZP_07943440.1| NodT family efflux transporter [Bilophila wadsworthia 3_1_6]
 gi|316924249|gb|EFV45426.1| NodT family efflux transporter [Bilophila wadsworthia 3_1_6]
          Length = 472

 Score =  201 bits (509), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 107/472 (22%), Positives = 203/472 (43%), Gaps = 26/472 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK-------WW 53
           M   + +     VLL GCT+ P Y +P  P+          K  +             W 
Sbjct: 1   MMSAKYMALALAVLLPGCTMAPNYVRPEAPVAEAWPDDLMPKGTVLAQATDQLASEIGWK 60

Query: 54  ESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF----- 108
             F D  L +L+++AL  N  +  +   I  A+      RADL P   AS          
Sbjct: 61  TFFTDQHLQRLIQLALDNNRDLRVSALNIERARGLYQIQRADLMPGVSASGESSNKGVSA 120

Query: 109 -------IPNLKTNSTGQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKL 160
                      + +S G   + +++D FG+ + ++                A+L+++S++
Sbjct: 121 DLSTTGEQTVSRQHSLGVGVTSYELDFFGRIQSLKDKALETYLGTEEAYRSARLSLVSEV 180

Query: 161 IPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIP 220
             +Y+     +ER++IA + L   + + E+   + + G +S+L L + +  + +   DI 
Sbjct: 181 AQAYLALVADRERLNIATETLKSQQASYEMIARRHSVGVSSELDLRQAQTSVDTARVDIA 240

Query: 221 TLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRY 280
                   ++  +S L G   T  +   +  S          I + +P+ ++  RPDI  
Sbjct: 241 RYSGQVAKDITALSLLAGTKVTPDMLPAKALSELPVW---PDIPVSLPSTVLLQRPDILQ 297

Query: 281 QEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDK 337
            E  L  + A IG A+++ +P +SL  +I    +   + F G    W+F P++ LPIF+ 
Sbjct: 298 AEHTLKAANADIGAARANFFPRISLTANIGTASNELSHLFDGGTGIWTFLPQVSLPIFEG 357

Query: 338 GKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSM 397
           G+  +N+R +E+  +     +++ + +A +EV +AL         +   +  V    ++ 
Sbjct: 358 GRNVANLRVSEADKKIAVANYEKAIQSAFREVSDALIDRVSLAGQLEAQKSLVHATSETY 417

Query: 398 SLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
            LS   Y QG  S L +LD +RA    +++L   +    ++ + LY A+G G
Sbjct: 418 RLSGERYNQGIDSYLAVLDSQRAMYSSQLNLISVRVAREQNLIMLYKALGGG 469


>gi|153807988|ref|ZP_01960656.1| hypothetical protein BACCAC_02274 [Bacteroides caccae ATCC 43185]
 gi|149129597|gb|EDM20811.1| hypothetical protein BACCAC_02274 [Bacteroides caccae ATCC 43185]
          Length = 457

 Score =  201 bits (509), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 107/459 (23%), Positives = 204/459 (44%), Gaps = 17/459 (3%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
             L     LF  +L  C VG  Y +P + L     S+   ++ ++     W + + D++L
Sbjct: 4   KKLYMAILLFAGILTSCKVGKSYVRPDLHLPD---SLAQHQDSVSFGDQDWKDIYADSTL 60

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF--------IPNLK 113
             L+  AL+ N  +L A  R+           A L P     ++                
Sbjct: 61  RSLIDRALEHNKDMLIAAARVKEMAAQKRISTAALLPDIKGKVTAERELENHGGDAFKKA 120

Query: 114 TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                Q    W++DL+G  R    +S+A    +       ++ +++++  +Y +      
Sbjct: 121 DTFEAQFLVSWELDLWGNLRWARSASIAEYLQSIEAQRALRMTIVAEVAQAYYELVALDT 180

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + I  Q L   ++ + L+ ++F  G TS+ S  + + E+    + +P LE+   +  ++
Sbjct: 181 ELDIVKQTLKAREEGVRLARIRFAGGLTSETSYRQAQVELARTATLVPDLERKISLKEND 240

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           I+ L G            Q  NF   L     +G+P+ L+  RPDIR  E+KL  + AK+
Sbjct: 241 IAFLAGEYPNRIARSRLLQEFNFPETLP----VGLPSTLLERRPDIRQAEQKLIAANAKV 296

Query: 293 GIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYL-PIFDKGKIKSNIRRAESSA 351
           G+A ++++P L+L G       +      + ++      L PIF  GK ++ ++  +++ 
Sbjct: 297 GVAYTNMFPRLALTGGFGTESTSLSELLKSPYAVMEGALLTPIFGWGKNRAALKAKKAAF 356

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           + +   ++++VL A KE  NA+ + N+ K++     +     K  M L+ + Y  G  + 
Sbjct: 357 EGEVHNYEKSVLTAFKETRNAIVNFNKIKEVYELRANLERSAKSYMDLAQLQYINGVINY 416

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           LD+LD +R     ++ LS A R    + V LY A+G G+
Sbjct: 417 LDVLDAQRGYFDAQIGLSNAIRDELIAVVQLYKALGGGW 455


>gi|207724533|ref|YP_002254930.1| outer membrane drug efflux lipoprotein [Ralstonia solanacearum
           MolK2]
 gi|206589755|emb|CAQ36716.1| outer membrane drug efflux lipoprotein [Ralstonia solanacearum
           MolK2]
          Length = 501

 Score =  201 bits (509), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 109/484 (22%), Positives = 204/484 (42%), Gaps = 34/484 (7%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQF-----------------SIGNSKN 43
           M  L         +LAGCT+ P Y +P  P+                      + G+++ 
Sbjct: 1   MTRLSPTVLALAAMLAGCTLMPTYQRPAAPVPAAFAGASDKSDASDTSRERGNTGGDARP 60

Query: 44  LINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYAS 103
              +  + W + F D SL +++ +AL  N  +  A   I  A+       A LFP+  AS
Sbjct: 61  AGPVADIGWHDVFTDPSLQRVIGMALANNRDLRVAVLNIEKARAQYRVQDAALFPTVKAS 120

Query: 104 ISHRFIPNLKTNSTGQL------------DSDWKIDLFGQRRHIESSL-ANLDSAYAQVD 150
            S          S                 S +++DLFG+ R + +       S      
Sbjct: 121 GSENASRTPAGLSATGQPLVAHSYSATLGFSAYELDLFGRVRSLSAQALEQYLSTVEARR 180

Query: 151 IAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEA 210
            +++++I+++  +Y+     ++ + +A   L        L+   +  G  S+L+L + + 
Sbjct: 181 SSQISLIAEVATAYLTLAADQDLLKLAQDTLSSQSDTYRLNQRSYELGTASRLTLRQSQT 240

Query: 211 EIKSIESDIPTLEKSFRMNVHNISTLLGYP-ATEFLHYMQKQSNNFQPNLYIPINIGIPA 269
            + S   D+         + + +  L+G    TE L      S+    ++   I  G+ +
Sbjct: 241 SVDSARVDVERYTAQVAQDRNALVLLVGADLPTELLPRSLPDSSAATGSVLATIPPGLTS 300

Query: 270 DLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSF 326
           DL++ RPDI   E  L  + A IG A++  +PS+SL  S   +  +    F G +  W+F
Sbjct: 301 DLLQRRPDILQAEHDLKAANANIGAARAAFFPSISLTASAGTSSASLAGLFKGGSGAWNF 360

Query: 327 GPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKL 386
           GP++ LPIFD G  ++N+  A +S       +++ +  A +EV +AL       + +   
Sbjct: 361 GPQIALPIFDGGANRANLDVANTSRDIAVAQYEKAIQTAFREVSDALAQRGTLGRQIEAQ 420

Query: 387 QHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAI 446
           Q  V+    S  L+   +++G  S L++LD +R+    + +L   +     + V  Y  +
Sbjct: 421 QSLVDATADSYQLATARFKRGVDSYLNVLDSQRSLYTAQQNLINTRLSRFTNLVTFYKTL 480

Query: 447 GSGY 450
           G G+
Sbjct: 481 GGGW 484


>gi|152973507|ref|YP_001338558.1| copper/silver efflux system outer membrane protein CusC [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|150958299|gb|ABR80328.1| putative outer membrane protein SilC [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 513

 Score =  201 bits (509), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 97/464 (20%), Positives = 208/464 (44%), Gaps = 19/464 (4%)

Query: 1   MNILRAIFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINI---DTLKWWESF 56
           M  L+ +    I +LAGC ++ PEY +P  P +P QFS+  +     +       W   F
Sbjct: 53  MFKLKLLSISTIFILAGCVSLAPEYQRPPAP-VPQQFSLSKNSLTPAVNSYQDTGWRNFF 111

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP------ 110
            D  +++L+  AL  N  +  A  ++  A+       AD +P   AS    +        
Sbjct: 112 VDPQVSRLIGEALNNNRDLRMAALKVEEARAQFNVTDADRYPQLNASSGITYNGGLKGDK 171

Query: 111 NLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                    L+  +++D FG+ +   E+   N  ++        + ++S +  SY   + 
Sbjct: 172 PTTQEYDAGLELSYELDFFGKLKNMSEADRQNYFASEEARRAVHILLVSNVSQSYFSQQL 231

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
             E++ IA + L  Y+++      +   G+T+ L+L +   +I+S  ++I   E      
Sbjct: 232 AYEQLRIARETLKNYEQSYAFVEQQLVTGSTNVLALEQARGQIESTRAEIAKREGDLAQA 291

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            + +  +LG     +     ++         + +   + + ++  RPDI   E +L  + 
Sbjct: 292 NNALQLVLG----TYRALPSEKGMKGGEIAPVKLPPNLSSQILLQRPDIMEAEYQLKAAD 347

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           A IG A++  +PS++L   ++ +     + F   +  W+F PK+ +PIF+ G+ K+N++ 
Sbjct: 348 ANIGAARAAFFPSITLTSGLSASSTELSSLFTSGSGMWNFIPKIEIPIFNAGRNKANLKL 407

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
           AE   Q+  + +++ + +A K+V + L   +   + +   Q  ++  + ++  +   Y  
Sbjct: 408 AEIRQQQSVVNYEQKIQSAFKDVSDTLALRDSLSQQLESQQRYLDSLQITLQRARGLYAS 467

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           G  S +++LD ER+    +  +         + ++L+ A+G G+
Sbjct: 468 GAVSYIEVLDAERSLFATQQTILDLTYSRQVNEINLFTALGGGW 511


>gi|325280866|ref|YP_004253408.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Odoribacter splanchnicus DSM 20712]
 gi|324312675|gb|ADY33228.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Odoribacter splanchnicus DSM 20712]
          Length = 451

 Score =  200 bits (508), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 105/454 (23%), Positives = 223/454 (49%), Gaps = 11/454 (2%)

Query: 1   MNILRAI-FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDT 59
           M  +  +   L ++ ++ C +G  Y++P +  LP Q   G   + ++   ++W + + D 
Sbjct: 2   MKKIYTLAIVLLVLGVSSCKLGKHYSRPEL-RLPEQIE-GTVPDSVSAGDIRWTDLYTDP 59

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST-- 117
            L +L++  L+ N  ++ A  ++  + E     +ADLFP + A++S     +    +T  
Sbjct: 60  VLRQLIRKTLEGNKDLMIAAAKVKESMELRRIAKADLFPKAEATVSAEREYDETPGNTFE 119

Query: 118 GQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISI 176
           G++ + W++DL+G+ R   +++LA    +       +  +++++  +Y +     + ++I
Sbjct: 120 GKVLASWEVDLWGKLRWAGQAALAEYLQSVEGRQALQSALVAQVAQAYFELIALDQELAI 179

Query: 177 AHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL 236
             Q L   ++ + L+ L+F  G TS+  L + + E+   ++ +P LE+  R+  + I+ L
Sbjct: 180 VRQTLAARQEGVRLAKLRFEGGLTSENPLRQAQVELARTQTLVPGLEREIRLKENQITLL 239

Query: 237 LGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
            G    E               L     +G+ + ++  RPDIR  E +L  + AK+G+A 
Sbjct: 240 AGEYPGEVARGKSIGQQQLMTALP----VGLSSRILERRPDIRQAEYRLKAAHAKVGVAY 295

Query: 297 SDLYPSLSLNGSIALTHDNSFPG-YNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQY 355
           + ++P  +L G   L   +        ++  G +L  P+F+ GK ++ ++ + +  +++ 
Sbjct: 296 TSMFPKFTLTGHYDLESSDLTDFLKAPYFFVGGELLAPVFNLGKNRARLKASRAVQEQET 355

Query: 356 ITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDIL 415
             +Q+ VL A  EV NAL +  + ++I    +H  +  + ++ L+ + Y  G  S LD+L
Sbjct: 356 YNYQKVVLQAFTEVSNALVNSRKSREIRESREHLEQSARSNLDLATLQYINGVISYLDVL 415

Query: 416 DIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           D +R     ++ L+ A R    + V LY  +G G
Sbjct: 416 DAQRGYFDAQIGLNTAIRDELLATVQLYQVLGGG 449


>gi|39997789|ref|NP_953740.1| outer membrane efflux protein [Geobacter sulfurreducens PCA]
 gi|39984681|gb|AAR36067.1| outer membrane efflux protein [Geobacter sulfurreducens PCA]
 gi|307635082|gb|ADI85453.2| efflux pump, RND family, outer membrane protein [Geobacter
           sulfurreducens KN400]
          Length = 512

 Score =  200 bits (508), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 108/464 (23%), Positives = 205/464 (44%), Gaps = 25/464 (5%)

Query: 8   FSLFIVLLAGCT-VGPEYTKPHMPLLPTQ-----FSIGNSKNLINIDTLKWWESFNDTSL 61
            S+  + LAGCT + P+Y +P  P+         +    S     +  + W E F D  L
Sbjct: 50  VSIMTLTLAGCTTMAPKYERPAAPVPVAWPEGPAYKQTASATEKPVADIPWQEFFVDEKL 109

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL--------- 112
           +KL+ +AL+ N  +  A   I  ++      R+DLFP   AS    F             
Sbjct: 110 HKLIALALENNRDLRAAALNIERSRAQYQIRRSDLFPKVDASAGATFTRQPEGLSATGRA 169

Query: 113 ---KTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
                 S G   S +++DLFG+ R + + +L    +        +++++S++  +Y+   
Sbjct: 170 DTIDQYSVGLGVSSYELDLFGRVRSLKDQALEQYLATEQARRSVQISLVSEVAVNYLTLA 229

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
             +ER+ +A + L   +++ +L+  +F  G +S L L + +  + +   DI         
Sbjct: 230 ADRERLKLAQETLANQQESYQLTKSRFDAGVSSALDLHQAQTSVDAARVDIARFTTLVAQ 289

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
           + + +S ++G P       +   + +        +  G+P+D++  RPDI   E  L  +
Sbjct: 290 DGNALSLVVGSPVPA---ELLPSALSDTLTALKDVAPGLPSDVLLRRPDILQAENLLKGA 346

Query: 289 VAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
            A IG A+++ +P ++L  ++    D+    F G +  WSF P++ LPIF  G  ++ + 
Sbjct: 347 NANIGAARANFFPRITLVSNVGFGSDDLAKLFSGDSFTWSFAPRITLPIFTAGANQATLE 406

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
            AE+        +++ +  A +EV +AL         +T  Q   +   +S  LS   Y 
Sbjct: 407 VAEADRNIAVAQYEKVIQTAFREVADALAQRGTIDDQLTAQQSLSDATAESHRLSQARYE 466

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           +G  + L +LD +RA    + +L   +     +   LY  +G G
Sbjct: 467 KGVDNYLQVLDSQRALYSAQQNLIGVRLVRLLNLATLYKVLGGG 510


>gi|293606558|ref|ZP_06688915.1| outer membrane efflux protein OprM [Achromobacter piechaudii ATCC
           43553]
 gi|292815034|gb|EFF74158.1| outer membrane efflux protein OprM [Achromobacter piechaudii ATCC
           43553]
          Length = 509

 Score =  200 bits (508), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 110/450 (24%), Positives = 202/450 (44%), Gaps = 21/450 (4%)

Query: 17  GC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTI 75
           GC ++ P Y +P +P+  T      ++  IN   + W   F D  L  L+  AL  N  +
Sbjct: 31  GCVSMAPTYERPALPVASTYSEPSQAEAGINAARVGWRSYFTDPVLQGLITEALANNRDL 90

Query: 76  LQATERINAAKENILSVRADLFPSSYASISHRFIPNL------------KTNSTGQLDSD 123
            QA  R+  A+      RAD FP+                              G   + 
Sbjct: 91  RQALLRVEEARALYGIQRADQFPTIGVQAEGARSRTPGDLNLTGQPMVGSQYQAGVGMAS 150

Query: 124 WKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILD 182
           W++D +G+ R + +++L N  ++ A    A L++I+++  SY+  R   ER+++  + + 
Sbjct: 151 WELDFWGRVRSLKDAALENYLASDAAARAATLSLIAQVADSYLTLRELDERLALTRETIA 210

Query: 183 LYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPAT 242
              +++ +   ++  G+ SKL L ++E   +   +    LE++     H +  L+G P  
Sbjct: 211 SRGESLRIFRRRYEVGSISKLDLTQVETLWQQARALGAELEQARATQAHALEQLVGKPLD 270

Query: 243 EFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPS 302
             L       +    +L      G+P+DL+  RPDI   E +L  + A IG A++  +P 
Sbjct: 271 LPLPKAGLDDDAVMLDLP----AGLPSDLLTQRPDIVAAEHQLRAANANIGAARAAFFPR 326

Query: 303 LSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQ 359
           ++L G+        +  F   +  WSF P L LPIFD G+  + +  A+    +    ++
Sbjct: 327 ITLTGAFGTASAELNGLFGSGSGAWSFAPSLDLPIFDAGRRSATLDLADVRRDQAVARYE 386

Query: 360 ETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIER 419
           +++ +A K+V +AL + +   + V  L+  V    +   L+ + Y  G    L++LD +R
Sbjct: 387 QSIQSAFKDVSDALAARHWLAEQVQVLRATVAAQSERARLAKLRYDHGASPYLEVLDAQR 446

Query: 420 ATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
                +  L   +R L  + V LY A+G G
Sbjct: 447 DLLTAQQALVQTRRALLSARVGLYAALGGG 476


>gi|241554290|ref|YP_002979503.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240863596|gb|ACS61258.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 477

 Score =  200 bits (508), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 186/465 (40%), Positives = 280/465 (60%), Gaps = 18/465 (3%)

Query: 1   MNI--LRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFND 58
           MN+  LR   S   +LLAGC  GP +  P MP LP +F  G++K+  ++   +WW ++ D
Sbjct: 1   MNLSSLRYAASAVTLLLAGCVSGPNHVPPEMP-LPAKFKEGSTKSNGDVVAAQWWTAYRD 59

Query: 59  TSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST- 117
             L+ LV     +NL +LQA ERIN+A  N+    A   PS     SH       +  T 
Sbjct: 60  KRLDGLVAHGRSENLDVLQALERINSASANVTVAAAGGLPSLDVGASHTVSGEKGSERTT 119

Query: 118 --------GQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
                   G+    W +D+FGQ R  + S  A+L +AYA  D AKL  +  L+ SYIDAR
Sbjct: 120 IGTTNETGGEASLSWLLDIFGQYRRSKESAIASLGAAYATADNAKLTFLKDLVESYIDAR 179

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
           ++++RI+++   L   ++  EL+ L+   GA S+L +V+ E  ++S +SDIP LE+SF  
Sbjct: 180 YYQQRIALSQANLKSRQQTYELTQLQLKAGAASRLDVVQAEGLVQSTKSDIPGLEQSFTE 239

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
           + H+I+TLLG PA   +  +QK +   QP     I  GIPADLIRNRPDIR  E++LA +
Sbjct: 240 SGHHIATLLGMPAASLMGELQKSAG--QPVFRGDIRAGIPADLIRNRPDIRKAERELAAA 297

Query: 289 VAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
           VA IG A++ LYPS+SL+       +    +  G  T W+FGP L LPIFD GK+++N+ 
Sbjct: 298 VADIGAAEAQLYPSISLSGSISPSWVKSSGASGGTLTSWTFGPTLNLPIFDGGKLRANVD 357

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
             +S A+ QY+ W+  VLN ++EVENAL+++  D + +  L+  V+  ++S++LS  +Y+
Sbjct: 358 IEKSDARTQYLAWKAAVLNGVEEVENALSAVRRDTQTLEPLRRQVQTAQESLALSTTSYK 417

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            G  SLLD+L+ +R+ +  +  L+   +Q+AK YVDLY+AIG+GY
Sbjct: 418 DGASSLLDVLEAQRSVSDAQESLADTVQQVAKDYVDLYVAIGAGY 462


>gi|21672266|gb|AAM74473.1| outer membrane protein precursor OPRM [Aeromonas hydrophila]
          Length = 475

 Score =  200 bits (508), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 99/467 (21%), Positives = 212/467 (45%), Gaps = 25/467 (5%)

Query: 2   NILRAIFSLFI-VLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           N+ + + +L + +LL GC++ P+Y +P +P   T  S    +  ++     W + F D +
Sbjct: 6   NMTKTLIALSVTLLLGGCSMAPDYQRPELPQGATWQSNQTGEAAVS----SWRQQFLDPA 61

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL 120
           L +L+  AL+ N  +  A   + A +      RA   P+  A+ S          S+   
Sbjct: 62  LQQLIATALENNRDLRIAALNVEAYEARYRIQRAAQLPTLAANGSGTRQQGSDDLSSTGQ 121

Query: 121 ------------DSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
                        + +++DLFG+ + + + +L             ++ +++ +  +Y+  
Sbjct: 122 GSISSQYGANIGITAYELDLFGRIQSLKDQALETYLVQIETQRSTQIALVASVANAYLTL 181

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
              +E ++++   L   +++  L+  K+  GA S++ L +    ++S +  +   ++  +
Sbjct: 182 LADQELLALSEATLATEQESYGLTEHKYRLGAASEMELAQGRTALESAKVSLAQYQRQVK 241

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
            + + ++ LLG      +      +      +     +G P+ L++ RPDI   E  L  
Sbjct: 242 QDRNGLALLLGTSVPALMTEPATLAEVQLAAIP----VGAPSSLLQQRPDILAAEHSLKA 297

Query: 288 SVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNI 344
           + A IG A++  +P++SL  +     +     F G    W+F P++ LPIFD GK  +++
Sbjct: 298 ANANIGAARAAFFPTISLTATAGTASNQLSGLFDGGTGTWTFMPQINLPIFDGGKRIADL 357

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
             AE S ++   ++++++  A KEV + L +  + ++ +   Q  V+  +    L+ + Y
Sbjct: 358 DVAEVSTKQAVASYEKSIQTAFKEVADTLGAQADYQQQLQAQQELVKASQTYFKLAEVRY 417

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            +G  S L  LD +R+    +  L   +     + V LY A+G G+ 
Sbjct: 418 EKGVDSYLTRLDAQRSLFSAKQGLITTRLAQLSNQVALYKAVGGGWQ 464


>gi|146284250|ref|YP_001174403.1| outer membrane protein OprM precursor [Pseudomonas stutzeri A1501]
 gi|145572455|gb|ABP81561.1| outer membrane protein OprM precursor [Pseudomonas stutzeri A1501]
          Length = 473

 Score =  200 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 102/453 (22%), Positives = 201/453 (44%), Gaps = 22/453 (4%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGN---SKNLINIDTLKWWESFNDTSLNKLVKIALQQNL 73
           GC++ PEY +P  P             +        L W + F D +L +L+++AL+ N 
Sbjct: 16  GCSLIPEYQRPDAPAPADWPQGEAYSKASPEARAQALGWRQFFRDPALQQLIEVALENNR 75

Query: 74  TILQATERINAAKENILSVRADLFPSSYASISHRFI-----------PNLKTNSTGQLDS 122
            +  A   ++A +      RAD+ P+  A  +               P + +  +     
Sbjct: 76  DLRVAALNVDAYRALYRVQRADVLPAVSADGAGTRSRTPGDLSMSGEPAISSQYSATFGV 135

Query: 123 DWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQIL 181
            W++DLFG+ R +   +L    ++ A     ++++I+ +  +++  +  +  + +    L
Sbjct: 136 SWELDLFGRLRSLRDQALEEFFASEAAQRSTQISLIASVANAWLTLQADQALLQVTRDTL 195

Query: 182 DLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPA 241
             Y++++ L+   F  G  S L L +  + + S    I    +    + + ++ LLG   
Sbjct: 196 KTYEESLGLTQRSFDVGVASALELRQARSAVDSARVSIEQYTRLVAQDRNALTLLLGQSL 255

Query: 242 TEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYP 301
              L   +         L     +G+P+DL++ RPDI   E +L    A IG A++  +P
Sbjct: 256 PAGLPSGEGLERTQLATLP----VGLPSDLLQQRPDILQAEYQLRAVNASIGAARAAFFP 311

Query: 302 SLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITW 358
            +SL G+           F G + +WSF P + +PIF+ G++++N+  A+ S   Q   +
Sbjct: 312 RISLTGAAGTASSELSGLFDGGSGYWSFSPSISVPIFNAGQLRANLDYAQISKNIQVAQY 371

Query: 359 QETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIE 418
           ++ +  A +EV + L +     + V   +  ++  +   +L+   YR G  S L +LD +
Sbjct: 372 EQAIQTAFREVADGLAAQATYVRQVQAQRDLLQTSEDYYNLAERRYRTGVDSYLTVLDAQ 431

Query: 419 RATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           R    V+  L   +     S V+L+ A+G G+ 
Sbjct: 432 RQLFSVQQQLISDRLAQLTSEVNLFKALGGGWQ 464


>gi|307823718|ref|ZP_07653946.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Methylobacter tundripaludum SV96]
 gi|307735012|gb|EFO05861.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Methylobacter tundripaludum SV96]
          Length = 526

 Score =  200 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 124/470 (26%), Positives = 230/470 (48%), Gaps = 26/470 (5%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK-NLINIDTLKWWESFNDTSLNKL 64
            ++SL  +LL+ C VGP+Y +P            + + N  + +   WW+SFND  LN+L
Sbjct: 12  PVWSLAFLLLSSCMVGPDYVRPATETATQWLEAEDRRLNTTSANDQTWWKSFNDPVLNQL 71

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSY--------------ASISHRFIP 110
           +  A  +NL I  A  R+  A+  +     +++P +               AS +     
Sbjct: 72  IDRAYLENLNIRIAGVRVLEARAQLGIAIGNIYPQNQQLTGSLSKVHLSERASQAAFSKI 131

Query: 111 NLKTNSTGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                +   L + W+ID +G+ R  IES+ A   +A A  + A +++ + +  +YI  R 
Sbjct: 132 FDYAQTQLGLTASWEIDFWGKFRRAIESADAGFQAAVADYNNALVSLTADVAHAYITIRT 191

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
            ++R+SIA Q +D  K+++ ++ +++  G TS+  + +    + + ++ IPTLE   R  
Sbjct: 192 LEKRLSIARQNVDTQKESLNIAKIRYNGGTTSERDVEQARTVLANTQASIPTLEIGLRQQ 251

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            + +S LLG         +   +    P   + + +GIPA+L+R RPD+R+ E + A   
Sbjct: 252 QNALSVLLGAAPGRISGLLAGTAQIPAP--PVQVAVGIPAELLRRRPDVRHAEWQAAAQS 309

Query: 290 AKIGIAKSDLYPSLS--------LNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIK 341
           A IG+ K+ LYP+LS         +   +    + F   +   +FGP L   IF+ G+I 
Sbjct: 310 ASIGVTKAALYPALSLTGTFGLLSSDVGSFALGDVFLWKSRTANFGPALQWNIFNYGQIT 369

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           + +R  ++  Q   I++Q TVL+A +EVE+ L +    ++    L  +    ++S+ L+ 
Sbjct: 370 NQVRVQDARLQGLLISYQNTVLSAQREVEDNLVAFLRSQERAQSLGESTAAAQRSLDLAT 429

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           + YRQG      +L  ++A    +  L+     ++ + V +Y A+G G+ 
Sbjct: 430 LQYRQGITDFTTVLTAQQALLSEQDSLANTLGDISNNLVGVYRALGGGWQ 479


>gi|163869206|ref|YP_001610458.1| putative outer membrane protein [Bartonella tribocorum CIP 105476]
 gi|161018905|emb|CAK02463.1| putative outer membrane protein [Bartonella tribocorum CIP 105476]
          Length = 492

 Score =  200 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 128/452 (28%), Positives = 231/452 (51%), Gaps = 9/452 (1%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIA 68
            +   LL+GC VGP Y K    +           +  +I    WW S ND  LN L+  A
Sbjct: 18  VMLCFLLSGCMVGPNYHKTSFSVPARWGQQSAQISGHSIALAGWWRSLNDPVLNTLMDEA 77

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK----TNSTGQLDSDW 124
           +  N  +  A  RI  A+ ++  V   L P++  +IS     + +          LD+ W
Sbjct: 78  VSGNNDVAVAKARIREARASLGQVVGSLLPNASNTISGTRSGSKQSDALNQYRSGLDASW 137

Query: 125 KIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDL 183
           ++D FG  +  +E++   L++A   +    + ++ ++  +Y+  R +++++ I  QI   
Sbjct: 138 ELDFFGGHKRGVEAAQYGLEAAVEDMRATMVILLGEVATNYVQMRGWQQKLLIVRQIAAT 197

Query: 184 YKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATE 243
            +K  EL   K T G  S+L +   +A++ + E+DI  +E +  M++H +S L G+  T 
Sbjct: 198 QRKTYELMQTKLTAGDISELDVSNAKAQMANTEADISQMEANVAMSMHRLSVLTGHVPTA 257

Query: 244 FLHYMQKQSNNF-QPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPS 302
               +QK + +   P    PI  GIPAD++  RPD+R  E++ A + A+IG  +++ YPS
Sbjct: 258 LKDLLQKNAKHVKIPQPQWPIPAGIPADILLTRPDLRRAERQYAQATARIGQREAERYPS 317

Query: 303 LSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQ 359
           L+L G+I+         +      WSFGP L  P F+ G+I +++  A +   + +IT++
Sbjct: 318 LTLTGNISTAATAMDQLWKSSTIGWSFGPNLRFPFFNGGQIVASVAMARAQRDQAFITYR 377

Query: 360 ETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIER 419
             VL A+++VENAL  + ++ + + KL  A +    S+ LS   +  G  S L++L+ +R
Sbjct: 378 AAVLGALEDVENALVRLTKEHQRLEKLVVANKAFLHSLQLSRSLFENGNTSFLELLNADR 437

Query: 420 ATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +    ++ L  ++  LA  Y+ L  A+G G++
Sbjct: 438 SYYSAQMALKDSRIALATQYIALMKALGGGWD 469


>gi|160895948|ref|YP_001561530.1| RND efflux system outer membrane lipoprotein [Delftia acidovorans
           SPH-1]
 gi|160361532|gb|ABX33145.1| RND efflux system, outer membrane lipoprotein, NodT family [Delftia
           acidovorans SPH-1]
          Length = 485

 Score =  200 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 103/465 (22%), Positives = 206/465 (44%), Gaps = 16/465 (3%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSI---GNSKNLINIDTLKWWESFND 58
           N    +     VLLAGC++ P Y +P  P+            ++       L W + F D
Sbjct: 3   NRSTPVAIATAVLLAGCSLIPTYERPAAPVAAQYTRANATAAAEGGTAAAQLPWQDFFQD 62

Query: 59  TSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP-------- 110
             L +LV+ AL  N  +  A   I  A+      RAD FP+  A ++    P        
Sbjct: 63  ARLQQLVRTALDNNRDLRVAALNIERAQAQYRITRADQFPTVGAGVNASRAPNTTGSGAK 122

Query: 111 NLKTNSTGQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
            + +   G   + W++D FG+   ++ ++LA   +       A+ ++++ +   +     
Sbjct: 123 YVNSYQVGLAVTSWELDFFGRIGSLKEAALAQYLATEEARRAAQTSLVAAVASGWYTLLA 182

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
            ++ + I+   L   +++I+L+ L+F  G  S+L   +  +  ++  + +   ++   ++
Sbjct: 183 DEQLLKISRDTLRTREESIKLTKLRFDTGVASELDYRQAVSLTEAARATLAQQQRQRALD 242

Query: 230 VHNISTLLGYP-ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
            + +  LLG     + L  +              +  G+P+DL+  RPDIR  E++L  +
Sbjct: 243 ENALVLLLGQALPADVLASLGSSQGLRDTADLPAVPAGLPSDLLTQRPDIRQAEQQLISA 302

Query: 289 VAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
            A IG A++  +P ++L G      +     F   +  ++  P   LPIFD G+  +N+ 
Sbjct: 303 NANIGAARAAFFPRITLTGQFGTASNELSGLFKSGSWGFTLAPSALLPIFDAGRNSANLA 362

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
            A+   +     +++++ +A +EV +AL S    +  +   +  +E  +  + LS + Y 
Sbjct: 363 AAKVEREVAIAQYEKSIQSAFREVSDALDSQGTLRDQIMAQRAQLEAEQARLKLSDLRYS 422

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            G  S LD+LD +R    +E      +     + ++LY A+G G+
Sbjct: 423 NGVASYLDLLDAQRTLFALEQSTVSVRLAQLLNQIELYKALGGGW 467


>gi|307611376|emb|CBX01040.1| hypothetical protein LPW_27411 [Legionella pneumophila 130b]
          Length = 517

 Score =  200 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 106/470 (22%), Positives = 211/470 (44%), Gaps = 23/470 (4%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLN 62
           +L+ +  L  ++L+ C VGP + +P         +   +          WW+ FND +L 
Sbjct: 1   MLKILVLLSCLILSSCLVGPNFKEPKKDAANYWLTSSPAIKQSAFQNANWWKVFNDPTLT 60

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI------------P 110
            L+      NL++  A  R+  A+  +     +L+P   A +                 P
Sbjct: 61  ALINNGYHNNLSLQIAGVRVLQARAQLAQSVGELYPQQQAMVGDYNYNRIGGNQLQGLLP 120

Query: 111 NLKTNSTGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                ++    + W++D +G+ R  I+S+ A   ++ A  D A + + S +  ++I  R 
Sbjct: 121 PDFLTASLGFSASWELDFWGKYRRAIQSNDALFLASLAAYDSALVTLTSDIASTFIKIRT 180

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
            +E I +    + +   +++++  ++  G TS L + +   E+   ++ +P      +  
Sbjct: 181 SEELIKVTKANIQVQAMSLKIAKDRYYGGQTSLLDVEQAATELAETQAKLPQYVSDLQHQ 240

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
              ++ LLG    +    ++K      P     + +GIP ++I  RPD+     +     
Sbjct: 241 KDILAVLLGTTPDKVDGLLKKNKG--IPKASAVVEVGIPKEVIARRPDVYQARMEAIAQS 298

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHDNS--------FPGYNTHWSFGPKLYLPIFDKGKIK 341
           A IG  K++LYPSLSL G+     +N         F   N +   GP L   + + G+I 
Sbjct: 299 AAIGAVKANLYPSLSLVGTFVFASNNIGNSTISDIFNWSNRNIVAGPSLAWSLLNYGQIT 358

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           + +R  +++ Q+  + +   VL   +EV++ +T   E +K V+ L+ A     +S  L++
Sbjct: 359 NAVRAQDAAFQQALLNYLNLVLKVQQEVQDNITRYVEGQKTVSSLKSANASAIESTRLAL 418

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           + Y++G  +   +L+ E+   +V+  L  A  +LA S V LY ++G G+ 
Sbjct: 419 VRYKEGEANYTTVLNAEQQQLRVQTSLVNATGELALSLVGLYRSLGGGWQ 468


>gi|157962015|ref|YP_001502049.1| RND efflux system outer membrane lipoprotein [Shewanella pealeana
           ATCC 700345]
 gi|157847015|gb|ABV87514.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Shewanella pealeana ATCC 700345]
          Length = 518

 Score =  200 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 115/455 (25%), Positives = 207/455 (45%), Gaps = 13/455 (2%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKI 67
            +  I+LL+GC +GP+Y +P + +           +  N+    W + + D  L  L++ 
Sbjct: 38  VACGILLLSGCAMGPDYQRPDLEIPEQFHHELQQTDEQNVGLKHWRDFYLDPDLQVLIEH 97

Query: 68  ALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI---------PNLKTNSTG 118
           AL QNL +     R+ AA+  +    A LFP      +             P  +     
Sbjct: 98  ALDQNLDLEGVRSRLLAARAGVTVTDAALFPVVGLDANGERALDSALTSTDPVKEDTFYV 157

Query: 119 QLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIA 177
                W++DL+G  R   E+  AN  S+   +++A +++IS +   Y +    ++R  I+
Sbjct: 158 AGTVSWELDLWGANRRRSEAEFANFISSQEALNLATISLISDVASRYYEWLDVEQRYQIS 217

Query: 178 HQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLL 237
              ++L KK  +L+ L+   G  S L + + E E +S    +P L+       + +  LL
Sbjct: 218 LNTVELRKKERDLARLRKQNGVISGLQVRQAEVEYQSARVTLPDLDYERSEKANQLRILL 277

Query: 238 GYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKS 297
           G      +   + Q             +GIP+ ++  RPD++  E+ L  + A +G+AK+
Sbjct: 278 GEFTYPLIPKTEAQLKAEGALFPDSFAVGIPSQMLSQRPDVKSAEQALVAANANVGVAKT 337

Query: 298 DLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQ 354
             +P  +++GS     +   + F      WS    +  PIF+ GKI +    A+ +A++ 
Sbjct: 338 AFFPKFTISGSYGSESESLSDIFDSQGLTWSLLGGVTAPIFNAGKISAQYDIAQENAKQA 397

Query: 355 YITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDI 414
            ++++ TVL A  EV +A+ S    +  +   Q  V    +   L+ + YR G  S LD+
Sbjct: 398 MLSYKSTVLGAYFEVNDAMNSFRRSELAIDAQQELVVASTEYTRLATLRYRNGVSSSLDL 457

Query: 415 LDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           +D +R+    E+ LS  KR    S + LY A+G G
Sbjct: 458 MDAQRSLFSAELTLSQVKRDRLLSMITLYRALGGG 492


>gi|301061715|ref|ZP_07202456.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [delta proteobacterium NaphS2]
 gi|300444175|gb|EFK08199.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [delta proteobacterium NaphS2]
          Length = 498

 Score =  200 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 118/459 (25%), Positives = 219/459 (47%), Gaps = 27/459 (5%)

Query: 16  AGCT-VGPEYTKPHMPLLPTQFSIGNSKNLINID---TLKWWESFNDTSLNKLVKIALQQ 71
           +GC  VGP Y KP +  +P  +    SK +          WW  F+D  LN L++ A Q 
Sbjct: 34  SGCAPVGPNYQKPEI-KIPDAWHEAISKEMARQPGATLQTWWRIFDDPVLNDLIEQARQS 92

Query: 72  NLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL----------------KTN 115
           NL I  A   I A++  +  V     P++    S     +                 +  
Sbjct: 93  NLDIKIALSGIAASRARLGVVSGKELPNANVFGSFSRFKHSDQGPFKQMAPPGGFEGQNM 152

Query: 116 STGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
               +D+ W++D+FG+ RR IE++ A  +++        + + +++   Y++ R  + RI
Sbjct: 153 FMVGVDALWEVDVFGRIRRQIEAAGAEYEASIEDYRDVMVTLFAEVALVYVEIRSCQRRI 212

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
             A     + KK +EL+  +F  G +SKL   +  + + + E+ +P L       ++ ++
Sbjct: 213 QCAEANAAIQKKMLELTRARFHSGISSKLDTAQATSNLANTEAAVPPLTIRLNTMINRLA 272

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
            LL          +    +   P     I IG+PADL+R RPD+R  EK+LA   A+IG+
Sbjct: 273 VLLDTNQETLQRKLGGSVS--IPIAKENIGIGVPADLLRQRPDVRMAEKQLAAQTARIGV 330

Query: 295 AKSDLYPSLSLNGSIALTHDNSFPGYNTH---WSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           A +DLYP  +++G   L   +           W     +    F  GK +SNI   +  A
Sbjct: 331 ATADLYPRFTISGFFGLETGSFSDIGGGSSLAWGIRSPVKWNFFSGGKTRSNITFHKEIA 390

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           +++ + +++TVL A++EV NA+ +  ++K    +L+ AVE  ++++ L ++ Y  G  + 
Sbjct: 391 RQELLKYRDTVLKAMEEVRNAIVAHAQEKLRRNRLREAVEATREAVDLVIVQYETGLTNF 450

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            ++LD +R+  + +  L +++  +  + + LY A+G G+
Sbjct: 451 NNVLDTQRSLFEQQDQLVVSEGDVVFNLIRLYKALGGGW 489


>gi|52842722|ref|YP_096521.1| outer membrane efflux protein (RND multidrug efflux) [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|19880978|gb|AAM00608.1| unknown [Legionella pneumophila]
 gi|52629833|gb|AAU28574.1| outer membrane efflux protein (RND multidrug efflux) [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
          Length = 520

 Score =  200 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 107/470 (22%), Positives = 211/470 (44%), Gaps = 23/470 (4%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLN 62
           +L+ +  L  ++L+ C VGP + +P         +   +          WW+ FND +L 
Sbjct: 4   MLKILALLSCLILSSCLVGPNFKEPKKDAANYWLTSSPAIKQSAFQNANWWKVFNDPTLT 63

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI------------P 110
            L+      NL++  A  R+  A+  +     +L+P   A +                 P
Sbjct: 64  SLIDNGYHNNLSLQMAGVRVLQARAQLAQSVGELYPQQQAMVGDYNYNRIGGNQLQGLLP 123

Query: 111 NLKTNSTGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                ++    + W++D +G+ R  I+S+ A   ++ A  D A + + S +  ++I  R 
Sbjct: 124 PDFLTASLGFSASWELDFWGKYRRAIQSNDALFLASLAAYDSALVTLTSDIASTFIKIRT 183

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
            +E I +    + +   +++++  ++  G TS L + +   E+   +S +P      +  
Sbjct: 184 SEELIKVTKTNIQVQAMSLKIAKDRYYGGQTSLLDVEQAATELAETQSKLPQYVSDLQHQ 243

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
              ++ LLG    +    ++K      P     + +GIP ++I  RPD+     +     
Sbjct: 244 KDILAVLLGTTPDKVDDLLKKNKG--IPKALAVVEVGIPKEVIARRPDVYQARMEAIAQS 301

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHDNS--------FPGYNTHWSFGPKLYLPIFDKGKIK 341
           A IG  K++LYPSLSL G+     +N         F   N +   GP L   + + G+I 
Sbjct: 302 AAIGAVKANLYPSLSLVGTFVFASNNIGNSTISDIFNWSNRNIVAGPSLAWSLLNYGQIT 361

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           + +R  +++ Q+  + +   VL   +EV++ +T   E +K V+ L+ A     +S  L++
Sbjct: 362 NAVRAQDAAFQQALLNYLNLVLKVQQEVQDNITRYVEGQKTVSSLKTANAAAIESTRLAL 421

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           + Y++G  +   +L+ E+   +V+  L  A  +LA S V LY ++G G+ 
Sbjct: 422 VRYKEGEANYTTVLNAEQQQLRVQTSLVNATGELALSLVGLYRSLGGGWQ 471


>gi|77458882|ref|YP_348388.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           fluorescens Pf0-1]
 gi|77382885|gb|ABA74398.1| outer membrane component of multidrug efflux system [Pseudomonas
           fluorescens Pf0-1]
          Length = 473

 Score =  200 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 127/470 (27%), Positives = 228/470 (48%), Gaps = 21/470 (4%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK----WWESF 56
           M++   + SL ++ L+ C VGP+Y  P         +   +    N D  K    WW+ F
Sbjct: 1   MSLKVFLPSLLVLALSACAVGPDYKTPTTEAANITSATDGAAGQKNFDRSKFEGIWWQQF 60

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS----------H 106
           +D +LN+LV  +LQ N  +  A  R  AA+     V  D  P+  +  S           
Sbjct: 61  DDPTLNQLVTQSLQGNRELRVAFARWKAARAIRDDVSNDAMPTITSRASSDLAKGQIPGQ 120

Query: 107 RFIPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
                        LD  W++DLFG+ +R++E+S A+  +A A +   ++ +I++L+ +Y 
Sbjct: 121 TTKRVNSERYDLGLDMAWELDLFGRIQRNLEASDADQQAAEADLYQLQVTMIAELVDAYG 180

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
             R  + R  IA   L+  +++ +++      G   +L + + +A + S+E+ +P L+  
Sbjct: 181 QLRGAQLREKIALANLNNQQESRKITISLRDAGVGDQLDVERADARLASVEASVPQLQAE 240

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
                + I+TLLG    +    +  +             IG P +L++ RPDI   E+KL
Sbjct: 241 QARQKNRIATLLGERPDKLTVDLSPKDLPAIAKALP---IGDPGELLQRRPDILSAERKL 297

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYN---THWSFGPKLYLPIFDKGKIKS 342
           A + A+IG+AK+DL+P +SL+G +  T        +     W+ GP +    FD G +++
Sbjct: 298 ASATARIGVAKADLFPRVSLSGFLGWTAGRGSQIGSSAANAWALGPSITWAAFDLGSVRA 357

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            +R A++ A+    T+++ VL A++E ENA +   + ++ +  L    E  +K+  L+ I
Sbjct: 358 RLRGADADAEGALATYEQQVLLALEESENAFSDYGKRQQRLISLIRQSESSRKAADLAEI 417

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            YR+G    L +LD +R     E   + A+  L +  V +Y A+G G+ P
Sbjct: 418 RYREGTTDFLVLLDAQRERLNAEDSQAQAEVDLYRGIVAIYKALGGGWQP 467


>gi|54295351|ref|YP_127766.1| hypothetical protein lpl2436 [Legionella pneumophila str. Lens]
 gi|53755183|emb|CAH16676.1| hypothetical protein lpl2436 [Legionella pneumophila str. Lens]
          Length = 520

 Score =  200 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 106/470 (22%), Positives = 211/470 (44%), Gaps = 23/470 (4%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLN 62
           +L+ +  L  ++L+ C VGP + +P         +   +          WW+ FND +L 
Sbjct: 4   MLKILVLLSCLILSSCLVGPNFKEPKKDAANYWLTSSPAIKQSAFQNANWWKVFNDPTLT 63

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI------------P 110
            L+      NL++  A  R+  A+  +     +L+P   A +                 P
Sbjct: 64  ALINNGYHNNLSLQIAGVRVLQARAQLAQSVGELYPQQQAMVGDYNYNRIGGNQLQGLLP 123

Query: 111 NLKTNSTGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                ++    + W++D +G+ R  I+S+ A   ++ A  D A + + S +  ++I  R 
Sbjct: 124 PDFLTASLGFSASWELDFWGKYRRAIQSNDALFLASLAAYDSALVTLTSDIASTFIKIRT 183

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
            +E I +    + +   +++++  ++  G TS L + +   E+   ++ +P      +  
Sbjct: 184 SEELIKVTKANIQVQAMSLKIAKNRYYGGQTSLLDVEQAATELAETQAKLPQYVSDLQHQ 243

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
              ++ LLG    +    ++K      P     + +GIP ++I  RPD+     +     
Sbjct: 244 KDILAVLLGTTPDKVDGLLKKNKG--IPKASAVVEVGIPKEVIARRPDVYQARMEAIAQS 301

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHDNS--------FPGYNTHWSFGPKLYLPIFDKGKIK 341
           A IG  K++LYPSLSL G+     +N         F   N +   GP L   + + G+I 
Sbjct: 302 AAIGAVKANLYPSLSLVGTFVFASNNIGNSTISDIFNWSNRNIVAGPSLAWSLLNYGQIT 361

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           + +R  +++ Q+  + +   VL   +EV++ +T   E +K V+ L+ A     +S  L++
Sbjct: 362 NAVRAQDAAFQQALLNYLNLVLKVQQEVQDNITRYVEGQKTVSSLKSANASAIESTRLAL 421

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           + Y++G  +   +L+ E+   +V+  L  A  +LA S V LY ++G G+ 
Sbjct: 422 VRYKEGEANYTTVLNAEQQQLRVQTSLVNATGELALSLVGLYRSLGGGWQ 471


>gi|82701981|ref|YP_411547.1| RND efflux system, outer membrane lipoprotein, NodT [Nitrosospira
           multiformis ATCC 25196]
 gi|82410046|gb|ABB74155.1| RND efflux system, outer membrane lipoprotein, NodT [Nitrosospira
           multiformis ATCC 25196]
          Length = 504

 Score =  200 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 109/452 (24%), Positives = 216/452 (47%), Gaps = 25/452 (5%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTIL 76
            C  GP Y +P +  +  ++  G  K   +I    WWE F D  LN+L++IAL +N  I 
Sbjct: 20  SCMFGPNYRRPEIETM-EKYRFGE-KVARDIADTAWWEQFGDPILNELIRIALVENKDIR 77

Query: 77  QATERINAAKENILSVRADLFPSSYASISHRF--------------IPNLKTNSTGQLDS 122
            AT RI   +    + R++LFP      S                 I    +     +++
Sbjct: 78  IATARIEEFQGRYGATRSELFPQIGGDASAERLRSTAFVWPRGLGGIDPYYSYYQVSINA 137

Query: 123 DWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQIL 181
           +W+ID++G+ R + E++   L ++ A      L +++ +  SYI+      ++ IA    
Sbjct: 138 NWEIDIWGRIRRLSEAARHQLFASEAARRATILTLVTSVASSYINLLILDRQLEIARATA 197

Query: 182 DLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPA 241
              +  +E+  +++  G  S+L L ++E++ ++  + IP LE S     + ++ LLG   
Sbjct: 198 ATRRDTLEVFRMRYEGGVISQLELAQIESQYETAVAAIPPLESSIAQQENALAVLLGRNP 257

Query: 242 TEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYP 301
                  +             ++ G+P++L+  RPD+R  E+ L  + A+IG A++  +P
Sbjct: 258 GPIARGRELAKLEL-----PMVSAGLPSELLMRRPDLREAEQNLISANAQIGAARALYFP 312

Query: 302 SLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITW 358
            +SL G + +        F G     +FG    +PIF  G I   +++AE+  ++  + +
Sbjct: 313 RISLTGVLGVASTQLATLFTGPAYMAAFGVLTSVPIFTAGGIAGQVKQAEARHEQALVGY 372

Query: 359 QETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIE 418
           Q  +  A +EVE++L ++ +++  +      VE  +  + ++ + Y +G  S +++LD +
Sbjct: 373 QRAIQIAFREVEDSLIAVQKNRAELAAQTRRVEASRTYLEMAQLRYDEGYISFIEVLDAQ 432

Query: 419 RATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           R   + E   +  + ++  S VDLY ++G G+
Sbjct: 433 RTLFEAETTQAQTRGRVFNSLVDLYKSLGGGW 464


>gi|226951713|ref|ZP_03822177.1| outer membrane efflux protein [Acinetobacter sp. ATCC 27244]
 gi|226837503|gb|EEH69886.1| outer membrane efflux protein [Acinetobacter sp. ATCC 27244]
          Length = 493

 Score =  200 bits (507), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 105/468 (22%), Positives = 206/468 (44%), Gaps = 19/468 (4%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKN-------LINIDTLKWWES 55
           + +        +LAGC++ P Y +P  P+     +                   + W + 
Sbjct: 14  LKKMSVLTTATILAGCSMAPIYERPVSPVSEHYPTGEAYPGLQVNNGKQTVAADIGWRDF 73

Query: 56  FNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP----- 110
           + D  L +L+  AL+ N         + A +      RAD  P    +            
Sbjct: 74  YTDPVLLQLIDHALKNNHDFKVTALNVEAIEAQYRIRRADRLPHVGVTAESASQRLPSDL 133

Query: 111 --NLKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
             N +    G     W++DL+G+ R + + +L N  ++      ++L+++S +  +Y+  
Sbjct: 134 AYNPRMYQVGVTSVAWEVDLWGRVRSLSDQALQNYLASKEVQTASQLSLVSAVANAYLVY 193

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
           +  +E + +    L   +K+ +L+      G  ++  L + E  +++ +++     +   
Sbjct: 194 KADQETLGLTKATLATQQKSYDLTRKLVDVGNATRFDLRQAEIGLRTAQTNYAKFLRITA 253

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSN-NFQPNLYIPINIGIPADLIRNRPDIRYQEKKLA 286
            + + +  LLG P T+ L     QS       +   I +G+P+DL++ RPDIR  E KL 
Sbjct: 254 QDRNALVLLLGSPLTQELAAQLDQSPKIPDQVVMQDIPVGLPSDLLQRRPDIRAAEHKLQ 313

Query: 287 DSVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSN 343
            + A IG A++  +PS++L GS        DN F      WSF PK+ LPIF+ G  ++N
Sbjct: 314 AANANIGAARAAFFPSITLTGSAGTASSSLDNLFNAGTGAWSFMPKINLPIFNAGLNQAN 373

Query: 344 IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
           + R+    Q + I + +++  A +EV + L   +   + +   Q  +   + +  L+ + 
Sbjct: 374 LDRSHIMKQIEVINYDKSIQTAFREVADGLAGKSTLDEQIKSQQQMIAASQDAHKLATLR 433

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +  G  + L +LD +R     +  L   + +   + V+LY A+G G+N
Sbjct: 434 FDAGEDNYLAVLDSQRTLYASQQALIQTRLERLNNQVNLYKALGGGWN 481


>gi|327482633|gb|AEA85943.1| outer membrane protein OprM precursor [Pseudomonas stutzeri DSM
           4166]
          Length = 473

 Score =  200 bits (507), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 103/453 (22%), Positives = 202/453 (44%), Gaps = 22/453 (4%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGN---SKNLINIDTLKWWESFNDTSLNKLVKIALQQNL 73
           GC++ PEY +P  P+            +        L W E F D +L +L+++AL+ N 
Sbjct: 16  GCSLIPEYQRPDAPVPADWPQGEAYSKASPEARAQALGWREFFRDPALQQLIEVALENNR 75

Query: 74  TILQATERINAAKENILSVRADLFPSSYASISHRFI-----------PNLKTNSTGQLDS 122
            +  A   ++A +      RAD+ P+  A  +               P + +  +     
Sbjct: 76  DLRVAALNVDAYRALYRVQRADVLPAVSADAAGTRSRTPGDLNMSGEPAISSQYSATFGV 135

Query: 123 DWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQIL 181
            W++DLFG+ R +   +L    ++ A     ++++I+ +  +++  +  +  + +    L
Sbjct: 136 SWELDLFGRLRSLRDQALEQYFASEAAQRSTQISLIASVANAWLTLQADQALLQVTRDTL 195

Query: 182 DLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPA 241
             Y++++ L+   F  G  S L L +  + + S    I    +    + + ++ LLG   
Sbjct: 196 KTYEESLGLTQRSFDVGVASALELRQARSAVDSARVSIEQYTRLVAQDRNALTLLLGQSL 255

Query: 242 TEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYP 301
              L   +         L     +G+P+DL++ RPDI   E +L    A IG A++  +P
Sbjct: 256 PAGLPSGEGLERTQLATLP----VGLPSDLLQQRPDILQAEYQLRAVNASIGAARAAFFP 311

Query: 302 SLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITW 358
            +SL G+           F G + +WSF P + +PIF+ G++++N+  A+ S   Q   +
Sbjct: 312 RISLTGAAGTASSELSGLFDGGSGYWSFSPSISVPIFNAGQLRANLDYAQISKNIQVAQY 371

Query: 359 QETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIE 418
           ++ +  A +EV + L +     + V   +  ++  +   +L+   YR G  S L +LD +
Sbjct: 372 EQAIQTAFREVADGLAAQATYVRQVQAQRDLLQTSEDYYNLAERRYRTGVDSYLTVLDAQ 431

Query: 419 RATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           R    V+  L   +     S V+L+ A+G G+ 
Sbjct: 432 RQLFSVQQQLISDRLAQLTSEVNLFKALGGGWQ 464


>gi|148360684|ref|YP_001251891.1| multidrug efflux MFS outer membrane protein [Legionella pneumophila
           str. Corby]
 gi|296106251|ref|YP_003617951.1| multidrug efflux MFS outer membrane protein [Legionella pneumophila
           2300/99 Alcoy]
 gi|148282457|gb|ABQ56545.1| multidrug efflux MFS outer membrane protein (RND family)
           [Legionella pneumophila str. Corby]
 gi|295648152|gb|ADG23999.1| multidrug efflux MFS outer membrane protein [Legionella pneumophila
           2300/99 Alcoy]
          Length = 479

 Score =  200 bits (507), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 120/474 (25%), Positives = 233/474 (49%), Gaps = 29/474 (6%)

Query: 4   LRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK--WWESFNDTSL 61
            + +    I  L GCTVGP+Y +P + +     +    K + +   +   WW++F+D  L
Sbjct: 3   RKLVLLFSISCLFGCTVGPDYQRPDIKIQEKWPTSKVEKKISSSAPVHLTWWKAFHDPLL 62

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASI----------------- 104
           ++ +  A   NL I  A  RI  A+       A+ +P    S                  
Sbjct: 63  DRYINEAATNNLDIKAAEARIRQARAMQQISLANFYPQINGSASANSLQISKGTLEGIFA 122

Query: 105 ---SHRFIPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKL 160
              ++  I   +       D+ W++DLFG+ RR +E+S A+L+ AY       L+ I+++
Sbjct: 123 NSPTYTLIDRNQWIYNLGFDAQWELDLFGKTRRKVEASKASLEEAYESRRTILLSTIAEI 182

Query: 161 IPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIP 220
             SYI+ R  ++   IA + ++L +K + L   ++  G +S++ +   E ++K+ ES +P
Sbjct: 183 ARSYIELRGAQQLYGIAQKNVELQRKTLALVRQRYKAGVSSEVDVSLAEGQLKNTESVLP 242

Query: 221 TLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRY 280
                 ++N + I+ +LG      L  + K  +  +P     + +G+ +D++R RPDIR 
Sbjct: 243 NYITQIQVNAYQIAVMLGKDPQTILKDIAKIQSLPKP--PQKVPMGLRSDILRQRPDIRA 300

Query: 281 QEKKLADSVAKIGIAKSDLYPSLSLNG----SIALTHDNSFPGYNTHWSFGPKLYLPIFD 336
            E++LA +VA+IG+A +D +P  +L+       + + D  F   +  W  GP++ LPIF 
Sbjct: 301 TERQLASAVAEIGVAVADFFPQFNLSVSNLAFQSTSVDTLFQSSSGFWLMGPQVSLPIFH 360

Query: 337 KGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKS 396
            G+I++N+   ++ AQ+  I +++ +L A++E ++AL   ++       L+ A+  +K++
Sbjct: 361 GGQIRANVESKKAVAQQAAIQYKKIILQALQEAQSALVRYSQSLDTNHSLRAAIIANKRA 420

Query: 397 MSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +  +   ++ G    L +L  E A    E     ++     + + LY A+G G+
Sbjct: 421 VQFAKKRFQYGEDDYLSLLQSEAALLNAETQEVNSEVSSLTALISLYKALGGGW 474


>gi|254241504|ref|ZP_04934826.1| hypothetical protein PA2G_02202 [Pseudomonas aeruginosa 2192]
 gi|126194882|gb|EAZ58945.1| hypothetical protein PA2G_02202 [Pseudomonas aeruginosa 2192]
          Length = 479

 Score =  200 bits (507), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 112/470 (23%), Positives = 228/470 (48%), Gaps = 25/470 (5%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKN----LINIDTLKWWESFNDTSL 61
            +  +  + L  C++GP++T+P  P          + N           +WW  F+D  L
Sbjct: 5   PLLLIASLALGACSLGPDFTRPDHPAPGDWSLQAAAGNPSHLAAAPLAAQWWTLFDDAQL 64

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK-------- 113
           N L++   + NL +  A  R+  ++    S+  D  PS  AS +++              
Sbjct: 65  NALLQRVQRANLDLRSAAARLQQSRAIRRSLGGDALPSVDASGNYQRQRTTSAGLFDPSG 124

Query: 114 -------TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
                   ++    D+ W++D +G+ RR +E++ A ++++  ++   +++V+++    YI
Sbjct: 125 KAGKGNYNHALAGFDASWELDFWGRVRRELEAADATVEASENELRDVQVSVLAEAARDYI 184

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
             R  + R +I    L+  ++++EL+  +   G  + L + +  A++ S+E+ +P +EK+
Sbjct: 185 QLRGEQSRAAIIRDNLETARRSLELTRTRLANGVATDLEVAQALAQVASMEARLPEVEKN 244

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
               V+ +  L+G      L  +       +P     + +G+P++L + RPDIR  E +L
Sbjct: 245 QAHLVNALGYLVGASPGSLLAELGPAREIPRP--PGSVPVGLPSELAQRRPDIRRAEARL 302

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHDNSF---PGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG+AK+D YP ++LNG+               +  ++ GP   LPIF+ G+++ 
Sbjct: 303 HAATASIGVAKADFYPRITLNGNFGFESLQLSSLGDWDHRQFAIGPAFSLPIFEGGRLRG 362

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            +   E+  QE  I +Q TVL A +EV++A+     +++   +L  AV  +++++  +  
Sbjct: 363 RLELREAQQQEAAIDYQRTVLRAWQEVDDAMHDYAANQRRQERLGEAVAQNRRALQSARE 422

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            YR G    L +LD +R     +     +   ++ + V+LY A+G G++P
Sbjct: 423 QYRAGAVDFLSVLDSQRQLLDNQEQQVASDEAVSLTLVNLYKALGGGWSP 472


>gi|313107979|ref|ZP_07794148.1| putative outer membrane protein precursor [Pseudomonas aeruginosa
           39016]
 gi|310880650|gb|EFQ39244.1| putative outer membrane protein precursor [Pseudomonas aeruginosa
           39016]
          Length = 479

 Score =  200 bits (507), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 112/470 (23%), Positives = 228/470 (48%), Gaps = 25/470 (5%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKN----LINIDTLKWWESFNDTSL 61
            +  +  + L  C++GP++T+P  P          + N           +WW  F+D  L
Sbjct: 5   PLLLIASLALGACSLGPDFTRPDRPAPGDWSLQAAAGNPSHLAAAPLAAQWWTLFDDAQL 64

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK-------- 113
           N L++   + NL +  A  R+  ++    S+  D  PS  AS +++              
Sbjct: 65  NALLQRVQRANLDLRSAAARLQQSRAIRRSLGGDALPSVDASGNYQRQRTTSAGLFDPSG 124

Query: 114 -------TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
                   ++    D+ W++D +G+ RR +E++ A ++++  ++   +++V+++    YI
Sbjct: 125 KAGKGNYNHALAGFDASWELDFWGRVRRELEAADATVEASENELRDVQVSVLAEAARDYI 184

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
             R  + R +I    L+  ++++EL+  +   G  + L + +  A++ S+E+ +P +EK+
Sbjct: 185 QLRGEQSRAAIIRDNLETARRSLELTRTRLANGVATDLEVAQALAQVASMEARLPEVEKN 244

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
               V+ +  L+G      L  +       +P     + +G+P++L + RPDIR  E +L
Sbjct: 245 QAHLVNALGYLVGASPGSLLAELGPAREIPRP--PGSVPVGLPSELAQRRPDIRRAEARL 302

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHDNSF---PGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG+AK+D YP ++LNG+               +  ++ GP   LPIF+ G+++ 
Sbjct: 303 HAATASIGVAKADFYPRITLNGNFGFESLQLSSLGDWDHRQFAIGPAFSLPIFEGGRLRG 362

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            +   E+  QE  I +Q TVL A +EV++A+     +++   +L  AV  +++++  +  
Sbjct: 363 RLELREAQQQEAAIDYQRTVLRAWQEVDDAMHDYAANQRRQERLGEAVAQNRRALQSARE 422

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            YR G    L +LD +R     +     +   ++ + V+LY A+G G++P
Sbjct: 423 QYRAGAVDFLSVLDSQRQLLDNQEQQVASDEAVSLTLVNLYKALGGGWSP 472


>gi|116747895|ref|YP_844582.1| Fis family transcriptional regulator [Syntrophobacter fumaroxidans
           MPOB]
 gi|116696959|gb|ABK16147.1| transcriptional regulator, Fis family [Syntrophobacter fumaroxidans
           MPOB]
          Length = 512

 Score =  199 bits (506), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 121/485 (24%), Positives = 237/485 (48%), Gaps = 36/485 (7%)

Query: 1   MNILR---AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL-KWWESF 56
           M   R   ++    + ++ GC VGP Y  P   +            +     + +WW  F
Sbjct: 7   MKRFRWTRSLILGLVAVVGGCMVGPNYRTPPSEMPGQWSEEPKGVEVAAAPDISRWWTLF 66

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS 116
            D  LN L++ A++ N  +  A  R+  A+       ADLFP+  A  S+ +     T +
Sbjct: 67  EDPKLNDLIERAVRANKDLKIAAARVREARAQRGVTAADLFPTVNADGSYVYSQKSLTTT 126

Query: 117 TG--------------------------QLDSDWKIDLFGQRRH-IESSLANLDSAYAQV 149
                                         D+ W++DL+G  R  +E++ ANL ++   +
Sbjct: 127 NPPLVSSGSSPAATVGGVSTGSTNLFQVGFDAGWELDLWGGTRRAVEAADANLAASVENL 186

Query: 150 DIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLE 209
               + ++S +  SY+  R F+ R+ IA   +   ++ +EL+  +F  G +S+L++ + +
Sbjct: 187 RGVLVTLVSDVAVSYMQIRGFQLRLGIARNNIASQRQTLELTEARFEAGLSSELAVAQQK 246

Query: 210 AEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPA 269
           A++ + E+ +P  E   R  +H +  LLG      L  + ++       +   +  G+P+
Sbjct: 247 AQLAATEATVPAFESGMRQAIHQLGVLLGGKPELLLEELLEEEPIPP--VPPGVPAGLPS 304

Query: 270 DLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDN---SFPGYNTHWSF 326
           DL+R RPDIR  E++LA + A IG+A + L+P  SL G++          F   + ++S 
Sbjct: 305 DLLRQRPDIRASERQLAAATASIGVATAQLFPQFSLTGTVGQQSMFSSKWFTPGSNYFSI 364

Query: 327 GPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKL 386
           GP +   IFD G+I+ NI+  ++  ++ + T+++T+L A+K+VE+AL + ++++     L
Sbjct: 365 GPSVSWAIFDAGRIRWNIKVQDARQEQAFHTYEKTILVALKDVEDALIAYSKEQDTRESL 424

Query: 387 QHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAI 446
           + AV+ ++++  +S   Y +G    L++LD +R     +   + +  +++   V LY A+
Sbjct: 425 KLAVDSNRRAYDISYELYAKGLVDFLNVLDAQRNLFVTQDQYAQSTLRVSADLVALYKAL 484

Query: 447 GSGYN 451
           G G++
Sbjct: 485 GGGWD 489


>gi|322421904|ref|YP_004201127.1| NodT family RND efflux system, outer membrane lipoprotein
           [Geobacter sp. M18]
 gi|320128291|gb|ADW15851.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Geobacter sp. M18]
          Length = 469

 Score =  199 bits (506), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 105/471 (22%), Positives = 195/471 (41%), Gaps = 26/471 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLL------PTQFSIGNSKNLINIDTLKWWE 54
           M     I S+    LAGC++ P Y++P  P+       P   S  +         LKW +
Sbjct: 1   MFRRIVILSIAGAFLAGCSMAPRYSRPDAPVPANWPTGPAYKSGASLTGETAAADLKWSQ 60

Query: 55  SFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKT 114
            F +  L KL+ +AL  N  +  A   +  ++      RAD  P+  A+ S         
Sbjct: 61  FFVNPQLQKLIDLALANNRDLRVAALNVEKSRAQFRIQRADQLPTVEAAGSGVVQRLPAG 120

Query: 115 NSTGQLDS------------DWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLI 161
            S                   ++ID FG+ R + + +L    +        ++++++++ 
Sbjct: 121 VSPTGQSVISRNYNLSLGLSSYEIDFFGRVRSLTDQALKQFLATEQARRSFQISLVAEVG 180

Query: 162 PSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPT 221
            +Y+     +ER+ +A   L+  K    L   + + GA+S+L L + +  + S   D+  
Sbjct: 181 NNYLTLAADRERLKLALDTLENQKAAYGLVQSRVSAGASSELDLRQAQTSVDSARVDVAR 240

Query: 222 LEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQ 281
                  + + ++ ++G      L      +      L      G+P+++++ RPD+   
Sbjct: 241 YTSLVAQDENLLTLVVGVQVPTELLPTGFSAVGNLRELPS----GVPSEVLQRRPDVMQA 296

Query: 282 EKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKG 338
           E +L  + A IG A++  +P ++LN SI    D     F   +  W F P+  LPIF+ G
Sbjct: 297 ELQLMAANANIGAARAAFFPRITLNTSIGTASDQLTGLFAPGSLAWGFVPQFTLPIFNYG 356

Query: 339 KIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMS 398
           + K+ +  AE         +++ + +A +EV +AL       + +   Q       +S  
Sbjct: 357 RNKAGLAVAERDRDISLARYEKAIQSAFREVADALALNGTVGEQLQAQQSLTNATSESYR 416

Query: 399 LSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           L+   Y  G  S L++LD ER+    +  L         + V LY  +G G
Sbjct: 417 LAQARYHGGVTSYLNVLDSERSFYTAQQGLISVNLARLSNLVTLYKVLGGG 467


>gi|148360025|ref|YP_001251232.1| outer membrane efflux protein [Legionella pneumophila str. Corby]
 gi|296108154|ref|YP_003619855.1| outer membrane efflux protein (RND multidrug efflux) [Legionella
           pneumophila 2300/99 Alcoy]
 gi|148281798|gb|ABQ55886.1| outer membrane efflux protein (RND multidrug efflux) [Legionella
           pneumophila str. Corby]
 gi|295650056|gb|ADG25903.1| outer membrane efflux protein (RND multidrug efflux) [Legionella
           pneumophila 2300/99 Alcoy]
          Length = 517

 Score =  199 bits (506), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 106/470 (22%), Positives = 212/470 (45%), Gaps = 23/470 (4%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLN 62
           +L+ +  L  ++L+ C VGP + +P         +   +          WW+ FND +L 
Sbjct: 1   MLKILALLSCLILSSCLVGPNFKEPKKDAANYWLTSSPAIKQSAFQNANWWKVFNDPTLT 60

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI------------P 110
            L+      NL++  A  R+  A+  +     +L+P   A +                 P
Sbjct: 61  VLIDNGYHNNLSLQMAGVRVLQARAQLAQSVGELYPQQQAMVGDYNYNRIGGNQLEGLLP 120

Query: 111 NLKTNSTGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                ++    + W++D +G+ R  I+S+ A   ++ A  D A + + S +  ++I  R 
Sbjct: 121 PDFLTASLGFSASWELDFWGKYRRAIQSNDALFLASLAAYDSALVTLTSDIASTFIKIRT 180

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
            +E I +    + +   +++++  +++ G TS L + +   E+   ++ +P      +  
Sbjct: 181 SEELIKVTKANIQVQAMSLKIAKDRYSGGQTSLLDVEQAATELAETQAKLPQYVSDLQHQ 240

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
              ++ LLG    +    ++K      P     + +GIP ++I  RPD+     +     
Sbjct: 241 KDILAVLLGTTPDKVDDLLKKNKG--IPKASAVVEVGIPKEVIARRPDVYQARMEAIAQS 298

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHDNS--------FPGYNTHWSFGPKLYLPIFDKGKIK 341
           A IG  K++LYPSLSL G+     +N         F   N +   GP L   + + G+I 
Sbjct: 299 AAIGAVKANLYPSLSLVGTFVFASNNIGSSTISDIFDWSNRNIVAGPSLTWSLLNYGQIT 358

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           + +R  +++ Q+  + +   VL   +EV++ +T   E +K V+ L+ A     +S  L++
Sbjct: 359 NAVRAQDAAFQQALLNYLNLVLKVQQEVQDNITRYVEGQKTVSSLKTANASAIESTRLAL 418

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           + Y++G  +   +L+ E+   +V+  L  A  +LA S V LY ++G G+ 
Sbjct: 419 VRYKEGEANYTTVLNAEQQQLRVQTSLVNATGELALSLVGLYRSLGGGWQ 468


>gi|71153378|sp|Q93PU3|TTGI_PSEPU RecName: Full=Toluene efflux pump outer membrane protein ttgI;
           Flags: Precursor
 gi|14582626|gb|AAK69565.1|AF299253_5 outer membrane efflux pump component TtgI [Pseudomonas putida]
          Length = 470

 Score =  199 bits (506), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 103/471 (21%), Positives = 200/471 (42%), Gaps = 25/471 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQ-----FSIGNSKNLINIDTLKWWES 55
           M   +++    +++L GC++ P+Y +P  P+         +     +  I     K  E 
Sbjct: 1   MK-FKSLPMFALLMLGGCSLIPDYQQPAAPMQAQWPTGQAYGGQGDQRSIATALPKAKEF 59

Query: 56  FNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK-- 113
           F D +L +L+  AL+ N  +  A + + + +      RA+ FP+     S          
Sbjct: 60  FKDPALVRLLDAALENNRDLRIAAKNVESYRALYRIQRAERFPTLDGQASGNRTRLPDDL 119

Query: 114 ---------TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPS 163
                    +     L + +++DLFG+ R +   +L    +        ++ +I  +  +
Sbjct: 120 SPTGDSRIDSQYQVGLVTAYELDLFGRIRSLSNQALEKYLATEEAQRSVQIALIGDVATT 179

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y   R  +  + +    L  Y +++ +       G +S+L + +    +   ++      
Sbjct: 180 YFLWRTDQALLELTEATLTSYVESLAMIESSAWAGTSSELDVRQARTLVNQAQAQQALYT 239

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +    +V+ +  LLG      L      + +    +      G+PADL+ NRP IR  E 
Sbjct: 240 RRIAQDVNALELLLGSKIPTDLPKNSPLAMSALGKVP----AGLPADLLLNRPRIRSAEH 295

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKI 340
           +L  + A IG A++  +P +SL  S      +    F   +  WSF P++ +PIF+ GK+
Sbjct: 296 QLMAANANIGAARAAFFPRISLTASAGSASSDLDGLFNSGSDSWSFAPQISVPIFNAGKL 355

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
           ++N+  AE        T+++++  A +EV + L +     K ++     V+ +K   SL+
Sbjct: 356 RANLDYAELQKDVGVATYEKSIETAFREVADGLAARGTYGKQLSAQSELVDNYKAYFSLA 415

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
              Y QG  S L +LD +R     +  L   +     S V LY A+G G++
Sbjct: 416 QQRYDQGVDSYLTVLDAQRELFSSQQKLLNDQLDQINSEVQLYKALGGGWS 466


>gi|54296688|ref|YP_123057.1| hypothetical protein lpp0719 [Legionella pneumophila str. Paris]
 gi|53750473|emb|CAH11867.1| hypothetical protein lpp0719 [Legionella pneumophila str. Paris]
          Length = 479

 Score =  199 bits (506), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 121/476 (25%), Positives = 235/476 (49%), Gaps = 31/476 (6%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK--WWESFNDT 59
             L  +FS+  +   GCTVGP+Y +P + +     +    K + +   +   WW++F+D 
Sbjct: 3   RKLALLFSISCLF--GCTVGPDYQRPDIKIQEKWPTSKVEKKISSSAPVHLTWWKAFHDP 60

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASI--------------- 104
            L++ +  A   NL I  A  RI  A+       A+ +P    S                
Sbjct: 61  LLDRYINEAATNNLDIKAAEARIRQARAMKQISLANFYPQINGSASANSLQISKGTLEGI 120

Query: 105 -----SHRFIPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVIS 158
                ++  I   +       D+ W++DLFG+ RR +E+S A+L+ AY       L+ I+
Sbjct: 121 FANSPTYTLIDRNQWIYNLGFDAQWELDLFGKTRRKVEASKASLEEAYESRRTILLSTIA 180

Query: 159 KLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESD 218
           ++  SYI+ R  ++   IA + ++L +K + L   ++  G +S++ +   E ++K+ ES 
Sbjct: 181 EIARSYIELRGAQQLYGIAQKNVELQRKTLALVRQRYKAGVSSEVDVSLAEGQLKNTESV 240

Query: 219 IPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDI 278
           +P      ++N + I+ +LG      L  + K  +  +P     + +G+ +D++R RPDI
Sbjct: 241 LPNYITQIQVNAYQIAVMLGKDPQTILKDIAKIQSLPKP--PQKVPMGLRSDILRQRPDI 298

Query: 279 RYQEKKLADSVAKIGIAKSDLYPSLSLNG----SIALTHDNSFPGYNTHWSFGPKLYLPI 334
           R  E++LA +VA+IG+A +D +P  +L+       + + D  F   +  W  GP++ LPI
Sbjct: 299 RATERQLASAVAEIGVAVADFFPQFNLSVSNLAFQSTSVDTLFQSSSGFWLMGPQVSLPI 358

Query: 335 FDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHK 394
           F  G+I++N+   ++ AQ+  I +++ +L A++E ++AL   ++       L+ A+  +K
Sbjct: 359 FHGGQIRANVESKKAVAQQAAIQYKKIILQALQEAQSALVRYSQSLDTNHSLRAAIIANK 418

Query: 395 KSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +++  +   ++ G    L +L  E A    E     ++     + + LY A+G G+
Sbjct: 419 RAVQFAKKRFQYGEDDYLSLLQSEAALLNAETQEVNSEVSSLTALISLYKALGGGW 474


>gi|296388676|ref|ZP_06878151.1| putative outer membrane protein precursor [Pseudomonas aeruginosa
           PAb1]
          Length = 479

 Score =  199 bits (506), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 112/470 (23%), Positives = 227/470 (48%), Gaps = 25/470 (5%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKN----LINIDTLKWWESFNDTSL 61
            +  +  + L  C++GP++T+P  P          + N           +WW  F+D  L
Sbjct: 5   PLLLIASLALGACSLGPDFTRPDRPAPGDWSLQAAAGNPSHLAAAPLAAQWWTLFDDAQL 64

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK-------- 113
           N L++   + NL +  A  R+  ++    S+  D  PS  AS +++              
Sbjct: 65  NALLQRVQRANLDLRSAAARLQQSRAIRRSLGGDALPSVDASGNYQRQRTTSAGLFDPSG 124

Query: 114 -------TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
                   ++    D+ W++D +G+ RR +E++ A ++++  ++   +++V+++    YI
Sbjct: 125 KAGKGNYNHALAGFDASWELDFWGRVRRELEAADATVEASENELRDVQVSVLAEAARDYI 184

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
             R  + R +I    L+  + ++EL+  +   G  + L + +  A++ S+E+ +P +EK+
Sbjct: 185 QLRGEQSRAAIIRDNLETARHSLELTRTRLANGVATDLEVAQALAQVASMEARLPEVEKN 244

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
               V+ +  L+G      L  +       +P     + +G+P++L + RPDIR  E +L
Sbjct: 245 QAHLVNALGYLVGASPGSLLAELGPAREIPRP--PGSVPVGLPSELAQRRPDIRRAEARL 302

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHDNSF---PGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG+AK+D YP ++LNG+               +  ++ GP   LPIF+ G+++ 
Sbjct: 303 HAATASIGVAKADFYPRITLNGNFGFESLQLSSLGDWDHRQFAIGPAFSLPIFEGGRLRG 362

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            +   E+  QE  I +Q TVL A +EV++A+     +++   +L  AV  +++++  +  
Sbjct: 363 RLELREAQQQEAAIDYQRTVLRAWQEVDDAMHDYAANQRRQERLGEAVAQNRRALQSARE 422

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            YR G    L +LD +R     +     +   ++ + V+LY A+G G++P
Sbjct: 423 QYRAGAVDFLSVLDSQRQLLDNQEQQVASDEAVSLTLVNLYKALGGGWSP 472


>gi|107102387|ref|ZP_01366305.1| hypothetical protein PaerPA_01003449 [Pseudomonas aeruginosa PACS2]
          Length = 479

 Score =  199 bits (506), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 111/470 (23%), Positives = 227/470 (48%), Gaps = 25/470 (5%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKN----LINIDTLKWWESFNDTSL 61
            +  +  + L  C++GP++T+P  P          + N           +WW  F+D  L
Sbjct: 5   PLLLIASLALGACSLGPDFTRPDRPAPGEWSLQAAAGNPSHLTAAPLAAQWWTLFDDAQL 64

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK-------- 113
           N L++   + NL +  A  R+  ++    S+  D  PS  AS +++              
Sbjct: 65  NALLQRVQRANLDLRSAAARLQQSRAIRRSLGGDALPSVDASGTYQRQRTTSAGLFDPSG 124

Query: 114 -------TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
                   ++    D+ W++D +G+ RR +E++ A ++++  ++   +++V+++    YI
Sbjct: 125 KAGKGNYNHALAGFDASWELDFWGRVRRELEAADATVEASENELRDVQVSVLAEAARDYI 184

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
             R  + R +I    L+  ++++EL+  +   G  + L + +  A++ S+E+ +P +EK+
Sbjct: 185 QLRGEQNRAAIIRDNLETARRSLELTRTRLANGVATDLEVAQALAQVASMEARLPEVEKN 244

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
               V+ +  L+G      L  +       +P     + +G+P++L + R DIR  E +L
Sbjct: 245 QAHLVNALGYLVGASPGSLLAELGPARAIPRP--PGSVPVGLPSELAQRRTDIRRAEARL 302

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHDNSF---PGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG+AK+D YP ++LNG+               +  ++ GP   LPIF+ G+++ 
Sbjct: 303 HAATASIGVAKADFYPRITLNGNFGFESLQLSSLGDWDHRQFAIGPAFSLPIFEGGRLRG 362

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            +   E+  QE  I +Q TVL A +EV++A+     +++   +L  AV  +++++  +  
Sbjct: 363 RLELREAQQQEAAIDYQRTVLRAWQEVDDAMHDYAANQRRQERLGEAVAQNRRALQSARE 422

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            YR G    L +LD +R     +     +   ++ + V+LY A+G G++P
Sbjct: 423 QYRAGAVDFLSVLDSQRQLLDNQEQQVASDEAVSLTLVNLYKALGGGWSP 472


>gi|167621140|ref|ZP_02389771.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia thailandensis Bt4]
          Length = 456

 Score =  199 bits (505), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 104/459 (22%), Positives = 200/459 (43%), Gaps = 30/459 (6%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIG------------NSKNLINIDTLKWWESFNDTSLNKL 64
           GCT+ P Y +P  P+     + G             S N      + W E F D  L +L
Sbjct: 1   GCTLAPRYERPAAPVSGAFPTDGVYAAQPGAAAGARSANGQAAVDIGWREFFVDPRLQRL 60

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSS-----------YASISHRFIPNLK 113
           ++IAL+ N  +  +   + A++      RA LFP+             A +S    P + 
Sbjct: 61  IEIALKNNRDLRVSVLNVEASRAQYRITRAGLFPTLDGTGTGTIQRTPAGVSVTGQPLIS 120

Query: 114 TNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                 + + W++DLFG+ + + + +LA   +       A++++++ +   Y+      +
Sbjct: 121 RTYNVGVSASWELDLFGRVQSLKDQALAQYFATAQARKAAEISLVASVADQYLTLLSTDD 180

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + +    L   + + +L+ L+F  G  S+L L + +  +++  ++     ++    V+ 
Sbjct: 181 LLQVTENTLKTARASYDLTKLQFDNGTGSELDLRQAQTVVETALANQQAQARARAQAVNA 240

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G P  + L      +     NL   I  G+P+DL+  RPDI   E+ L  + A I
Sbjct: 241 LVLLIGEPLPDDLPAGLPLNA---QNLLTDIPAGLPSDLLTRRPDIMQAEETLRAANANI 297

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL G+           F      WSF P + LPIF+ G+  +N+  A  
Sbjct: 298 GAARAAFFPKISLTGAFGTASPTLGGLFKAGTAAWSFAPSIALPIFEGGQNIANLDLAHV 357

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             + +   +++ + +A +EV + L +     + +  L+      ++   LS + Y+ G  
Sbjct: 358 QKRIEIANYEKAIQSAFREVSDGLAARGTYDQQIAALERNEHAQQRRYDLSDLRYKNGVD 417

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGS 448
           S L +L  +      +  L  A+     + VDLY A+G 
Sbjct: 418 SYLSVLTAQTDLYSAQQQLISARLARWTNLVDLYRALGG 456


>gi|194291260|ref|YP_002007167.1| outer membrane protein [Cupriavidus taiwanensis LMG 19424]
 gi|193225095|emb|CAQ71106.1| putative outer membrane protein [Cupriavidus taiwanensis LMG 19424]
          Length = 494

 Score =  199 bits (505), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 113/465 (24%), Positives = 195/465 (41%), Gaps = 27/465 (5%)

Query: 11  FIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLIN--------IDTLKWWESFNDTSLN 62
              +L GCT+ P Y +P  P+  +  +                    + W E F D  L 
Sbjct: 11  VAGVLTGCTLAPHYDRPAPPVADSFPTAPEGYATAEVKSGETRRAADIGWREFFRDPRLQ 70

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISH--------------RF 108
            L+  +L  N  +  A  RI  A+      RADL P+   +  +                
Sbjct: 71  ALIATSLDNNRDLRTAALRIEEARATYQVQRADLLPTVNVNGGYTRARTTAAEAATVLGQ 130

Query: 109 IPNLKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
               +    G   S +++D FG+ R +  ++LA   +       A+++++S++  +Y+  
Sbjct: 131 PGVTEVYQVGLGISSYELDFFGRVRSLSNAALAQYFATEEARRSAQISLVSEVAKAYLAE 190

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
           R + E+  +A   L   +    L+  +F  GATS L L   E+ +         L +   
Sbjct: 191 RAYAEQYELARDTLKARESTYGLAKQRFEAGATSALDLRDNESLVAQARVAAAQLARQRA 250

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
              + +  L+G P     +  +    + +  +      G+P+DL+  RPDIR  E++L  
Sbjct: 251 QAHNALEVLVGKPIGTIENLPEPMRLSDERIISDIPP-GLPSDLLEQRPDIRQAEQQLLS 309

Query: 288 SVAKIGIAKSDLYPSLSLNG---SIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNI 344
           + A IG A++  +P +SL     +I+ T    F      WSF P+L LPIFD G+  SN+
Sbjct: 310 ANANIGAARAAFFPRISLTTSVGTISPTFSGLFDAGTRAWSFAPQLTLPIFDYGRNLSNL 369

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
             A      Q   +++T+  A  EV +AL +    +  V   +           L+ + +
Sbjct: 370 DLANVRKNIQIANYEKTIQTAFAEVADALVARGTLEDQVAGQEQVRNAEAARYELARLRF 429

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           R G  S LD LD +R     E  L  A++    + +DLY ++G G
Sbjct: 430 RSGVASYLDELDAQRQLFTAEQALVQARQLRLNNAIDLYRSLGGG 474


>gi|146342522|ref|YP_001207570.1| multidrug efflux system outer membrane subunit [Bradyrhizobium sp.
           ORS278]
 gi|146195328|emb|CAL79353.1| putative multidrug efflux system, outer membrane subunit (efflux
           pump component) (TolC family) [Bradyrhizobium sp.
           ORS278]
          Length = 495

 Score =  199 bits (505), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 135/463 (29%), Positives = 228/463 (49%), Gaps = 20/463 (4%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
               L   LLAGC VGP+Y  P     P ++S   ++    +   +WW +  D  L++L+
Sbjct: 10  LALCLASPLLAGCAVGPDYVTPDF-GTPARWSSDRNQPAQQLRLAQWWRNLGDAPLDQLI 68

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI-------------PNL 112
             A+  NL +  A  RI  A+         LFP+   + S                 P  
Sbjct: 69  GEAVSGNLDVAAAKARIREARATQRQAVGALFPTVSGTSSATETRSAGSTTAGIAIAPTT 128

Query: 113 KTNSTGQLDSDWKID-LFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
            +      DS W++D     RR +E++   +D+A   +    L +I  +  +YIDAR ++
Sbjct: 129 SSQFQAGFDSSWELDLFGANRRAVEAASYGVDAAKDDLRATLLTLIGDVASNYIDARAYQ 188

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
            R+++A +     ++   L+  K   G+ S +   K  A   S E+ IPT E S++  +H
Sbjct: 189 ARVALAQRTAASQRETAALTARKQEAGSASAVDTAKASALAASTEATIPTYESSYQQALH 248

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
            +  LLG   T     + +      P   +P   GIPAD++  RPDIR  E++LA   AK
Sbjct: 249 RLGVLLGRDPTALSQRLSRSLPIPAPRRPLPK--GIPADVLVMRPDIRKAERQLAQFTAK 306

Query: 292 IGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
           IG A + LYP +SL G+++ +     +        WS GP L +PIF+ GK+++ +  AE
Sbjct: 307 IGQATAALYPDISLTGTVSTSALKLGDLGKSSTIGWSIGPSLSVPIFNGGKLQAAVEVAE 366

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           +   E ++ W+  VL+A+++VENA+ ++ +++  +  L  +   + ++  LS   Y+ G 
Sbjct: 367 AQRDEYHVAWRSAVLSALEDVENAIVNLGQERLRIRSLTESARRYNEAARLSRGLYQTGS 426

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            + LD+LD ER+    E  L  ++  LAK+YV L  A+G G++
Sbjct: 427 STFLDVLDAERSQFTAEDSLLASRAALAKNYVALAKALGGGWS 469


>gi|110597328|ref|ZP_01385616.1| RND efflux system, outer membrane lipoprotein, NodT [Chlorobium
           ferrooxidans DSM 13031]
 gi|110341164|gb|EAT59632.1| RND efflux system, outer membrane lipoprotein, NodT [Chlorobium
           ferrooxidans DSM 13031]
          Length = 478

 Score =  199 bits (505), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 106/481 (22%), Positives = 211/481 (43%), Gaps = 33/481 (6%)

Query: 1   MNILRAI-FSLFIVLLAGCTVGPEYTKPHMPL-------------LPTQFSIGNSKNLIN 46
           MN    + F L    L+ C++ P Y +P  P+              PT  S    ++   
Sbjct: 1   MNTKLLLPFFLAATTLSACSIAPTYVRPTAPVTKEWPVASGIGTMPPTAPSSTAPQSGEQ 60

Query: 47  I--DTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASI 104
                + W   F    L  +++ +L  N  +  AT  I AA+      R+DL PS  AS 
Sbjct: 61  PRTTDIGWRSMFRSPKLQSIIEESLTNNRDLRIATLNIEAARHTYRIQRSDLLPSINASG 120

Query: 105 SHRFIPN---------LKTNSTGQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKL 154
           S     +           T + G   + +++DLFG+ R + +       +       A+ 
Sbjct: 121 SFTRQESRNGTGQAEITSTYTAGIGTTAYELDLFGRVRSLSNRAINQYLATEEGRKAAQT 180

Query: 155 NVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKS 214
           ++++++  +Y+      E + +    L       +L    F  GA S+L + +    ++S
Sbjct: 181 SLVAEVANAYLTYLADVELLRLTESTLKTRLDGFDLIKRSFDLGAKSRLDVAQAATLVES 240

Query: 215 IESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRN 274
              +    ++    + + ++ L+G      L   Q  ++     +   + +GIP+ ++ +
Sbjct: 241 ARVNRAQYQRQVEQDRNALTLLVGKEIDPKLLEPQPLADL---QILNTLPVGIPSVVLLD 297

Query: 275 RPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTH----WSFGPKL 330
           RPDIR  E  L    A IG A++ L+PS+SL GS      +    + T+    WSF P++
Sbjct: 298 RPDIRQAEFSLKAENANIGAARASLFPSISLTGSAGFASASLSDLFVTNSSGLWSFAPQV 357

Query: 331 YLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAV 390
            LPIF  G+++SN++ AE++       +++ +  A +EV +AL +     + +   +  +
Sbjct: 358 TLPIFQGGRLRSNLKLAETNRDIALARYEKAIQTAFREVADALVARATWTEQLRAQRALL 417

Query: 391 ELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +   ++ +++   Y  G  S   +LD +R+  + + +  +  +Q   + +DLY A+G G+
Sbjct: 418 KESDQTSTITKARYEHGIDSYFALLDAQRSLFEAQQNEILIHQQTLANMIDLYKALGGGW 477

Query: 451 N 451
            
Sbjct: 478 Q 478


>gi|218259564|ref|ZP_03475264.1| hypothetical protein PRABACTJOHN_00923 [Parabacteroides johnsonii
           DSM 18315]
 gi|218225009|gb|EEC97659.1| hypothetical protein PRABACTJOHN_00923 [Parabacteroides johnsonii
           DSM 18315]
          Length = 456

 Score =  199 bits (505), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 110/459 (23%), Positives = 222/459 (48%), Gaps = 17/459 (3%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
           NI   +     + L+ C +G +Y +P + L      I    +  +ID++ W   + DT+L
Sbjct: 4   NIYVFMVLSLTLALSSCKIGKKYARPELDLPE---EIVAGADTASIDSIPWQSLYADTTL 60

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHR--------FIPNLK 113
            +L+ IAL  N  +  A  +I           A+ FP   A I  +          P   
Sbjct: 61  QRLITIALDNNKDMKIAAAKIKEMIATKRITFAEQFPEIGARIYGQKERLNYGGDDPKPD 120

Query: 114 TNSTGQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                +L   W++DL+G  R    + +A    +       ++ +++++  +Y +     +
Sbjct: 121 PEYGAKLTLSWELDLWGNLRWANEAGIAAYLQSVEARRALQMTLVAEVAAAYYELCALDQ 180

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
             +I    L   ++ + L+ L+F  G TS+ S  + + E+   E+ +P+LE+  ++  ++
Sbjct: 181 EQAIVRHTLAARREGVRLAKLRFEGGLTSETSYSQAQVELARTETLLPSLEQKIKIKEND 240

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +S LLG  + +    + +  +  + +L   + +G+P+ L+  RPD+R  E+KL ++ A++
Sbjct: 241 LSFLLGQYSGD----VPRGLSLREQHLPATLPVGLPSSLLERRPDMRQAEQKLREANARV 296

Query: 293 GIAKSDLYPSLSLNGSIALTHDNSFPG-YNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           G+A++DL+P +SL G++   ++       +  W     L  P+F  GK K+ ++ A +  
Sbjct: 297 GVAQTDLFPKISLTGNLGFENEELTNFIKSPAWFLAGDLLQPLFAMGKNKAKLKAARARY 356

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           +++   +Q++VL A KEV NA+ +I + K++    +  +      + L+ + Y  G  S 
Sbjct: 357 EQEVYNYQKSVLGAFKEVGNAIITIRKAKEVRLSYERLLNAADTYLQLAQLQYINGVTSY 416

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +D+LD +R     ++ L+ A      S V LY A+G G+
Sbjct: 417 MDVLDAQRGLLDAQLSLNKAMLDELLSTVYLYKALGGGW 455


>gi|113869666|ref|YP_728155.1| outer membrane efflux protein [Ralstonia eutropha H16]
 gi|113528442|emb|CAJ94787.1| outer membrane efflux protein [Ralstonia eutropha H16]
          Length = 495

 Score =  199 bits (505), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 120/465 (25%), Positives = 202/465 (43%), Gaps = 27/465 (5%)

Query: 11  FIVLLAGCTVGPEYTKPHMPLL------PTQFSIGNSKNLIN--IDTLKWWESFNDTSLN 62
              +L GCT+ P Y +P  P+       P  ++   +K+        + W E F D  L 
Sbjct: 11  VAGVLTGCTLAPHYDRPAPPVADSFPVAPEGYATAEAKSGETRRAVDIGWREFFRDPRLQ 70

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN----------- 111
            L+  +L  N  +  A  RI  A+      RADL P+  A+ ++                
Sbjct: 71  SLIATSLDNNRDLRTAALRIEEARALYQVQRADLLPTVNANAAYTRASTNAAGTSTVLGQ 130

Query: 112 ---LKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
               +        S +++D FG+ R +  ++LA   S       A ++++S++  +Y+  
Sbjct: 131 PGVTQVYQANLGISSYELDFFGRVRSLSNAALAQYFSTEEAHRSAYISLVSEVAKAYLSE 190

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
           R F E+  IA   L   +    L+  +F  GATS L L   E+ +         L +   
Sbjct: 191 RSFAEQYEIARDTLKARESTYGLAKQRFDVGATSALDLRDNESLVAQARVAAAQLARQRA 250

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
              + +  L+G P     +  +    +    +   I  G+P+DL+  RPDIR  E++L  
Sbjct: 251 QAQNALEVLVGKPIGSIGNLPEPMRLS-DERIISDIPAGLPSDLLEQRPDIRQAEQQLLS 309

Query: 288 SVAKIGIAKSDLYPSLSLNG---SIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNI 344
           + A IG A++  +P ++L     +I+ T  N F      WSF P+L LPIFD G+ KSN+
Sbjct: 310 ANANIGAARAAFFPRITLTTSVGTISPTFSNLFDAGTKAWSFAPQLTLPIFDYGRNKSNL 369

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
             A      Q   +++T+  A  EV +AL +    +  V+  +           L+ + +
Sbjct: 370 DLANVRKNIQIANYEKTIQTAFAEVADALVARGTLEDQVSGQEEVRNAEAARYELARLRF 429

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           R G  S LD LD +R     E  L  A++    + +DLY ++G G
Sbjct: 430 RSGVASYLDELDAQRQLFTAEQALIQARQLRLNNAIDLYRSLGGG 474


>gi|153003440|ref|YP_001377765.1| RND efflux system outer membrane lipoprotein [Anaeromyxobacter sp.
           Fw109-5]
 gi|152027013|gb|ABS24781.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Anaeromyxobacter sp. Fw109-5]
          Length = 483

 Score =  199 bits (505), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 106/451 (23%), Positives = 195/451 (43%), Gaps = 20/451 (4%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGNSKNLINID-TLKWWESFNDTSLNKLVKIALQQNLTI 75
           GCT+ P Y +P  P+     +             L W + F D  L  LV +AL+ N  +
Sbjct: 20  GCTLAPRYQRPPAPVAEAWEAGSTPAAAGPAAADLGWRDVFGDERLRALVALALENNRDL 79

Query: 76  LQATERINAAKENILSVRADLFPSSYASISHRFIP------------NLKTNSTGQLDSD 123
             A   +  A+      RA+L P+  AS S                      + G   + 
Sbjct: 80  RVAALNVELARAQHRIQRAELLPAVGASASVTRQHLGEDLSPTGEAQTTTGYTVGVGVAA 139

Query: 124 WKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILD 182
           +++DLFG+ R + ++      +       A L++++++   Y+ AR   +++++A Q L+
Sbjct: 140 FELDLFGRVRSLSAAALERYLATEEARRAAHLSLVAEVATQYLSARALDDQVALARQTLE 199

Query: 183 LYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPAT 242
             +  + L+   F  G TS+L L   EA++++   ++           + +  L+G    
Sbjct: 200 TVESALALTRRTFEAGKTSELDLRIAEAQVQTSRFNLSRALLLRAQAQNALVLLVGEALP 259

Query: 243 EFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPS 302
             L   Q         L   +  G+P++++R RPDI   E  L  + A IG A++  +PS
Sbjct: 260 AELPPPQPLETQA---LLAELPPGVPSEVLRRRPDILAAEHALRSANASIGAARAAFFPS 316

Query: 303 LSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQ 359
           +SL      +       F    T WSF P++ LP+F  G +++++  A      +   ++
Sbjct: 317 ISLTAFGGTSSPELSGLFGAGATTWSFTPRVNLPLFTGGALRASLDVAHLRKSIEVAQYE 376

Query: 360 ETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIER 419
             +  A +EV +AL +     + +   +   E  ++   LS + YR+G  S L +LD +R
Sbjct: 377 RAIQGAFREVADALVARAALDEQLEAQRARTEAEQRRYDLSELRYRKGVDSYLGVLDAQR 436

Query: 420 ATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
                   L  ++     + VDLY A+G G+
Sbjct: 437 ELFAARQLLIQSRLARLVNLVDLYRALGGGW 467


>gi|242239928|ref|YP_002988109.1| RND efflux system, outer membrane lipoprotein, NodT family [Dickeya
           dadantii Ech703]
 gi|242131985|gb|ACS86287.1| RND efflux system, outer membrane lipoprotein, NodT family [Dickeya
           dadantii Ech703]
          Length = 465

 Score =  199 bits (505), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 105/468 (22%), Positives = 207/468 (44%), Gaps = 24/468 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINID-----TLKWWES 55
           M ++  I +  ++LL+GCT+ P Y +P  P +P  +  G +    +        + W E 
Sbjct: 1   MRVIAGIVT-GVMLLSGCTLAPHYQRPSAP-VPENWPQGAAYQTASPAGRAANDIPWREV 58

Query: 56  FNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTN 115
             D  L ++V +AL  N ++ +A   + AA+      RADL PS  A++       L ++
Sbjct: 59  MVDARLRQVVDMALSDNRSLRKAIADMEAARALYGEQRADLAPSLNATLDGTRSRALNSS 118

Query: 116 STGQLDSDWK----------IDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSY 164
            +G   S             +DLFG+ R +  ++L    ++       +L +I+    ++
Sbjct: 119 GSGTSLSQSYSAGLSVSAFSLDLFGKNRSLTGAALETYLASAETATSTRLTLIADSATAW 178

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           +     +  +++A Q +    +++ ++  +   G  S + + + E   +   +D+ +   
Sbjct: 179 VTLATARSDLALARQTMASAGQSLAVTRSRQRNGVASAVDVAQSETVYQQARADVASALT 238

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
           +   + + +  L G P  E    +   S         P+  GI + ++  RPD++  E  
Sbjct: 239 TEAQSRNALDLLAGRPVPE---ALLPDSLESVSGAVAPVAAGISSTVLLRRPDVQAAEHT 295

Query: 285 LADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIK 341
           L  + A IG A++  +PS++L  S  +      + F   +  WS  P + LPIFD G   
Sbjct: 296 LKSANANIGAARAAFFPSITLTASNGIGSSELSSLFRHGSRVWSVVPGVSLPIFDGGANL 355

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           S +R AE+  +    ++++ V  A  +V +AL       +  +  Q  V   ++S  L+ 
Sbjct: 356 SALRYAEAEKKGYIASYEKAVQTAFSDVADALARKGTLAEQQSAQQDYVSAAQRSYQLAS 415

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
             YR+G  + L++LD +R        L   ++    + + LY A+G G
Sbjct: 416 SRYREGVDTYLNVLDAQRTLYSARQSLISLEQSRLNNLITLYNALGGG 463


>gi|114320563|ref|YP_742246.1| RND efflux system outer membrane lipoprotein [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|114226957|gb|ABI56756.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Alkalilimnicola ehrlichii MLHE-1]
          Length = 488

 Score =  199 bits (505), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 116/473 (24%), Positives = 220/473 (46%), Gaps = 25/473 (5%)

Query: 3   ILRAIFSLFIVL-LAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
           + +AI +L  VL LAGC VGP+Y  P M L           +      + WW+ F+D +L
Sbjct: 1   MRKAITALAAVLILAGCAVGPDYQAPEMDLPEAWPESSLLADGERAAWVDWWKRFDDPTL 60

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTN------ 115
           N+LV+ A+  NL I     R+  A+  +    A+  P+              T       
Sbjct: 61  NQLVERAVANNLDIRLQAARLEEARARLGMASAEQLPTVDLQAEAARERGPATLQPAFPG 120

Query: 116 ----------STGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSY 164
                      +      ++IDLFG+  R  E++ A L       D  +LN+I+ ++ +Y
Sbjct: 121 VEPRARTDNLFSVSGVLGYEIDLFGRLAREREAAEAFLLENVFSQDAVRLNLIADVVTTY 180

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
            D R  +++++I    L   ++   L  +++  G T +L+L + EAE++S  ++IP  ++
Sbjct: 181 FDLRAAQQQLAITENTLVSREETYALERVRYEAGETDELTLRQAEAELQSTRAEIPLRQE 240

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQP----NLYIPINIGIPADLIRNRPDIRY 280
                   +  L+G    E +   +     + P    +L   +   +P++L+  RPD+R 
Sbjct: 241 QVSTLEGVLGVLVGMSPAELMTLDEMDLGEYTPLEAIHLPEDLPATLPSELLERRPDVRA 300

Query: 281 QEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDK 337
            E +L  + A IG+A+++  P L+L   +     ++   F G    W  G  +  P+FD 
Sbjct: 301 AEAELMAATAAIGVAQAERLPRLNLTALLGTAATDTSDLFTGAAETWGLGSSVAGPLFDF 360

Query: 338 GKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSM 397
           G+ ++ +  AE+ A +    +Q TV++A  EV +AL+      +    ++  V   +++ 
Sbjct: 361 GRGRAGVEAAEAMAAQSRARYQATVISAFNEVRDALSLYRTSSQRAQAIRAQVAAVERTS 420

Query: 398 SLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            L+ + Y++G    +++LD +R+    E+ L+ A R    +   L+ A+G G+
Sbjct: 421 QLAELRYQEGFIGFIEVLDAQRSLLAAELALAEAVRDQLNATATLFKALGGGW 473


>gi|254235826|ref|ZP_04929149.1| hypothetical protein PACG_01767 [Pseudomonas aeruginosa C3719]
 gi|126167757|gb|EAZ53268.1| hypothetical protein PACG_01767 [Pseudomonas aeruginosa C3719]
          Length = 479

 Score =  199 bits (505), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 112/470 (23%), Positives = 228/470 (48%), Gaps = 25/470 (5%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKN----LINIDTLKWWESFNDTSL 61
            +  +  + L  C++GP++T+P  P          + N           +WW  F+D  L
Sbjct: 5   PLLLIASLALGACSLGPDFTRPDRPAPGEWSLQAAAGNPSHLAAAPLAAQWWTLFDDAQL 64

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK-------- 113
           N L++   + NL +  A  R+  ++    S+  D  PS  AS +++              
Sbjct: 65  NALLQRVQRANLDLRSAAARLQQSRAIRRSLGGDALPSVDASGTYQRQRTTSAGLFDPSG 124

Query: 114 -------TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
                   ++    D+ W++D +G+ RR +E++ A ++++  ++   +++V+++    YI
Sbjct: 125 KAGKGNYNHALAGFDASWELDFWGRVRRELEAADATVEASENELRDVQVSVLAEAARDYI 184

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
             R  + R +I    L+  ++++EL+  +   G  + L + +  A++ S+E+ +P +EK+
Sbjct: 185 QLRGEQNRAAIIRDNLETARRSLELTRTRLANGVATDLEVAQALAQVASMEARLPEVEKN 244

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
               V+ +  L+G      L  +       +P     + +G+P++L + RPDIR  E +L
Sbjct: 245 QAHLVNALGYLVGASPGSLLAELGPARAIPRP--PGSVPVGLPSELAQRRPDIRRAEARL 302

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHDNSF---PGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG+AK+D YP ++LNG+               +  ++ GP   LPIF+ G+++ 
Sbjct: 303 HAATASIGVAKADFYPRITLNGNFGFESLQLSSLGDWDHRQFAIGPAFSLPIFEGGRLRG 362

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            +   E+  QE  I +Q TVL A +EV++A+     +++   +L  AV  +++++  +  
Sbjct: 363 RLELREAQQQEAAIDYQRTVLRAWQEVDDAMHDYAANQRRQERLGEAVAQNRRALQSARE 422

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            YR G    L +LD +R     +     +   ++ + V+LY A+G G++P
Sbjct: 423 QYRAGAVDFLSVLDSQRQLLDNQEQQVASDEAVSLTLVNLYKALGGGWSP 472


>gi|20502696|gb|AAM22559.1| unknown [Aeromonas hydrophila]
          Length = 475

 Score =  199 bits (505), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 100/467 (21%), Positives = 214/467 (45%), Gaps = 25/467 (5%)

Query: 2   NILRAIFSLFI-VLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           N+ + + +L + +LL GC++ P+Y +P +P   T  S    +  ++     W + F D +
Sbjct: 6   NMTKTLITLSVTLLLGGCSMAPDYQRPELPQGATWQSNQTGEAAVS----SWRQQFLDPA 61

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL 120
           L +L+  AL+ N  +  A   + A +      RA   P+  A+ S          S+   
Sbjct: 62  LQQLIATALENNRDLRIAALNVEAYEARYRIQRAAQLPTLAANGSGSRQQGSDDLSSTGQ 121

Query: 121 ------------DSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
                        + +++DLFG+ + + + +L    +        ++ +++ +  +Y+  
Sbjct: 122 GTISSQYGANIGITAYELDLFGRIQSLKDQALETYLAQIETQRSTQIALVASVANAYLTL 181

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
              +E ++++   L   +++  L+  K+  GA S++ L +    ++S +  +   ++  +
Sbjct: 182 LADQELLALSEATLATEQESYGLTEHKYRLGAASEMELAQGRTALESAKVSLAQYQRQVK 241

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
            + + ++ LLG      +  +  +           I +G P+ L++ RPDI   E  L  
Sbjct: 242 QDRNGLALLLG----TGVPALMTEPATLAEVQLAAIPVGAPSSLLQQRPDILAAEHSLKA 297

Query: 288 SVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNI 344
           + A IG A++  +P++SL  +     +     F G    W+F P++ LPIFD GK  +++
Sbjct: 298 ANANIGAARAAFFPTISLTATAGTASNQLSGLFDGGTGTWTFMPQINLPIFDGGKRIADL 357

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
             AE S ++   ++++++  A KEV + L +  + ++ +   Q  V+  +    L+ + Y
Sbjct: 358 DVAEVSTKQAVASYEKSIQTAFKEVADTLGAQADYQQQLQAQQELVKASQTYFKLAEVRY 417

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            +G  S L  LD +R+    +  L   +     + V LY A+G G+ 
Sbjct: 418 EKGVDSYLTRLDAQRSLFSAKQGLITTRLAQLSNQVALYKAVGGGWQ 464


>gi|237724772|ref|ZP_04555253.1| outer membrane protein oprM [Bacteroides sp. D4]
 gi|229436967|gb|EEO47044.1| outer membrane protein oprM [Bacteroides dorei 5_1_36/D4]
          Length = 457

 Score =  199 bits (505), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 115/461 (24%), Positives = 214/461 (46%), Gaps = 16/461 (3%)

Query: 1   MN-ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDT 59
           M   L  I    + LL  C +G  YT+P +  LP Q      ++ ++I  ++WWE + DT
Sbjct: 2   MKHTLLYIAVSGMTLLTSCQLGKHYTRPDL-HLPQQLDTLQQQDTLSIADMQWWEIYTDT 60

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST-- 117
           +L  L++  L  N  +  A  R+           A+LFP        +   +    +   
Sbjct: 61  TLQSLIEKTLDNNKDMKIAAARVKELAAMKRIDFANLFPQLNGGAYAQKEGSNYGGNNYK 120

Query: 118 ------GQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                 G+L   W++DL+G  R   + S+A    +       K++++S++  +Y +    
Sbjct: 121 NDPELGGKLTVTWELDLWGNLRWAKDKSIAQFLGSIEAQRALKMSIVSEVAQAYFELVAL 180

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
              ++I  Q L   K+ + L+ L+F  G TS+ S  + + E     + +P LE+   +  
Sbjct: 181 DNELNIVRQTLYARKEGVRLAKLRFEGGLTSETSYQQAQVEYARTATLVPELERKISLKE 240

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           ++I+ L G       H +Q+     +  L   + +G+P+ L+  RPD+R  E+KL  + A
Sbjct: 241 NDIAFLAGEYP----HRIQRSILPEEVKLPETLPVGLPSTLLERRPDVREAEQKLIAANA 296

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNSFPGYN-THWSFGPKLYLPIFDKGKIKSNIRRAES 349
            +GIA ++++P LSL     +  +     +          L  P+F  GK ++ ++  ++
Sbjct: 297 SVGIAYTNMFPRLSLTAQYGVESEEFSDFFKSPIHYISGNLLTPLFAMGKYRATLQAKKA 356

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
           + +++  +++++VL A KE  NA+   N+ K I           K +M L+ + Y  G  
Sbjct: 357 AYEQECYSYEKSVLTAFKEARNAIVDFNKIKDIYESRLQLERSSKATMELAQLQYINGVI 416

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             LD+LD +R+    ++ LS A R    + V LY A+G G+
Sbjct: 417 GYLDVLDAQRSYFDAQIGLSNAIRDKQITLVKLYKALGGGW 457


>gi|331656597|ref|ZP_08357559.1| cation efflux system protein CusC [Escherichia coli TA206]
 gi|222032332|emb|CAP75071.1| Cation efflux system protein cusC [Escherichia coli LF82]
 gi|312945117|gb|ADR25944.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli O83:H1 str. NRG 857C]
 gi|331054845|gb|EGI26854.1| cation efflux system protein CusC [Escherichia coli TA206]
          Length = 460

 Score =  199 bits (505), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 110/464 (23%), Positives = 207/464 (44%), Gaps = 18/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK---NLINIDTLKWWESFN 57
           M+  + +     + L GC++ P+Y +P MP +P QFS+  +       N     W   F 
Sbjct: 1   MSPCKLLPFCLALALTGCSLAPDYQRPAMP-VPQQFSLSQNGLVNAADNYQNAGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS- 116
           D  +  L+  AL  N  +  A  ++  A+       AD +P      S  +  NLK +S 
Sbjct: 60  DNQVKTLISEALVNNRDLRMAALKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGDSA 119

Query: 117 -----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +  
Sbjct: 120 TTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       
Sbjct: 180 YAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +    Q Q+ N      + +  G+P+ ++  RPDI   E  L  + A
Sbjct: 240 NALQLLLG----SYGKLPQAQTVNSDSLQSVKLPAGLPSQILLQRPDIMEAEHALMAANA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  A
Sbjct: 296 NIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARTLYQHG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             S L++LD ER+       L         + + LY A+G G+ 
Sbjct: 416 AVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGWQ 459


>gi|148257444|ref|YP_001242029.1| multidrug efflux system outer membrane subunit [Bradyrhizobium sp.
           BTAi1]
 gi|146409617|gb|ABQ38123.1| putative multidrug efflux system, outer membrane subunit (efflux
           pump component) (TolC family) [Bradyrhizobium sp. BTAi1]
          Length = 504

 Score =  199 bits (505), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 133/451 (29%), Positives = 223/451 (49%), Gaps = 20/451 (4%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTIL 76
           GC VGP+Y  P    +P  +S    +    +   +WW +  D  L++L+  A+  NL + 
Sbjct: 17  GCAVGPDYVTPDF-GVPNSWSSDRGRPAPALKLAQWWHNLADPQLDQLITEAVGGNLDVA 75

Query: 77  QATERINAAKENILSVRADLFPSSYASISHRFI-------------PNLKTNSTGQLDSD 123
            A  RI  A+         LFPS   + S                 P   +      DS 
Sbjct: 76  SAKARIREARATQRQAIGALFPSISGTGSATETRSASSSTGGVAIGPTTYSQYQAGFDSS 135

Query: 124 WKID-LFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILD 182
           W++D     RR +E++   +D+A   +    L +I  +  +YIDAR ++ R+++A +   
Sbjct: 136 WELDLFGANRRAVEAASYGVDAADDDLRATLLTLIGDVASNYIDARAYQARVALAKRTAA 195

Query: 183 LYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPAT 242
             ++   L+  K   G+ S +   K  A   S E+ IPT E S++  VH +  LLG   T
Sbjct: 196 SQRETAALTERKQNAGSASAVDTAKANALAASTEATIPTYESSYQQAVHRLGVLLGRDPT 255

Query: 243 EFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPS 302
                + + +    P L +P   GIPAD++  RPD+R  E++LA   AKIG A + LYP 
Sbjct: 256 ALSLRLSRATVIPSPRLPLPK--GIPADVLVMRPDVRKAERQLAQYTAKIGQATAALYPD 313

Query: 303 LSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQ 359
           +SL+G+++ +     +        WS GP L +PIF+ GK+++ +  AE+   + ++ WQ
Sbjct: 314 VSLSGTVSTSALKLGDLGKNSTIGWSIGPSLSVPIFNGGKLQAAVEVAEAQRDQYHVAWQ 373

Query: 360 ETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIER 419
             VL+A+++VENA+ ++ +++  +  L  +   + ++  LS   Y  G  + LD+LD ER
Sbjct: 374 SAVLSALEDVENAIVNLAQERIRIRSLTESARRYSEAARLSRSLYETGSSTFLDVLDAER 433

Query: 420 ATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +    E  L  ++  LAK YV L  A+G G+
Sbjct: 434 SQFTAEDSLLASRATLAKDYVALAKALGGGW 464


>gi|15598033|ref|NP_251527.1| outer membrane protein precursor [Pseudomonas aeruginosa PAO1]
 gi|9948923|gb|AAG06225.1|AE004710_7 probable outer membrane protein precursor [Pseudomonas aeruginosa
           PAO1]
          Length = 479

 Score =  199 bits (505), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 112/470 (23%), Positives = 228/470 (48%), Gaps = 25/470 (5%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKN----LINIDTLKWWESFNDTSL 61
            +  +  + L  C++GP++T+P  P          + N           +WW  F+D  L
Sbjct: 5   PLLLIASLALGACSLGPDFTRPDRPAPGEWSLQAAAGNPSHLAAAPLAAQWWTLFDDAQL 64

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK-------- 113
           N L++   + NL +  A  R+  ++    S+  D  PS  AS +++              
Sbjct: 65  NALLQRVQRANLDLRSAAARLQQSRAIRRSLGGDALPSVDASGNYQRQRTTSAGLFDPSG 124

Query: 114 -------TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
                   ++    D+ W++D +G+ RR +E++ A ++++  ++   +++V+++    YI
Sbjct: 125 KAGKGNYNHALAGFDASWELDFWGRVRRELEAADATVEASENELRDVQVSVLAEAARDYI 184

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
             R  + R +I    L+  ++++EL+  +   G  + L + +  A++ S+E+ +P +EK+
Sbjct: 185 QLRGEQNRAAIIRDNLETARRSLELTRTRLANGVATDLEVAQALAQVASMEARLPEVEKN 244

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
               V+ +  L+G      L  +       +P     + +G+P++L + RPDIR  E +L
Sbjct: 245 QAHLVNALGYLVGASPGSLLAELGPARAIPRP--PGSVPVGLPSELAQRRPDIRRAEARL 302

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHDNSF---PGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG+AK+D YP ++LNG+               +  ++ GP   LPIF+ G+++ 
Sbjct: 303 HAATASIGVAKADFYPRITLNGNFGFESLQLSSLGDWDHRQFAIGPAFSLPIFEGGRLRG 362

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            +   E+  QE  I +Q TVL A +EV++A+     +++   +L  AV  +++++  +  
Sbjct: 363 RLELREAQQQEAAIDYQRTVLRAWQEVDDAMHDYAANQRRQERLGEAVAQNRRALQSARE 422

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            YR G    L +LD +R     +     +   ++ + V+LY A+G G++P
Sbjct: 423 QYRAGAVDFLSVLDSQRQLLDNQEQQVASDEAVSLTLVNLYKALGGGWSP 472


>gi|134095881|ref|YP_001100956.1| outer membrane transport protein involved in copper (silver)
           tolerance [Herminiimonas arsenicoxydans]
 gi|133739784|emb|CAL62835.1| Outer membrane protein oprM [Herminiimonas arsenicoxydans]
          Length = 474

 Score =  199 bits (505), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 112/466 (24%), Positives = 209/466 (44%), Gaps = 21/466 (4%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKN-LINIDTLKWWESFNDT 59
           M     +  L   +L+ C++ P+YT+P  P+     +   + +         W   F D 
Sbjct: 1   MIKQLTLTVLAASVLSACSMAPKYTRPDAPVAADYPAASAAADKQQRAHETGWRNFFPDQ 60

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL------- 112
            L  L+  AL  N  +  A  RI  A+       ADL P+   + +              
Sbjct: 61  RLQALIGAALANNRDLRVAALRIEEARAQYNIQSADLLPNLNGTFTGSRARTPASISPTG 120

Query: 113 -----KTNSTGQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYID 166
                     G   + +++D FG+   +  ++LA+  +       A +++++++  +Y+ 
Sbjct: 121 IDSVSSAYQVGLSLASFELDFFGRVHSLNDAALASYLATEEAQRAAHISLVAEVAKAYLA 180

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
            R F E++++A   L       +L+  +F  GA+S L L + EA ++S      TL +  
Sbjct: 181 ERAFAEQLALAQSTLKSRGTAYDLAKQRFEVGASSALDLRQNEALLQSARVAQVTLARQR 240

Query: 227 RMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLA 286
              ++ ++ L+G P T F       + N   ++      G+P+DL+  RPDIR  E+ L 
Sbjct: 241 AQALNALTLLVGQPLTGFPEAQPLSAQNIVTDIP----AGLPSDLLTQRPDIRSAEQSLL 296

Query: 287 DSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSN 343
            + A IG A++  +P +SL   I        N F      W+F P+L LPIFD G+  +N
Sbjct: 297 AANANIGAARAAFFPRISLTAGIGTASSTLSNLFDSGTRAWTFAPQLVLPIFDAGRNSAN 356

Query: 344 IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
           +  +E         +++++ +A +EV +AL + +  ++ +   +   E   + + L+   
Sbjct: 357 LTLSEVRKNIAIANYEKSIQSAFREVSDALVARDLLEEQIDAQRRVQEAQAERLKLADQR 416

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           ++ G  S LD+LD +R     E DL  A+     + +DLY ++G G
Sbjct: 417 FQNGIASSLDVLDAQRELFSAEQDLVQARLLRLTNAIDLYRSLGGG 462


>gi|77458749|ref|YP_348255.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           fluorescens Pf0-1]
 gi|77382752|gb|ABA74265.1| putative outer membrane efflux protein [Pseudomonas fluorescens
           Pf0-1]
          Length = 489

 Score =  199 bits (505), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 108/466 (23%), Positives = 212/466 (45%), Gaps = 27/466 (5%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK---WWESFNDTSLNKL 64
            SL + +L+ C VGP+Y +P    +         +     D+L    WWE + D  LN+L
Sbjct: 20  LSLCVAMLSACAVGPDYQRPQTAEIAQYKEAEGWRQANPSDSLARGAWWELYGDRQLNQL 79

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL------------ 112
           ++     N T+ Q+  +   A+  + S R   +PS   S                     
Sbjct: 80  IEKLNSSNQTVAQSEAQYRQAQALVRSARGAFYPSVDLSAGKTRSSQGTGSSSSSLSSSS 139

Query: 113 ---KTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
              +     QL   W+ D++G+ RR +E++ A+  ++YA +   +L+  S+L+ +Y+  R
Sbjct: 140 SGIRDTYNAQLGVSWEADVWGKLRRGLEANEASAQASYADLAAMRLSQQSELVQNYLQLR 199

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
              ++  +    +  Y+++++++  ++  G + + ++ + + ++K+ + D+  L      
Sbjct: 200 VIDQQKRLLESTVAAYERSLKMTMNQYNAGVSGRDAVAQAQTQLKTTQGDLVDLIWQRAQ 259

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
             + I+ L G P  EF     +            I + +P+ L+  RPDI   E+ +  +
Sbjct: 260 FENAIAVLTGQPPAEFNIAETQDIPKL-----PQIPLSLPSQLLERRPDIASAERSVIAA 314

Query: 289 VAKIGIAKSDLYPSLSLNG---SIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
            A IG+AK+  YP  SL+      + T  N     N  WS GPK+ LP+FD G   + + 
Sbjct: 315 NANIGVAKAAYYPDFSLSMSGGYSSSTSQNLISLPNRFWSVGPKMTLPLFDGGIRSAEVD 374

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
           R E+   +    +++TVL+  +EVEN L  +   +      Q A++  + S+ L+   Y+
Sbjct: 375 RTEAVYDQTVAKYRQTVLDGFREVENYLVQLKVYEDEAAVRQEALDAARDSLRLTENQYK 434

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            G  + LD++ ++      E  +    +    + V L  A+G G++
Sbjct: 435 AGVIAYLDVVTVQATALSNERTVLNILQSRLIASVQLIAALGGGWD 480


>gi|299137787|ref|ZP_07030968.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Acidobacterium sp. MP5ACTX8]
 gi|298600428|gb|EFI56585.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Acidobacterium sp. MP5ACTX8]
          Length = 480

 Score =  199 bits (505), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 116/468 (24%), Positives = 226/468 (48%), Gaps = 22/468 (4%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNL-----INIDTLKWWESF 56
           N    + ++F + L GC+VGP Y +P + +LP QF+  ++ ++      + D  ++W SF
Sbjct: 3   NRKSILATVFSLGLTGCSVGPHYKQPTL-VLPQQFTAPDTASVDVSPHADADDPEFWHSF 61

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI------- 109
           ND  L+ LV+ +L  N  +  A    ++A   +   + D +P+   S S           
Sbjct: 62  NDPELSSLVQRSLTANNDLRVALAHYDSANALLREAKFDRYPTVTMSTSVGRQKFGANQA 121

Query: 110 ---PNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
              P      T  +++ W++D FG+ R +IE+      +  + +   ++ V+ ++  +YI
Sbjct: 122 FGYPRNNRFFTPGINASWELDFFGRVRHNIEAQRQQTLADASNLAAMQVTVVGEVASTYI 181

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
           D R  +E + IA + ++  ++ + L    ++ G  ++    +  A +++  S IP L  +
Sbjct: 182 DLRGRQELLRIARENVENEQETVRLVEAAYSAGRGTEFDTSRARALLETTTSRIPELLSA 241

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
             ++ H ++ L G      +  ++       P+L   I++G PADL+R RPD+   E++L
Sbjct: 242 IALDEHRLAVLCGLSPEALVSELEVAKPL--PDLPQRIDLGTPADLVRRRPDVSASEERL 299

Query: 286 ADSVAKIGIAKSDLYPSLSLNGS---IALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
             +  +IGIA +DL+P ++  G         D  F G +        +     D+G++++
Sbjct: 300 HAATEQIGIATADLFPRVNFAGLLGLNEFHGDTPFDGVSAVNLAALNIDWSFLDRGRVRA 359

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            I    +    Q   +Q++VL A+++VENAL S    +    +LQ A    K++  L+ +
Sbjct: 360 RIAAKRADGDAQLAQYQQSVLLALEDVENALVSYARSQDRDVQLQLAANDSKRAADLASV 419

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            ++ G   LLD+LD +R   + E   + +    A S V LY ++  G+
Sbjct: 420 RFKNGATGLLDLLDAQRVQLQAEDAYAESHSNSAISAVLLYKSLAGGW 467


>gi|306812996|ref|ZP_07447189.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli NC101]
 gi|305853759|gb|EFM54198.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli NC101]
          Length = 460

 Score =  199 bits (504), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 110/464 (23%), Positives = 207/464 (44%), Gaps = 18/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK---NLINIDTLKWWESFN 57
           M+  + +     + L GC++ P+Y +P MP +P QFS+  +       N     W   F 
Sbjct: 1   MSPCKLLPFCVALALTGCSLAPDYQRPAMP-VPQQFSLSQNGLVNAADNYQNAGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS- 116
           D  +  L+  AL  N  +  A  ++  A+       AD +P      S  +  NLK +S 
Sbjct: 60  DNQVKTLISEALVNNRDLRMAALKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGDSA 119

Query: 117 -----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +  
Sbjct: 120 TTRELSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       
Sbjct: 180 YAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +    Q Q+ N      + +  G+P+ ++  RPDI   E  L  + A
Sbjct: 240 NALQLLLG----SYGKLPQAQTVNSDSLQSVKLPAGLPSQILLQRPDIMEAEHALMAANA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  A
Sbjct: 296 NIGAARAAFFPSISLTSVISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQTNLDIA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARALYQHG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             S L++LD ER+       L         + + LY A+G G+ 
Sbjct: 416 AVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGWQ 459


>gi|301309768|ref|ZP_07215707.1| outer membrane efflux protein [Bacteroides sp. 20_3]
 gi|300831342|gb|EFK61973.1| outer membrane efflux protein [Bacteroides sp. 20_3]
          Length = 459

 Score =  199 bits (504), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 109/459 (23%), Positives = 218/459 (47%), Gaps = 14/459 (3%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
           N   A F + ++  + C +G  Y +P + L     +  ++ +  +++ + W   + D +L
Sbjct: 5   NFYIAAFVVSMLAFSSCKIGKRYARPELNLPDRIEAYTDTTDTASVENIPWESLYADETL 64

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHR--------FIPNLK 113
             L+K AL  N  +  A  ++           A++ P   A+I  +          P   
Sbjct: 65  KDLIKKALDNNKDMKIAAAKVKEMIAAKRISFANMLPEVGANIYAQKERLNYGGDDPKPD 124

Query: 114 TNSTGQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                +L   W++DL+G  R    +++A+           +L +I+++  +Y       +
Sbjct: 125 PEFGAKLTLSWELDLWGNLRWANEATIASYMQTVEGQRALRLTIIAEVAANYYQLCALDQ 184

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            +SI  Q LD  ++ + L+ L++  G TS+ +  + + E+   E+ IP+LE+  ++   +
Sbjct: 185 ELSIVQQTLDARREGVRLAKLRYEGGLTSETAYNQAQVELARTETLIPSLERQIKIKESD 244

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +S LLG    E+   + +  +    +L   + IG+P+ L+  RPD+R  E KL  + A++
Sbjct: 245 LSMLLG----EYTDDIPRGLSLSDQHLPDALPIGLPSSLLERRPDMRQAEFKLRAANAQV 300

Query: 293 GIAKSDLYPSLSLNGSIALTHDNSFPG-YNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           G+A++DL+P + L  +     D       +        L  PIF  GK K+ ++ A++  
Sbjct: 301 GVAQTDLFPKIRLTSNYGFESDELSSILKSPAGFIAGSLLQPIFAMGKNKAKVKAAKARY 360

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           +++  +++++VL A KEV NA+ ++ + K+I     +      K + L+ + Y  G  S 
Sbjct: 361 EQEVYSYEKSVLGAFKEVNNAIVTVRKVKEIRASRMNLEASASKYLELAQLQYINGVISY 420

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +D+LD +R     ++ L+ A      S V LY A+G G+
Sbjct: 421 MDVLDAQRGLLDAQIGLNNAVLDELLSVVYLYKALGGGF 459


>gi|30249104|ref|NP_841174.1| Outer membrane efflux protein [Nitrosomonas europaea ATCC 19718]
 gi|30138721|emb|CAD85026.1| Outer membrane efflux protein [Nitrosomonas europaea ATCC 19718]
          Length = 476

 Score =  199 bits (504), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 124/468 (26%), Positives = 226/468 (48%), Gaps = 26/468 (5%)

Query: 5   RAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIG----------NSKNLINIDTLKWWE 54
           +  + L  V+L+GC VGP+Y +P +P +P  +             + + +      +WW+
Sbjct: 4   KIGWFLIAVILSGCAVGPDY-RPPLPGIPDSWQAEKEEIVEQQSLSVQPIDQQVLKEWWK 62

Query: 55  SFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKT 114
           +FND  L+ L+  AL  N  +  A  RI+ A+    ++RA LFP   A+ + +   N   
Sbjct: 63  NFNDPRLDSLIDQALSDNFDLKIALSRIDQARAERSAIRAGLFPGVNATANAQRSHNPFP 122

Query: 115 NSTGQLDSD---------WKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSY 164
                +  +         W+IDLFG+ RR +E++ A+LD+   Q   A + + + L  SY
Sbjct: 123 GFAPGIKFNLFELGFDALWEIDLFGRLRRQLEAASADLDAVNIQYSQALVTLTADLARSY 182

Query: 165 IDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEK 224
           I+ R F+ ++ I    L   +   EL+   F  G  ++   V+  A+ ++  + IP LE 
Sbjct: 183 IEYRSFQNQLRITRANLAAQQTTQELTEKLFKAGVGTRYDAVRARAQTETTRAQIPDLEG 242

Query: 225 SFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKK 284
           S    +  +  L G         + +   +  P       +  P   IR+RPD+   E++
Sbjct: 243 SLVAALRQLEMLTGQQPGALAAALSE--PDAVPMAPGRTILASPVATIRHRPDLHIAERR 300

Query: 285 LADSVAKIGIAKSDLYPSLSLNGS---IALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIK 341
           LA + A  G A ++L+P LSL+          D  F      ++    L  P+ + G+I+
Sbjct: 301 LAAATALQGAAIAELFPRLSLSAFLGLRNTELDALFKSAAFSYNTAAGLLQPLLNFGRIR 360

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           + I  A +  QE Y+T+++TVL A++E E ALT   +++     L  +V   ++++ LS 
Sbjct: 361 AGIDLANARQQETYLTFEKTVLEALQETETALTRYLKEEIRRQALARSVMDLREAVRLSQ 420

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           + ++ G  S LD+LD +R     E+DL+ ++ +++   + +Y  +G G
Sbjct: 421 LRFQVGTVSFLDVLDAQRTLYSAEIDLARSETKVSTDLITVYKTLGGG 468


>gi|301064154|ref|ZP_07204601.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [delta proteobacterium NaphS2]
 gi|300441774|gb|EFK06092.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [delta proteobacterium NaphS2]
          Length = 518

 Score =  199 bits (504), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 124/470 (26%), Positives = 234/470 (49%), Gaps = 22/470 (4%)

Query: 1   MNILRAIFSLFIVLLAGCTV-GPEYTKPHMPLLPTQFSIGNS--KNLINIDTLKWWESFN 57
           M        + + +L+GC + GP +  P  PL P       +  ++       +WWE FN
Sbjct: 1   MWQGSLFLWVVMAILSGCAMIGPNFNPPEAPLAPKWQETEGAYTRSDTKAYDSRWWEVFN 60

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSS--------YASISHRFI 109
           D  LNKL+++A QQNLT+  A  R+  A+  +  V   L+P          Y   S    
Sbjct: 61  DPVLNKLIELAYQQNLTLQIAGLRVLEARAQLGVVVGSLYPQVQQATGSYSYNRASGGGA 120

Query: 110 PNLKTNSTGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
               + ++   D+ W++D +G+ R  I+S+ ANL +  A  D A + + +++  +Y+  R
Sbjct: 121 EPYFSGASIGFDAGWELDFWGKFRRSIQSADANLMANMAGYDDALVTLTAEVARAYVQIR 180

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
            F+ERI +A + + + K+ +E+S  +F  GA S+L + +    + +  + +P  +   R 
Sbjct: 181 TFEERIRLAEENIRIQKRALEISEARFKSGAVSELDVQQARTLLNTTRAAVPAFQILLRQ 240

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
             H +S LLG P  +    ++       P+  + + +G+PADL++ RPDIR  E +    
Sbjct: 241 TQHALSVLLGMPPQDLDGLLE--GPRIIPDAPVQVAVGVPADLLKRRPDIRQAELQAVAQ 298

Query: 289 VAKIGIAKSDLYPS--------LSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKI 340
            ++IG+AK+DL+PS         S   +   +  + F   +  +S GP     +F+ G+I
Sbjct: 299 CSRIGVAKADLFPSISLLGSLGWSTTDAGRSSLGDLFQSSSFGFSVGPSFQWNLFNYGRI 358

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
            +++R  ++  Q+    ++ TVLNA +EVE+A+T     K      + +V+  +++  +S
Sbjct: 359 TNSVRVQDARFQQTLTLYRNTVLNAAREVEDAMTGFMRSKIQAVYQEESVKAAQRTSEIS 418

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +I Y  G  +   +L   ++ ++ +   +  K  +A + V +Y A+G G+
Sbjct: 419 LIQYTAGTIAYESVLTSTQSLSQQQDQYAQTKGNIALNLVAMYKALGGGW 468


>gi|224538024|ref|ZP_03678563.1| hypothetical protein BACCELL_02913 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224520371|gb|EEF89476.1| hypothetical protein BACCELL_02913 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 457

 Score =  199 bits (504), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 103/463 (22%), Positives = 212/463 (45%), Gaps = 18/463 (3%)

Query: 1   MNILRAI--FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFND 58
           M     I      ++L + C +G  Y +P + L   Q      ++ +++   +WWE + D
Sbjct: 1   MKRKYTIYYMMALVLLFSSCQLGKHYVRPELNLP--QQLDSTEQDTLSLADRQWWELYTD 58

Query: 59  TSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSS--------YASISHRFIP 110
           T+L  L++  L+ N  +  A  R+           A+LFP           A        
Sbjct: 59  TTLQALIERTLEYNKDMKIAAARVKELAAMKRIDFANLFPQVSGKLYADKEAENYGGDNY 118

Query: 111 NLKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
           +   +   +    W++DL+G  R   + S+A+   +       K+++++++  +Y +   
Sbjct: 119 DSDRSYEAKAIVSWEVDLWGNLRWAKDKSMADFLGSIEAQRALKMSLVAEVAQAYFELVA 178

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
               ++I  Q L+  K+ + L+ L+F  G TS+ S  + + E     + +P LE+   + 
Sbjct: 179 LDNELAIVRQTLNARKEGVRLAKLRFEGGLTSETSYQQAQVEFARTATLVPDLERKISIK 238

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            ++I+ L G         +++     +  L   + +G+P+ L+  RPD+R  E+KL  + 
Sbjct: 239 ENDIAFLAGEYP----RKIERSVLPEEVKLPENLPVGLPSTLLERRPDVRQAEQKLIAAN 294

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYL-PIFDKGKIKSNIRRAE 348
           A +G+A ++++P L+L     L          + + F     L P+F  GK ++ ++  +
Sbjct: 295 ATVGLAYTNMFPRLALTAHYGLESAEFSDFLKSPYHFLSGSLLTPLFAMGKNRAMLKAKK 354

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           ++ +++  +++++VL A K+  NA+   N+ K I        +  + ++ L+ + Y  G 
Sbjct: 355 AAYEQEVYSYEKSVLTAFKDARNAIVDFNKIKDIYESRLQLEQAAQTNVELAQLQYINGV 414

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
              LD+LD +R     ++ LS A R    + V LY A+G G+ 
Sbjct: 415 IGYLDVLDAQRGYFDAQIGLSNAIRDKQITLVRLYKALGGGWQ 457


>gi|91782927|ref|YP_558133.1| RND efflux system outer membrane lipoprotein [Burkholderia
           xenovorans LB400]
 gi|91686881|gb|ABE30081.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia xenovorans LB400]
          Length = 516

 Score =  199 bits (504), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 112/480 (23%), Positives = 213/480 (44%), Gaps = 40/480 (8%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGN-------------SKNLINIDTLKW 52
           ++    +++L+GC++ P Y  P  P   T                   ++   ++   +W
Sbjct: 14  SVLLGALMVLSGCSLAPTYEVPSTPTTATFKEAPQQPLSAQEAGTWKTAQPSEDVARGEW 73

Query: 53  WESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP-- 110
           W+ F+D  LN L + AL  N  +  A  R+N A+    + RA LFPS  A          
Sbjct: 74  WKVFDDAKLNDLEQQALDANQNLKAAAARVNEARAMNQAARAGLFPSLDAGFGPTRQRVS 133

Query: 111 ------------NLKTNSTGQLDSDWKIDLFGQR-RHIESSLANLDSAYAQVDIAKLNVI 157
                         +T    Q  + +++DLFG+    ++++ A+   + A      L + 
Sbjct: 134 AASLFEPDGTNVPQRTFWRAQASASYEVDLFGRVASTVDAARADTQRSEALFRSVMLALQ 193

Query: 158 SKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIES 217
           + +  +Y   R       +    ++L +  ++L   ++T+G  ++L L + +AE+ S +S
Sbjct: 194 ADVAQNYFALRELDAESEVFRNAVELRQHALKLVQRRYTEGEITELDLSRAKAELASAQS 253

Query: 218 DIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPD 277
           D  T+++    + H+++ LLG    EF              + + +  G+P+ L+  RPD
Sbjct: 254 DAMTVQRLRAASEHSLAVLLGKAPAEFSMAADPIRP-----VNLRVPPGLPSSLLERRPD 308

Query: 278 IRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSF-------GPKL 330
           I   E+ +A + ++IGIAK+  +PSL++ G+           +             G  L
Sbjct: 309 IAAAERAMAAANSRIGIAKAAFFPSLTITGTGGFESATIGDLFKWSSRAFLLGPLAGTAL 368

Query: 331 YLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAV 390
            +PIFD G+ K N+  A +  +E    +++ VL A +EVE+ L+ +   +        AV
Sbjct: 369 NIPIFDGGRRKGNLANARAVYEEDVANYRQQVLVAFREVEDNLSDMRILEDQTRTQNEAV 428

Query: 391 ELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +  +++  LS   Y +G  + LD++D ER   +        +   A S V+L  A+G G+
Sbjct: 429 KASQRAADLSRSQYTEGAVNYLDVIDAERTVLQARRAAVQLQGVQAASTVNLIRALGGGW 488


>gi|77918705|ref|YP_356520.1| outer membrane protein [Pelobacter carbinolicus DSM 2380]
 gi|77544788|gb|ABA88350.1| outer membrane protein [Pelobacter carbinolicus DSM 2380]
          Length = 470

 Score =  199 bits (504), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 122/470 (25%), Positives = 220/470 (46%), Gaps = 22/470 (4%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKN----LINIDTLKWWESF 56
           M  + AIF L  ++L+GC+V  +YT P  P+   Q  +  S              WW+ F
Sbjct: 1   MKSITAIF-LCTLVLSGCSVFRDYTPPENPVGAEQTDLTVSDAVRYKAAQEPVAAWWQKF 59

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF-------- 108
           +D  L  LV+ AL  NL +  A   +  A+     V  D FP+   + ++          
Sbjct: 60  DDPQLVALVEEALDTNLDVRIALANLGEARAMAREVGLDRFPTVTGNAAYFRLLNSRETS 119

Query: 109 ----IPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPS 163
               +     + T   D+ W++DLFG+  + I +  A  D+A   V    + V ++   +
Sbjct: 120 AGNSVERDVNSYTAGFDALWELDLFGRVSQRIAAQKALTDAALNDVRQIYVTVSAEAART 179

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           YI+ R  + R++IA +         EL+   F  G  + L + +   +     S IP L+
Sbjct: 180 YIELRGAQYRLNIAERNARNQAGTYELTQKLFDGGRGTALDVSRAITQRDLARSRIPPLQ 239

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
                 ++ +S L G      L  +        P+L + + +G    L++ RPDIR  E+
Sbjct: 240 AEVTAAINRLSVLTGRVPDALLEALSGSKPL--PSLPVTVAVGDAEGLLKRRPDIRTAER 297

Query: 284 KLADSVAKIGIAKSDLYPSLSL--NGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIK 341
           +LA SVA+  +A +DL+P++S+  +   + T   SF       S GP ++   FD G+++
Sbjct: 298 QLAASVARYNVAATDLFPTVSILGSIGFSATDLGSFGASALAGSLGPSIHWRAFDLGRVR 357

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           + + +A++ +      +++TVL A++E + AL++ + +++    LQ A    + S  L+ 
Sbjct: 358 AQMAQADARSIAALAAYEKTVLKALEETQTALSNFSREEERRGTLQQAARSARHSAQLAK 417

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             Y QG  + LD+LD ER   + E  L+ ++   A   + +Y A+G G+ 
Sbjct: 418 QRYEQGMDAFLDVLDAERTQLQTEDALAASETTAALDLIAIYKALGGGWQ 467


>gi|170682284|ref|YP_001742688.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli SMS-3-5]
 gi|170520002|gb|ACB18180.1| cation efflux system protein CusC [Escherichia coli SMS-3-5]
          Length = 460

 Score =  199 bits (504), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 111/464 (23%), Positives = 207/464 (44%), Gaps = 18/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK---NLINIDTLKWWESFN 57
           M+  + +     + L GC++ P+Y +P MP +P QFS+  +       N     W   F 
Sbjct: 1   MSPCKLLPFCVALALTGCSLAPDYQRPAMP-VPQQFSLSQNGLVNAADNYQNAGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS- 116
           D  +  L+  AL  N  +  A  ++  A+       AD +P      S  +  NLK N+ 
Sbjct: 60  DNQVKTLISEALVNNRDLRMAALKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGNTA 119

Query: 117 -----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +  
Sbjct: 120 TTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       
Sbjct: 180 YAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +    Q Q+ N      + +  G+P+ ++  RPDI   E  L  + A
Sbjct: 240 NALQLLLG----SYGKLPQAQTVNSDSLQSVKLPAGLPSQILLQRPDIMEAEHALMAANA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  A
Sbjct: 296 NIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + NA KEV +AL         ++  Q  +   K ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLKITLQRARALYQHG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             S L++LD ER+       L         + + LY A+G G+ 
Sbjct: 416 AVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGWQ 459


>gi|289664656|ref|ZP_06486237.1| outer membrane protein [Xanthomonas campestris pv. vasculorum
           NCPPB702]
          Length = 501

 Score =  199 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 101/482 (20%), Positives = 204/482 (42%), Gaps = 32/482 (6%)

Query: 1   MNILRAIFSLF--IVLLAGCTVGPEYTKPHMPLLP-------------TQFSIGNSKNLI 45
           M+ +R  F       +L+GCT+ P Y +P  P+                     ++ +  
Sbjct: 1   MSSIRMTFCALGVASVLSGCTLMPRYARPDAPVPAQFAGTDVSTAPSTATADTDSTADTA 60

Query: 46  NIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS 105
            I  + W + F D +L +++ +AL  N  +  A   I  A+      RA L P+   + +
Sbjct: 61  YIADIGWRQVFTDPALQQVIALALDNNRDLRVAALNIEVARAQYRVDRAALLPAIDGTGT 120

Query: 106 HRFIPNL------------KTNSTGQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIA 152
                              +T S     S +++DLFG+ R ++        S        
Sbjct: 121 ANNSRTPAELGIPGQPQVFRTYSASIGISAYELDLFGRVRSLKEQALQQFLSTAEARRST 180

Query: 153 KLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEI 212
            +++++++  +Y+     ++ + +A   L     +  L    F  G  S+L+L + +  +
Sbjct: 181 HISLVAEVATAYLTLAADQQLLQLAQSTLASQSDSYRLQQRSFELGVASQLTLRQAQTTV 240

Query: 213 KSIESDIPTLEKSFRMNVHNISTLLGYP-ATEFLHYMQKQSNNFQPNLYIPINIGIPADL 271
           ++   D+         + + +  L+G     E L +    + + + N+   +  G+P+ L
Sbjct: 241 ETARVDVERYTAQVAQDRNALVLLVGASVPVELLPHALPDNASVEGNVLASVPAGLPSQL 300

Query: 272 IRNRPDIRYQEKKLADSVAKIGIAKSDLYP---SLSLNGSIALTHDNSFPGYNTHWSFGP 328
           ++ RPDI   E+ L  + A IG A++  +P     +  GS + +    F      WSF P
Sbjct: 301 LQRRPDILEAERNLRAANANIGAARAAFFPSISLTASTGSSSSSLSRLFDAGTRAWSFVP 360

Query: 329 KLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQH 388
            L LPIF+ G+ ++N+  A+++   +   +++++ +A +EV +AL   +   + +   Q 
Sbjct: 361 TLTLPIFNAGRNRANLDMAKANRDIEVARYEKSIQSAFREVSDALAQRDTLGRQLQAQQA 420

Query: 389 AVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGS 448
            V+    S  LS   + +G  S L  LD +R+    +  L   +     + V  Y A+G 
Sbjct: 421 LVDATADSYRLSQARFERGIDSYLQALDAQRSLYSAQQTLITTQLSRFTNLVTFYKAMGG 480

Query: 449 GY 450
           G+
Sbjct: 481 GW 482


>gi|116050841|ref|YP_790336.1| putative outer membrane protein precursor [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|115586062|gb|ABJ12077.1| putative outer membrane protein precursor [Pseudomonas aeruginosa
           UCBPP-PA14]
          Length = 479

 Score =  199 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 112/470 (23%), Positives = 228/470 (48%), Gaps = 25/470 (5%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKN----LINIDTLKWWESFNDTSL 61
            +  +  + L  C++GP++T+P+ P          + N           +WW  F+D  L
Sbjct: 5   PLLLIASLALGACSLGPDFTRPNRPAPGDWSLQAATGNPSHLAAAPLAAQWWTLFDDAQL 64

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK-------- 113
           N L++   + NL +  A  R+  ++    S+  D  PS  AS +++              
Sbjct: 65  NALLQRVQRANLDLRSAAARLQQSRAIRRSLGGDALPSVDASGNYQRQRTTSAGLFDPSG 124

Query: 114 -------TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
                   ++    D+ W++D +G+ RR +E++ A ++++  ++   +++V+++    YI
Sbjct: 125 KAGKGNYNHALAGFDASWELDFWGRVRRELEAADATVEASENELRDVQVSVLAEAARDYI 184

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
             R  + R +I    L+  + ++EL+  +   G  + L + +  A++ S+E+ +P +EK+
Sbjct: 185 QLRGEQSRAAIIRDNLETARHSLELTRTRLANGVATDLEVAQALAQVASMEARLPEVEKN 244

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
               V+ +  L+G      L  +       +P     + +G+P++L + RPDIR  E +L
Sbjct: 245 QAHLVNALGYLVGASPGSLLAELGPAREIPRP--PGSVPVGLPSELAQRRPDIRRAEARL 302

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHDNSF---PGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG+AK+D YP ++LNG+               +  ++ GP   LPIF+ G+++ 
Sbjct: 303 HAATASIGVAKADFYPRITLNGNFGFESLQLSSLGDWDHRQFAIGPAFSLPIFEGGRLRG 362

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            +   E+  QE  I +Q TVL A +EV++A+     +++   +L  AV  +++++  +  
Sbjct: 363 RLELREAQQQEAAIDYQRTVLRAWQEVDDAMHDYAANQRRQERLGEAVAQNRRALQSARE 422

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            YR G    L +LD +R     +     +   ++ + V+LY A+G G++P
Sbjct: 423 QYRAGAVDFLSVLDSQRQLLDNQEQQVASDEAVSLTLVNLYKALGGGWSP 472


>gi|296282528|ref|ZP_06860526.1| RND-family efflux transporter [Citromicrobium bathyomarinum JL354]
          Length = 474

 Score =  199 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 115/475 (24%), Positives = 205/475 (43%), Gaps = 30/475 (6%)

Query: 1   MNILRAIFSLFIVLLAGCT-VGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDT 59
           M    A+ +L    LAGC  + PE+ +P     P           +    L + E FND 
Sbjct: 1   MKRFMAL-ALVSTALAGCASMAPEHVRPEAATAPAFDPDYRPDGSVVASQLSYREWFNDP 59

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN-------- 111
            L +L+  AL+ N  +L AT RI  A+       +   P+  A+ S              
Sbjct: 60  RLVQLIGTALENNRDLLAATARIEQARARYRIQDSRQLPTVVANASGTRTRQQLGVNPSL 119

Query: 112 -------------LKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVI 157
                              G   S +++D +G+   +  ++ A   S+ A      L++I
Sbjct: 120 DTGDVEGAPDSVTFNRFDVGVGVSSFELDFWGRVASLSNAARAEYLSSVASQRAFYLSLI 179

Query: 158 SKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIES 217
           +    +Y +    +E+I++A    +  ++ + ++ L+   G TS L   + E  +   E 
Sbjct: 180 ADTATTYYEIVETQEQIALAEATAESRREGLRIAKLRLDNGVTSALPFRQAETLLTQAEQ 239

Query: 218 DIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPD 277
            + + + +     + +  L+G    + L       +            G+ +DL+  RPD
Sbjct: 240 QLASEQLALAQLRNQLGVLVGGTVPDALPDGLPLESQADDRRLA---AGLLSDLLLVRPD 296

Query: 278 IRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPI 334
           I   E++L  + A IG A++  +P++SL G+     D   + F G    WSFGP + LPI
Sbjct: 297 IIAAEEQLRAARANIGAARAAFFPTISLTGNAGFASDSLDDLFSGSGFGWSFGPTISLPI 356

Query: 335 FDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHK 394
           FD G  ++++  A++   EQ  T+ +TV  A +EV +AL       + V  L+ AVE  +
Sbjct: 357 FDWGAREADLDLAKALEVEQVATYDKTVQTAFREVSDALAGRRWLAEQVATLERAVEAQE 416

Query: 395 KSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           +   L+ + YR+G    L++LD ER        L   +R   ++   L++A+G G
Sbjct: 417 RIARLARLRYREGVADYLEVLDAERNLFSARQQLLATERAWLQNRATLFVALGGG 471


>gi|26246550|ref|NP_752589.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli CFT073]
 gi|227884450|ref|ZP_04002255.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli 83972]
 gi|48474444|sp|Q8CWA4|CUSC_ECOL6 RecName: Full=Cation efflux system protein CusC; Flags: Precursor
 gi|26106949|gb|AAN79133.1|AE016757_37 Probable outer membrane lipoprotein cusC precursor [Escherichia
           coli CFT073]
 gi|227838536|gb|EEJ49002.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli 83972]
 gi|307552443|gb|ADN45218.1| cation efflux system protein CusC [Escherichia coli ABU 83972]
          Length = 460

 Score =  199 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 110/464 (23%), Positives = 207/464 (44%), Gaps = 18/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK---NLINIDTLKWWESFN 57
           M+  + +     + L GC++ P+Y +P MP +P QFS+  +       N     W   F 
Sbjct: 1   MSPCKLLPFCVALALTGCSLAPDYQRPAMP-VPQQFSLSQNGLVNAADNYQNAGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS- 116
           D  +  L+  AL  N  +  A  ++  A+       AD +P      S  +  NLK +S 
Sbjct: 60  DNQVKTLISEALVNNRDLRMAALKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGDSA 119

Query: 117 -----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +  
Sbjct: 120 TTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       
Sbjct: 180 YAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +    Q Q+ N      + +  G+P+ ++  RPDI   E  L  + A
Sbjct: 240 NALQLLLG----SYGKLPQAQTVNSDSLQSVKLPAGLPSQILLQRPDIMEAEHALMAANA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  A
Sbjct: 296 NIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARTLYQHG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             S L++LD ER+       L         + + LY A+G G+ 
Sbjct: 416 AVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGWQ 459


>gi|293413869|ref|ZP_06656518.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli B185]
 gi|291433927|gb|EFF06900.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli B185]
          Length = 460

 Score =  199 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 110/464 (23%), Positives = 208/464 (44%), Gaps = 18/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK---NLINIDTLKWWESFN 57
           M+  + +     + L GC++ P+Y +P MP +P QFS+  +       N     W   F 
Sbjct: 1   MSPCKLLPFCVALALTGCSLAPDYQRPAMP-VPQQFSLSQNGLVNAADNYQNAGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS- 116
           D  +  L+  AL+ N  +  AT ++  A+       AD +P      S  +  NLK +S 
Sbjct: 60  DNQVKTLISEALENNRDLRMATLKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGDSA 119

Query: 117 -----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +  
Sbjct: 120 TTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       
Sbjct: 180 YAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +    Q Q+ N      + +  G+ + ++  RPDI   E  L  + A
Sbjct: 240 NALQLLLG----SYGKLPQAQTVNGGSLQSVKLPAGLSSQILLQRPDIMEAEHALMAANA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  A
Sbjct: 296 NIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARALYQHG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             S L++LD ER+       L         + + LY A+G G+ 
Sbjct: 416 AVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGWQ 459


>gi|215485614|ref|YP_002328045.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli O127:H6 str. E2348/69]
 gi|218688398|ref|YP_002396610.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli ED1a]
 gi|312964388|ref|ZP_07778682.1| cation efflux system protein cusC [Escherichia coli 2362-75]
 gi|215263686|emb|CAS08020.1| copper/silver efflux system, outer membrane component [Escherichia
           coli O127:H6 str. E2348/69]
 gi|218425962|emb|CAR06773.1| copper/silver efflux system, outer membrane component [Escherichia
           coli ED1a]
 gi|312290865|gb|EFR18741.1| cation efflux system protein cusC [Escherichia coli 2362-75]
          Length = 460

 Score =  199 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 110/464 (23%), Positives = 207/464 (44%), Gaps = 18/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK---NLINIDTLKWWESFN 57
           M+  + +     + L GC++ P+Y +P MP +P QFS+  +       N     W   F 
Sbjct: 1   MSPCKLLPFCVALALTGCSLAPDYQRPAMP-VPQQFSLSQNGLVNAADNYQNAGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS- 116
           D  +  L+  AL  N  +  A  ++  A+       AD +P      S  +  NLK +S 
Sbjct: 60  DNQVKTLISEALVNNRDLRMAALKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGDSA 119

Query: 117 -----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +  
Sbjct: 120 TTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       
Sbjct: 180 YAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +    Q Q+ N      + +  G+P+ ++  RPDI   E  L  + A
Sbjct: 240 NALQLLLG----SYGKLPQAQTVNSDSLQSVKLPAGLPSQILLQRPDIMEAEHALMAANA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  A
Sbjct: 296 NIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARALYQHG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             S L++LD ER+       L         + + LY A+G G+ 
Sbjct: 416 AVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGWQ 459


>gi|171912833|ref|ZP_02928303.1| outer membrane protein [Verrucomicrobium spinosum DSM 4136]
          Length = 479

 Score =  199 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 118/453 (26%), Positives = 222/453 (49%), Gaps = 14/453 (3%)

Query: 10  LFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIAL 69
           L + LL+ C VGP    P   +     +      +      +WW  +ND  LN LV  A+
Sbjct: 12  LSLCLLSACAVGPNPKTPETQVGAQFDNKNQGGYVTAPTVAQWWRRYNDPKLNSLVDRAI 71

Query: 70  QQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST-----------G 118
             NL +  A  R+  A+    +VR D FP+  ++ S+      K  S+            
Sbjct: 72  ASNLDLKIAAARVEEARALRAAVRYDYFPTVTSAASYTNQRQSKAASSPGLDRTSELYDA 131

Query: 119 QLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIA 177
            LD+ W++D +G+ RR   ++ A++ +A A V+   + V +++  +Y++ R  + ++++ 
Sbjct: 132 GLDASWELDFWGRVRRSNWAARADVRAAEAAVEDGLVLVTAEVASTYLELRGLQHQLAVR 191

Query: 178 HQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLL 237
            +  D  ++ ++L+      G  ++L   +  A++ S  + IP +E     ++H +S L+
Sbjct: 192 RRNADNQQQTLKLTESLLQGGRGTELDTSRARAQLNSTLAAIPLIEGLIAQDIHRLSVLI 251

Query: 238 GYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKS 297
           G   +      +       P L   + IG P++L+R RPDIR  E  L  +  ++G+A +
Sbjct: 252 GTTPST--LKPELIKPRPIPTLPSIVRIGNPSELLRRRPDIRAVEADLEAATHRVGVATA 309

Query: 298 DLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYIT 357
           DL+P ++ NG+ +L  D+    ++   SFGP++    FD G++K+ I  A +    Q  T
Sbjct: 310 DLFPRVTFNGTASLQADSFSGPWSGANSFGPRISWAAFDLGRVKAQINAANARVDAQVST 369

Query: 358 WQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDI 417
           + +TVL A++E ENAL +    +     L  +    +++ +L+   Y+ G    L +LD 
Sbjct: 370 YYKTVLGALEETENALVTFGRQRARRNYLSESATASEQAANLARERYQNGVADFLTVLDA 429

Query: 418 ERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           ER   + +  L+ ++   A S V +Y A+G G+
Sbjct: 430 ERVLLEAQSLLAESQTATATSQVAIYKALGGGW 462


>gi|239817793|ref|YP_002946703.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Variovorax paradoxus S110]
 gi|239804370|gb|ACS21437.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Variovorax paradoxus S110]
          Length = 474

 Score =  199 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 100/451 (22%), Positives = 196/451 (43%), Gaps = 18/451 (3%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTIL 76
           GC++ P Y +P  P+  T               + W E F D+ LN L++ AL+ N  + 
Sbjct: 18  GCSLIPTYERPAAPVPTTFPGDPAQPAGQAAAAVPWEEFFTDSRLNGLIRTALENNRDLR 77

Query: 77  QATERINAAKENILSVRADLFPSSYASISHRFIPN-------------LKTNSTGQLDSD 123
            +   I  A+      RA LFP+   + S                       S     + 
Sbjct: 78  VSVLNIEQARAQFQIERAALFPALGLTGSGSRSSPNPYQAFDSSAGSVSSQYSVNLGVTA 137

Query: 124 WKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILD 182
           W+ID FG+ R + + +LA   +       A++++I+ +   ++      E + +  Q L 
Sbjct: 138 WEIDFFGRIRALKDQALAQYLATEESRKAAQVSLIAAVATGWLTLIADDELLELTRQTLV 197

Query: 183 LYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPAT 242
             ++++ L+ ++F  G +S+L      +  ++  +     +++   + + ++ LLG P  
Sbjct: 198 TREESVRLTKMRFDNGVSSELDFQAANSLAETARASYAQQQRTRMQDENALALLLGAPVP 257

Query: 243 EFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPS 302
                   +  +    +      G+P+DL+  RPDIR  E++L  + A IG A+++ +P 
Sbjct: 258 ADATAGGIKGLDSVKPMPDVP-AGLPSDLLAERPDIRAAEQQLIAANANIGAARANFFPR 316

Query: 303 LSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQ 359
           +SL  ++          F   +  WSF P + LPIFD G+ ++ +  A++  +     ++
Sbjct: 317 VSLTTTLGTASSEFSGLFDRGSRAWSFAPSVTLPIFDAGRNRATLDSAKAGREIAVAQYE 376

Query: 360 ETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIER 419
           +++  A +EV +AL       + V   +   +       LS + YR G  S LD+LD +R
Sbjct: 377 KSIQTAFREVADALAGRATLGEQVRAQRAQADAEAVRFRLSDMRYRNGIASALDLLDAQR 436

Query: 420 ATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +    +      +    ++ V LY  +G G+
Sbjct: 437 SLYTAQQSAVTTRLLQLQNQVTLYKTLGGGW 467


>gi|113970279|ref|YP_734072.1| RND efflux system outer membrane lipoprotein [Shewanella sp. MR-4]
 gi|113884963|gb|ABI39015.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Shewanella sp. MR-4]
          Length = 497

 Score =  199 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 104/462 (22%), Positives = 217/462 (46%), Gaps = 22/462 (4%)

Query: 7   IFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLI------NIDTLKWWESFNDTS 60
           +  +    +AGC +GP+Y +P + L     +   S+         ++  L W   + D  
Sbjct: 35  LGLVTAFSVAGCAMGPDYQRPELALPSQYQAQILSQTTAEQGNIKDVSALSWRHFYQDPV 94

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI---------PN 111
           L  L++ AL  NL +  A  R+ AA+  +  V + L+P   A++ +            P+
Sbjct: 95  LISLIEHALANNLDLQMAQSRLLAARSKMTVVDSALWPEVSANLGYERSLDSGATSKDPS 154

Query: 112 LKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
             T         W++DL+G  R   E++ A+  S   ++ +  +++IS +   Y +    
Sbjct: 155 PTTAVDLAGTVSWELDLWGANRRASEAAKADYLSEVEKLRLTYVSLISDIASRYYEWLDI 214

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           ++R S++   + + +K ++++ L+   G  S L + + E E++S +  +PTL+   +  +
Sbjct: 215 EQRYSVSIDTVGIRQKELDIAKLRHANGVISGLDVRQAEVELQSTKVTLPTLDYERKYKI 274

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     F      Q       L   ++ G+P++L+  RPD++  E+ +  + A
Sbjct: 275 NQLHILLGEYDYAF---PSPQGLPENVGLPYELSAGVPSELLTLRPDVKMSEQAMIAANA 331

Query: 291 KIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
           ++GIAK+  +P  +++G     ++   + F      WS    +  PIF++GKI +    A
Sbjct: 332 QVGIAKAAFFPKFTISGQYGRENNHLKDIFDSNGVTWSLLGGISAPIFNRGKIAAEYDIA 391

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
              A++  ++++  VL A  +V +AL ++   ++ +   +  V+       L+ + Y+ G
Sbjct: 392 TEEAKQSMLSYRNVVLTAYFDVNDALNNLKRAQEAIKAQRELVQSSSAYARLARLRYQNG 451

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
             + LD++D +R     ++  S   R    + + LY A+G G
Sbjct: 452 VATSLDLMDAQRQLFSAQLAYSEILRDKQLAKIALYRALGGG 493


>gi|73537921|ref|YP_298288.1| RND efflux system, outer membrane lipoprotein, NodT [Ralstonia
           eutropha JMP134]
 gi|72121258|gb|AAZ63444.1| RND efflux system, outer membrane lipoprotein, NodT [Ralstonia
           eutropha JMP134]
          Length = 489

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 100/467 (21%), Positives = 206/467 (44%), Gaps = 28/467 (5%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFS--------IGNSKNLINIDTLKWWESFNDTS 60
           +  + LLAGC++ P Y +P +P+                     +    L W + F D  
Sbjct: 8   AAAVALLAGCSLIPSYEQPSLPVAQAYPQGAAYPTADAAAGAQQMRATDLGWRDFFADAR 67

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL 120
           L +L+++AL  N  +  A   + A +      RADLFP+   +            ST   
Sbjct: 68  LRRLIEVALDNNRDLRVAALNVEAFRAQYQIERADLFPAIGVAAQETRQRIPADLSTTGR 127

Query: 121 D------------SDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
                        + W++DLFG+ R + E++L    ++      A++ +++ +  +Y+  
Sbjct: 128 RIIASQYGVSLGTTAWELDLFGRIRSLSEAALEQYFASDETRRSAQIALVASVANAYLAL 187

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
                ++++    L  Y+++  L+   + +G  S+L L + +  +++  + +    +   
Sbjct: 188 LADDAQLTLTRSTLANYERSYGLTRRSYEEGIASRLDLRQSQTAVENARASLARYTRLVA 247

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
            + + +  LLG    + L            ++      G+P+DL++NRPD+   E +L  
Sbjct: 248 QDENALVLLLGTGMPDDLPAPLPLDQKLTADVP----AGLPSDLLQNRPDVLAAEHRLRS 303

Query: 288 SVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNI 344
           + A IG A++  +P ++L  S     +     F   +  W F P++ LP+F  G +++++
Sbjct: 304 ANANIGAARAAFFPRIALTASAGTASNELSGLFKAGSGTWLFQPQISLPLFTAGSLRASL 363

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
             A+         ++ T+  A +EV + L +       +      VE  + + +L+   Y
Sbjct: 364 DYAKIQKDINVAQYERTIQTAFREVSDGLAARGTYTSQLEAQVRFVEAAQDAYNLADRRY 423

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           R G  S L +LD +R+    +  L +A+++   S V+LY A+G G++
Sbjct: 424 RTGVDSYLAVLDAQRSLYNAQQLLIVARQEQLTSEVNLYKALGGGWH 470


>gi|302038615|ref|YP_003798937.1| efflux transporter outer membrane factor lipoprotein [Candidatus
           Nitrospira defluvii]
 gi|300606679|emb|CBK43012.1| Efflux transporter, outer membrane factor lipoprotein [Candidatus
           Nitrospira defluvii]
          Length = 506

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 111/482 (23%), Positives = 210/482 (43%), Gaps = 37/482 (7%)

Query: 4   LRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIG----NSKNLINIDTLKWWESFNDT 59
           +  +  +  +  +GC  GP Y +P +        +      +     +    WW++F++ 
Sbjct: 12  ISTVLVMLSLSASGCLQGPNYHRPPVDTPADWTRMASGPLAAGATETMPEADWWQAFHNQ 71

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI---------- 109
            L + V+ AL QN  + +A  R+   + ++ +  A L+P      S+  I          
Sbjct: 72  ELTQFVERALAQNHDVRRAVSRVLEGRASVTTAGAGLYPQLNVQGSYSNIVVSKNTLAGL 131

Query: 110 ----------------PNLKTNSTGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIA 152
                            +      G  D  W++D++G+ R  +E++ A+  +        
Sbjct: 132 GLATGQQPGPQVFAKPGSSFDLWNGAADLRWELDVWGRIRRGMEAASADAQAIEQDARAI 191

Query: 153 KLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEI 212
            L ++  +  SY   R   E+I IA + L L + ++++   + + G  S L + + E  +
Sbjct: 192 ALTLVGDVGQSYFRIRELDEQIEIAQRALTLRRDSLDIITKRASVGLASDLDVKRTEVLV 251

Query: 213 KSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLI 272
                 IP L +   + +H +  L G         +   ++  +  +   I +G+P+ L+
Sbjct: 252 AESAGQIPDLTRLRAVELHRLEVLTGSAPGS---VVLAPTSLRKVIVQPEIPVGLPSQLL 308

Query: 273 RNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPK 329
             RPDI   E  L  + A+IG A++  +P+LS+ G   L      N F G + ++S GP 
Sbjct: 309 ERRPDILQAEASLVAANARIGQARAYFFPTLSITGQGGLQSAEFVNWFSGNSANFSIGPS 368

Query: 330 LYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHA 389
           + LPIF  G   + +  AES  Q+    +Q+T+L A +EV + L SI    + + + +  
Sbjct: 369 VTLPIFLGGTNVARLEAAESRYQQMLEGYQQTILLAFREVADLLVSIQSRSEQLARQREQ 428

Query: 390 VELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
                 ++ L+ + YR+G  + LD+LD +R     E  L+  +R      V LY A+G G
Sbjct: 429 ATAATAAVGLAEVRYRKGLVNYLDVLDAQRTMLAAETQLAQTERARLTDMVGLYKALGGG 488

Query: 450 YN 451
           + 
Sbjct: 489 WQ 490


>gi|295097783|emb|CBK86873.1| efflux transporter, outer membrane factor (OMF) lipoprotein, NodT
           family [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 461

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 96/464 (20%), Positives = 207/464 (44%), Gaps = 19/464 (4%)

Query: 1   MNILRAIFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINI---DTLKWWESF 56
           M  L+ +    I +LAGC ++ PEY +P  P +P QFS+  +     +       W   F
Sbjct: 1   MFKLKLLSISTIFILAGCVSLAPEYQRPAAP-VPQQFSLSRNSLTPAVNGYQDTGWRNFF 59

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP------ 110
            D  + +L+  AL  N  +  A  ++  A+       AD +P   AS    +        
Sbjct: 60  VDPQVTRLITEALTNNRDLRMAALKVEEARAQFNVTDADRYPQLNASSGITYSGGLKGDK 119

Query: 111 NLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                    L+  +++D FG+ +   ++   N  ++        + ++S +  SY   + 
Sbjct: 120 PTTQKYDAGLEFSYELDFFGKLKNMSDADRQNYFASEEARRAVHILLVSSVSQSYFSQQL 179

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
             E++ IA + L  Y+++      +   G+T+ L+L +   +I+S  ++I   E      
Sbjct: 180 AYEQLRIARETLKNYEQSYAFVEQQLVTGSTNVLALEQARGQIESTRAEIAKREGDLAQA 239

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            + +  +LG     +     ++         + +   + + ++  RPDI   E +L  + 
Sbjct: 240 NNALQLVLG----TYRALPPEKGMKGGEIAPVKLPPNLSSQILLQRPDIMEAEYQLKAAD 295

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           A IG A++  +PS++L   ++ +     + F   +  W+F PK+ +PIF+ G+ K+N++ 
Sbjct: 296 ANIGAARAAFFPSITLTSGLSASSTELSSLFTSGSGMWNFIPKIEIPIFNAGRNKANLKL 355

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
           AE   Q+  + +++ + +A K+V + L   +   + +   Q  ++  + ++  +   Y  
Sbjct: 356 AEIRQQQSVVNYEQKIQSAFKDVSDTLALRDSLSQQLESQQRYLDSLQITLQRARGLYSS 415

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           G  S +++LD ER+    +  +         + ++L+ A+G G+
Sbjct: 416 GAVSYIEVLDAERSLFATQQTILDLTYSRQVNEINLFTALGGGW 459


>gi|167583776|ref|ZP_02376164.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia ubonensis Bu]
          Length = 502

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 103/451 (22%), Positives = 196/451 (43%), Gaps = 20/451 (4%)

Query: 14  LLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQN 72
           LL+GC ++ P YT+P  P+     +    +         W   F D  L  L++ AL  N
Sbjct: 33  LLSGCLSLAPHYTRPAQPVPEAYPAGKADEAASATAVPDWRTYFTDARLRTLIEQALANN 92

Query: 73  LTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLD----------- 121
             +  A  R+  A+      RAD +PS  A  ++                          
Sbjct: 93  RDLRVAVARVEEARAVHGIRRADQWPSINAGAAYARFRTPGGLLAPSPFIGRLYDVQLAE 152

Query: 122 SDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI 180
           + W+ID +G+ R++ +++     ++ A      L++I+++  +Y+    + ERI++    
Sbjct: 153 TQWEIDFWGRVRNLKDAARERYLASDAARRAVSLSLITQVADAYLAVCAYDERIALTRAT 212

Query: 181 LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP 240
           +D  ++++ +   +  +GA S+L L + E  ++  ES    L ++       +  L+G  
Sbjct: 213 IDSRRESLRIFRRRHDEGAISRLDLTQSEILLQQAESLGAQLGQARASAADALMLLVGAS 272

Query: 241 ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLY 300
                  +        P L      G+P+ L+ NRPD+   E +L  + A IG A++  +
Sbjct: 273 PDLPATPLTLDDQAVMPALAP----GLPSALLENRPDVVAAEHQLRAAHANIGAARAAFF 328

Query: 301 PSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYIT 357
           P ++L  +I          F      WS  P L +PIFD G+ ++N+  +++   E    
Sbjct: 329 PRIALTSAIGSGSSELHKLFTSGTGTWSVIPNLAMPIFDAGRNRANLALSQAQRDEAVAQ 388

Query: 358 WQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDI 417
           +++TV  A ++V +AL + +   + +   +  +    +   L+ + Y  G    L++LD 
Sbjct: 389 YEKTVQGAFRDVSDALAARDWLAEQLRVERATLASQTERARLAKLRYDSGAVRFLEVLDA 448

Query: 418 ERATAKVEVDLSIAKRQLAKSYVDLYIAIGS 448
           +R     E  L   +R L  S V LY A+G 
Sbjct: 449 QRDLLNAEQQLVQTRRALLSSRVALYGALGG 479


>gi|38639717|ref|NP_943486.1| copper/silver efflux system outer membrane protein CusC [Klebsiella
           pneumoniae]
 gi|38016815|gb|AAR07836.1| SilC [Klebsiella pneumoniae]
          Length = 513

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 97/464 (20%), Positives = 208/464 (44%), Gaps = 19/464 (4%)

Query: 1   MNILRAIFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINI---DTLKWWESF 56
           M  L+ +    I +LAGC ++ PEY +P  P +P QFS+  +     +       W   F
Sbjct: 53  MFKLKLLSISTIFILAGCVSLAPEYQRPPAP-VPQQFSLSKNSLTPAVNSYQDTGWRNFF 111

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP------ 110
            D  +++L+  AL  N  +  A  ++  A+       AD +P   AS    +        
Sbjct: 112 VDPQVSRLIGEALTNNRDLRMAALKVEEARAQFNVTDADRYPQLNASSGITYSGGLKGDK 171

Query: 111 NLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                    L+  +++D FG+ +   E+   N  ++        + ++S +  SY   + 
Sbjct: 172 PTTQEYDAGLELSYELDFFGKLKNMSEADRQNYFASEEARRAVHILLVSSVSQSYFSQQL 231

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
             E++ IA + L  Y+++      +   G+T+ L+L +   +I+S  ++I   E      
Sbjct: 232 AYEQLRIARETLKNYEQSYAFVEQQLVTGSTNVLALEQARGQIESTRAEIAKREGDLAQA 291

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            + +  +LG     +     ++         + +   + + ++  RPDI   E +L  + 
Sbjct: 292 NNALQLVLG----TYRALPSEKGMKGGEIAPVKLPPNLSSQILLQRPDIMEAEYQLKAAD 347

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           A IG A++  +PS++L   ++ +     + F   +  W+F PK+ +PIF+ G+ K+N++ 
Sbjct: 348 ANIGAARAAFFPSITLTSGLSASSTELSSLFTSGSGMWNFIPKIEIPIFNAGRNKANLKL 407

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
           AE   Q+  + +++ + +A K+V + L   +   + +   Q  ++  + ++  +   Y  
Sbjct: 408 AEIRQQQSVVNYEQKIQSAFKDVSDTLALRDSLSQQLESQQRYLDSLQITLQRARGLYAS 467

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           G  S +++LD ER+    +  +         + ++L+ A+G G+
Sbjct: 468 GAVSYIEVLDAERSLFATQQTILDLTYSRQVNEINLFTALGGGW 511


>gi|110640802|ref|YP_668530.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli 536]
 gi|191172350|ref|ZP_03033892.1| cation efflux system protein CusC [Escherichia coli F11]
 gi|110342394|gb|ABG68631.1| probable outer membrane efflux protein [Escherichia coli 536]
 gi|190907449|gb|EDV67046.1| cation efflux system protein CusC [Escherichia coli F11]
          Length = 460

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 110/464 (23%), Positives = 207/464 (44%), Gaps = 18/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK---NLINIDTLKWWESFN 57
           M+  + +     + L GC++ P+Y +P MP +P QFS+  +       N     W   F 
Sbjct: 1   MSPCKLLPFCVALALTGCSLAPDYQRPAMP-VPQQFSLSQNGLVNAADNYQNAGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS- 116
           D  +  L+  AL  N  +  A  ++  A+       AD +P      S  +  NLK +S 
Sbjct: 60  DNQVKTLISEALVNNRDLRMAALKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGDSA 119

Query: 117 -----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +  
Sbjct: 120 TTRELSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       
Sbjct: 180 YAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +    Q Q+ N      + +  G+P+ ++  RPDI   E  L  + A
Sbjct: 240 NALQLLLG----SYGKLPQAQTVNSDSLQSVKLPAGLPSQILLQRPDIMEAEHALMAANA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  A
Sbjct: 296 NIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARTLYQHG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             S L++LD ER+       L         + + LY A+G G+ 
Sbjct: 416 AVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGWQ 459


>gi|120597958|ref|YP_962532.1| RND efflux system outer membrane lipoprotein [Shewanella sp.
           W3-18-1]
 gi|120558051|gb|ABM23978.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Shewanella sp. W3-18-1]
          Length = 497

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 102/468 (21%), Positives = 205/468 (43%), Gaps = 26/468 (5%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMP---------LLPTQFSIGNSKNLINIDTLKWWESFNDT 59
             F + LAGC++ P+Y +P  P                      + +   + W + F D 
Sbjct: 17  VAFAIALAGCSMAPKYDRPPAPIDIVYPSGAAYAEPAKATPEAPVTDAADIGWRDFFRDP 76

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST-- 117
            L +L+ IAL+ N  + +A   + AA+      RA++ P+   S            S   
Sbjct: 77  LLQQLIGIALESNRDMRKAALNVEAAQALYRIQRAEVLPNLGVSGRGAAERLPADLSNTG 136

Query: 118 ----------GQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYID 166
                       + + W++D++G+ R +   +LA+  +        ++++IS++  +Y+ 
Sbjct: 137 AADVVRRYEVAGVTAAWELDVWGRIRSLSNQALASYLAMDETRIATQMSLISEVANAYLT 196

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
            R  +E + +  + L   K++ EL+   F  G  ++L + + E  +++ E++     +  
Sbjct: 197 LRADQELLQLTGETLGTQKRSHELTAQLFEAGNATQLDVRRSEIVLRTAEANFADYTRQT 256

Query: 227 RMNVHNISTLLGYPAT-EFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
             + + +  LLG P T E    + K        +   +  G+P++L+  RPD+R  E+ L
Sbjct: 257 AKDRNALVLLLGQPLTLELSQQLDKAIVLPDGIVPTELPSGLPSELLVRRPDVRAAEQVL 316

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG A++  +P++SL GS        D  F   +  WSF P++ +PIF  G +++
Sbjct: 317 LGANASIGAARAAFFPTISLTGSAGTASASLDGLFESGSRAWSFLPQITVPIFRGGALRA 376

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
           N+  A    + +   +++++  A  EV + L       + +   Q  V   +    L+  
Sbjct: 377 NLDVAHVKKRIEIANYEKSIQVAFSEVADGLAGKRTLDEQIRSEQFLVAASQGMYDLAEQ 436

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            +R+G    L +LD +R     +  L   +     + + LY A+G G+
Sbjct: 437 RFREGVDDNLTLLDAQRTLYSAQQTLVRTRLARLSNLIALYKALGGGW 484


>gi|218698944|ref|YP_002406573.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli IAI39]
 gi|218368930|emb|CAR16684.1| copper/silver efflux system, outer membrane component [Escherichia
           coli IAI39]
          Length = 460

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 110/464 (23%), Positives = 207/464 (44%), Gaps = 18/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK---NLINIDTLKWWESFN 57
           M+  + +     + L GC++ P+Y +P MP +P QFS+  +       N     W   F 
Sbjct: 1   MSPCKLLPFCVALALTGCSLAPDYQRPAMP-VPQQFSLSQNGLVNAADNYQNAGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS- 116
           D  +  L+  AL  N  +  A  ++  A+       AD +P      S  +  NLK +S 
Sbjct: 60  DNQVKTLISEALVNNRDLRMAALKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGDSA 119

Query: 117 -----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +  
Sbjct: 120 TTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       
Sbjct: 180 YAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +    Q Q+ N      + +  G+P+ ++  RPDI   E  L  + A
Sbjct: 240 NALQLLLG----SYGKLPQAQTVNSDSLQSVKLPAGLPSQILLQRPDIMEAEHALMAANA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  A
Sbjct: 296 NIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKIQNAFKEVADALALRQTLNDQISAQQRYLASLQITLQRARALYQHG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             S L++LD ER+       L         + + LY A+G G+ 
Sbjct: 416 AVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYAALGGGWQ 459


>gi|229591441|ref|YP_002873560.1| putative cation transport lipoprotein [Pseudomonas fluorescens
           SBW25]
 gi|229363307|emb|CAY50420.1| putative cation transport lipoprotein [Pseudomonas fluorescens
           SBW25]
          Length = 476

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 102/456 (22%), Positives = 206/456 (45%), Gaps = 22/456 (4%)

Query: 11  FIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQ 70
              +L+GC++ P+Y +P  P +P Q+            +  W + F+D +L +L++ AL 
Sbjct: 1   MASMLSGCSLIPDYQRPQAP-VPVQYPQQGVYAQAQAGSADWQQLFHDPALQQLIRDALV 59

Query: 71  QNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDS-------- 122
            N  +  A   + A +      RADLFP+  A+ + +        +     +        
Sbjct: 60  NNRDLRVAALNVEAFQAQYRIQRADLFPAVSATGAGQRRRLPGDVNGTGKPAITSSYSAT 119

Query: 123 ----DWKIDLFGQRRHIESSLA-NLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIA 177
                +++D FG+ R +                 A+L++++ +  +Y+  R  +E +++A
Sbjct: 120 LGISAYELDFFGRVRSLSEQAMLTYLGTEEARRSAQLSLVANVANAYLTWRADQELLALA 179

Query: 178 HQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLL 237
            Q L     ++ L+    T G  S L +V+    ++S  + +   E+    +++N++ L+
Sbjct: 180 QQTLVANDHSLRLTSRSKTAGKASALDVVQARTSVESTRASVARYERQVAQDLNNLALLV 239

Query: 238 GYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKS 297
           G P  E L      ++         +  G+P+DL++ RPDI   E +L  + A IG A++
Sbjct: 240 GGPVDEQLPARPLAAD-----WVARVPAGLPSDLLQRRPDILQAEYQLRAANANIGAARA 294

Query: 298 DLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQ 354
             +PS+SL  +           F G +  W+F P++ LPIF+ G +++++  A+      
Sbjct: 295 AFFPSVSLTANAGSASTELSGLFKGGSGSWTFQPQINLPIFNAGSLRASLDYAKLQKDIS 354

Query: 355 YITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDI 414
              +++++  A +EV + L +       +   +  V  +++   L+   YR G  S L  
Sbjct: 355 VAQYEKSIQTAFQEVADGLAARQTFIDQLDAQRDFVAANQQYYKLAEHRYRSGVDSNLTF 414

Query: 415 LDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           LD +RA    +  L + +     + V+LY A+G  +
Sbjct: 415 LDAQRALFSSQQALIVDRLAQLVAEVNLYTALGGAW 450


>gi|331645729|ref|ZP_08346832.1| cation efflux system protein CusC [Escherichia coli M605]
 gi|330910331|gb|EGH38841.1| cation efflux system protein CusC precursor [Escherichia coli AA86]
 gi|331044481|gb|EGI16608.1| cation efflux system protein CusC [Escherichia coli M605]
          Length = 460

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 110/464 (23%), Positives = 207/464 (44%), Gaps = 18/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK---NLINIDTLKWWESFN 57
           M+  + +     + L GC++ P+Y +P MP +P QFS+  +       N     W   F 
Sbjct: 1   MSPCKLLPFCVALALTGCSLAPDYQRPAMP-VPQQFSLSQNGLVNAADNYQNAGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS- 116
           D  +  L+  AL  N  +  A  ++  A+       AD +P      S  +  NLK +S 
Sbjct: 60  DNQVKTLISEALVNNRDLRMAALKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGDSA 119

Query: 117 -----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +  
Sbjct: 120 TTRELSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       
Sbjct: 180 YAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +    Q Q+ N      + +  G+P+ ++  RPDI   E  L  + A
Sbjct: 240 NALQLLLG----SYGKLPQAQTVNSDSLQSVKLPAGLPSQILLQRPDIMEAEHALMAANA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  A
Sbjct: 296 NIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARALYQHG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             S L++LD ER+       L         + + LY A+G G+ 
Sbjct: 416 AVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGWQ 459


>gi|331651578|ref|ZP_08352597.1| cation efflux system protein CusC [Escherichia coli M718]
 gi|331049856|gb|EGI21914.1| cation efflux system protein CusC [Escherichia coli M718]
          Length = 460

 Score =  198 bits (502), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 110/464 (23%), Positives = 208/464 (44%), Gaps = 18/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK---NLINIDTLKWWESFN 57
           M+  + +     + L GC++ P+Y +P MP +P QFS+  +       N     W   F 
Sbjct: 1   MSPCKLLPFCVALALTGCSLAPDYQRPAMP-VPQQFSLSQNGLVNAADNYQNAGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS- 116
           D  +  L+  AL+ N  +  AT ++  A+       AD +P      S  +  NLK +S 
Sbjct: 60  DNQVKTLISEALENNRDLRMATLKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGDSA 119

Query: 117 -----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +  
Sbjct: 120 TTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       
Sbjct: 180 YAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +    Q Q+ N      + +  G+ + ++  RPDI   E  L  + A
Sbjct: 240 NALQLLLG----SYGKLPQAQTVNSDSLQSVKLPAGLSSQILLQRPDIMEAEHALMAANA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  A
Sbjct: 296 NIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARALYQHG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             S L++LD ER+       L         + + LY A+G G+ 
Sbjct: 416 AVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGWQ 459


>gi|189468204|ref|ZP_03016989.1| hypothetical protein BACINT_04600 [Bacteroides intestinalis DSM
           17393]
 gi|189436468|gb|EDV05453.1| hypothetical protein BACINT_04600 [Bacteroides intestinalis DSM
           17393]
          Length = 458

 Score =  198 bits (502), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 102/464 (21%), Positives = 213/464 (45%), Gaps = 19/464 (4%)

Query: 1   MNILRAI---FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFN 57
           M     I     + ++  + C +G  Y +P + L   Q      ++ ++I   +WWE + 
Sbjct: 1   MKRKYTIYGMIMVVVLAFSSCQLGKHYARPELNLP--QQLDSTEQDTLSIADRQWWELYT 58

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSS--------YASISHRFI 109
           DT+L  L++  L+ N  +  A  R+           A+LFP           A       
Sbjct: 59  DTTLQALIERTLEYNKDMKIAAARVKELAAMKRIDFANLFPQVSGKLYADKEAENYGGDN 118

Query: 110 PNLKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
            +   +   +    W++DL+G  R   + S+A+   +       K+++++++  +Y +  
Sbjct: 119 YSSDRSYEAKAIVSWEVDLWGNLRWAKDKSMADFLGSIEAQRALKMSLVAEVAQAYFELV 178

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
                ++I  Q L+  K+ + L+ L+F  G TS+ S  + + E+    + +P LE+   +
Sbjct: 179 ALDNELAIVRQTLNARKEGVRLAKLRFEGGLTSETSYQQAQVELARTATLVPDLERKISI 238

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
             ++I+ L G    +    +  +      +L     +G+P+ L+  RPD+R  E+KL  +
Sbjct: 239 KENDIAFLAGDYPQKIARSVLPEEVKLPESLP----VGLPSTLLERRPDVRQAEQKLIAA 294

Query: 289 VAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYL-PIFDKGKIKSNIRRA 347
            A +G+A ++++P L+L     L          + + F     L P+F  GK ++ ++  
Sbjct: 295 NASVGLAYTNMFPRLALTAHYGLESAEFSDFLKSPYHFLSGSLLTPLFAMGKNRAMLKAK 354

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           +++ +++  +++++VL A K+  NA+   ++ K+I        +  + ++ L+ + Y  G
Sbjct: 355 KAAYEQEVYSYEKSVLTAFKDARNAIVDFSKIKEIYESRLQLEQAARSNVELAQLQYING 414

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
               LD+LD +R     ++ LS A R    + V LY A+G G+ 
Sbjct: 415 VIGYLDVLDAQRGYFDAQIGLSNAIRDKQITLVRLYKALGGGWQ 458


>gi|319407782|emb|CBI81433.1| putative outer membrane protein [Bartonella sp. 1-1C]
          Length = 494

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 139/454 (30%), Positives = 238/454 (52%), Gaps = 10/454 (2%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK-WWESFNDTSLNKLVK 66
           F LF  +L GC VGP+Y K    +          +      TL  WW++FND  L+KL+ 
Sbjct: 18  FCLFFFVLPGCVVGPDYHKTSFSVPEIWGQESFVQTSERPATLAGWWKNFNDPILDKLIH 77

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK----TNSTGQLDS 122
            A+  N +I  A  R+  A+ ++      L PS  +SI             +   G  D+
Sbjct: 78  DAIAANNSIAVAKARVREARASLGQSIGRLSPSVSSSIVGTHSSRQSDTSLSQYRGGFDA 137

Query: 123 DWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQIL 181
            W++DLFG  +  +E++   LD+A   +    + ++  +  +YI+ R +++++SIAH I 
Sbjct: 138 SWELDLFGGHKRAVEAARYGLDAAVEDLRATMVTLLGDIATNYIEMRGWQQKLSIAHSIA 197

Query: 182 DLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPA 241
              +K  +L   K   G  S+L     +A++ + E+DI  +E +  M++H +S L G   
Sbjct: 198 ASQRKTAQLIEAKLEAGDISELDNSNAQAQMINTEADILQMEVNLSMSIHRLSVLTGCVP 257

Query: 242 TEFLHYMQKQSNN-FQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLY 300
                ++QK +     P    PI++GIPAD++  RPD+R  E++ A + A+IG  +++ Y
Sbjct: 258 IALQDFLQKSAKKKQIPRPKWPISVGIPADILLTRPDLRRAERQYAQATARIGQREAERY 317

Query: 301 PSLSLNGSIALTHDNSF---PGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYIT 357
           PSLSL G+I+ T ++      G    WSFGP +  P F+ G++ ++I  A +   + +I 
Sbjct: 318 PSLSLTGNISTTAESMGQLAKGSTIGWSFGPSIRFPFFNGGQVVASIAVARAQRDQAFIA 377

Query: 358 WQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDI 417
           ++  VL A++EVENAL  + ++++ + KL  A   +  S+ LS   +  G  S L++L+ 
Sbjct: 378 YRAAVLGALEEVENALVRLYKEQQRLKKLLAANAAYSHSLKLSKDLFESGNTSFLELLNA 437

Query: 418 ERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            R+    ++ LS +   LAK YV L  A+G G+N
Sbjct: 438 YRSYYSSQMSLSDSYIALAKHYVALMKALGGGWN 471


>gi|49474725|ref|YP_032767.1| hypothetical protein BQ12400 [Bartonella quintana str. Toulouse]
 gi|49240229|emb|CAF26699.1| hypothetical protein BQ12400 [Bartonella quintana str. Toulouse]
          Length = 494

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 122/460 (26%), Positives = 219/460 (47%), Gaps = 10/460 (2%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
           N L     L   +L+GC VGP Y K    +               +    WW   +D  L
Sbjct: 12  NRLFCSAFLCFFILSGCMVGPNYHKTFFRVPAVWGQKSAQIAEHPVALAGWWWRLDDPVL 71

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI-----PNLKTNS 116
           N L+  A+  N ++  A  R+  A+  +      L P+   SIS             +  
Sbjct: 72  NVLINYAISGNNSVAVAKARVREARAGLGQAVGFLLPNVSNSISGIRSASGQSDASLSQY 131

Query: 117 TGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERIS 175
               D+ W++D FG  +  +E+S    ++    +    + ++  +  +Y+  R +++++ 
Sbjct: 132 RSGFDASWELDFFGGHKRAVEASHYGFEATVEDMRATMVTLLGDVATNYVQMRGWQQKLL 191

Query: 176 IAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIST 235
           I  QI    +K  EL   +   G  S+L +   +A++ + E+DI  +E +  M++H +S 
Sbjct: 192 IVQQIALSQRKTYELMCARLKAGDVSELDVSNSQAQMANTEADISQMEANLEMSIHRLSV 251

Query: 236 LLGYPATEFLHYMQKQSNNF-QPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
           L G   T     +QK +     P    PI  GIPAD++  RPD+R  E++ A + A+IG 
Sbjct: 252 LTGRVPTALKDLLQKNAKQAKIPQPKWPIAAGIPADILLTRPDLRRAERQYAQATARIGQ 311

Query: 295 AKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
            ++D YPSL+L G+I+      D  +      WSFGP L  P F+ G+I +++  A +  
Sbjct: 312 READRYPSLTLTGTISTAATAIDQLWKNSTIGWSFGPGLRFPFFNGGQIVASVAVARAQR 371

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
            + +IT++  VL A+++VENAL  +  + + + KL  A +    S+ L+   +  G  S 
Sbjct: 372 DQAFITYRAAVLGALEDVENALVKLKNEHQRLEKLIVANKASLHSLQLARRLFENGNTSF 431

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           L++L+ +R+    ++ L  ++  L   Y+ L  A+G G++
Sbjct: 432 LELLNADRSYYSAQMALKDSRVSLVIQYIALMKALGGGWD 471


>gi|327393269|dbj|BAK10691.1| Nodulation protein T precursor NodT [Pantoea ananatis AJ13355]
          Length = 508

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 127/477 (26%), Positives = 230/477 (48%), Gaps = 38/477 (7%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQF----SIGNSKNLINIDTLKWWESFNDTSLNKL 64
            + +  L GC+VGP+Y  P  P LP  +    S   S+   +    +WW +F D  L+ L
Sbjct: 14  LMLLFALTGCSVGPDYQAPK-PQLPGSYHALDSQETSRPQTSAVDSRWWRNFGDPQLDSL 72

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP-------------- 110
           +  A++ NL++ QA  RI  A+E +   +  LFPS   S                     
Sbjct: 73  IARAIEGNLSLQQAVLRIAGAREQLSQAQGGLFPSLNGSAKVTRQQLGLEGLLKANGADQ 132

Query: 111 -------------NLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNV 156
                           T   G  D+ W++DL+G+ RR IES+ A   +A  Q + A +++
Sbjct: 133 LDSNVASQLNGLTQPVTLYQGSFDASWELDLWGKVRRQIESANAQQQAAIEQRNDALVSL 192

Query: 157 ISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE 216
            ++++ +++  R  +  +    Q + +  +  +L+  +   G     ++    A++ S++
Sbjct: 193 EAEVVRAWLQLRGAQATVKTLQQQIAVADQTWQLTESQQRNGLAPVTNVENARAQLSSLQ 252

Query: 217 SDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRP 276
           + +P  +   R  ++ ++ LLG         + +      P L   +++GIP+ L R RP
Sbjct: 253 AQLPQYQAQTRQAMNGLAVLLGKTPGALDAELSEPKAL--PALPAFVSVGIPSTLARRRP 310

Query: 277 DIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSF---PGYNTHWSFGPKLYLP 333
           DIR  E  L    A+IG++ + L+PSLSL G + + + +        +  +S GP L +P
Sbjct: 311 DIRQAEATLHAQTAEIGVSVAQLFPSLSLTGQLGVRNTDVSYLDNWSSHFYSVGPSLSIP 370

Query: 334 IFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELH 393
           IF  G++ S++R A +      + +++TVL A+++VENAL S   D++ VT L       
Sbjct: 371 IFQGGRLVSSVRLARAQQASAALNYRQTVLTALQDVENALVSYRADQQRVTALDETTGAL 430

Query: 394 KKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +++  L+  +YRQG  + L++LD +R  A+     + A+ Q     V LY A+G G+
Sbjct: 431 QRTFDLASDSYRQGLSTFLEVLDAQRQLAQAREQATQARMQSGLDLVALYKALGGGW 487


>gi|311280808|ref|YP_003943039.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Enterobacter cloacae SCF1]
 gi|308750003|gb|ADO49755.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Enterobacter cloacae SCF1]
          Length = 507

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 112/457 (24%), Positives = 217/457 (47%), Gaps = 15/457 (3%)

Query: 6   AIFSLFIVLLAGCT-VGPEYTKPHMPLLPTQFSI--GNSKNLINIDTLKWWESFNDTSLN 62
            +     ++L  CT +GP+YT P  P L        G + +       +WW   ND +L 
Sbjct: 11  LLTGGACLVLTACTKLGPDYTPPKTPELTQWQPATRGVTPHAAQASYDRWWTQLNDPTLT 70

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPS--------SYASISHRFIPNLKT 114
            LV  AL++N  +  A  R+  ++  +    + L P                    +  T
Sbjct: 71  ALVNEALRKNPDVKIAGLRLLESRAQLGIAESLLGPQATVGSGEIVRTGQVRDHHSSTAT 130

Query: 115 NSTGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
           +     +  W+ID +G+ +  +ES+ A+  +  AQ D  ++ + +++   Y++ R  + R
Sbjct: 131 SYGAGFNLGWEIDFWGKFQRGVESADASYFATLAQYDDIQVLMAAQVAQLYVNIRTLEAR 190

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
           ++I     D+ K++++++   F  G +++L + + + +  S  S IP LE S R + + +
Sbjct: 191 LNITRNNADIQKRSLQITERLFLSGNSAELDVQQAKTQYLSTLSSIPQLETSLRQSQNAL 250

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
           S LL                  Q +L +   +  PADL+R RPD+R  E++LA   A IG
Sbjct: 251 SVLLARKPGPLPEMASNTGVIPQGDLSLVSEV--PADLLRRRPDVRTAERQLAAQSALIG 308

Query: 294 IAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQE 353
           +A+S+LYPS+SL GS+ ++   +       W  GP     + D+G++ + +   ++   +
Sbjct: 309 VAESELYPSISLIGSVGISA-RTGSSSTLSWVAGPTFSWNLLDQGRLGNQVLVQDARFLQ 367

Query: 354 QYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLD 413
            +  +++TV  A +EV++A  +   DK  +T L    +   +S+ ++   YR+G      
Sbjct: 368 LHERYRDTVFQAAREVDDAAIAYANDKDEITLLIETGQAATRSLEIANTQYREGMADFQR 427

Query: 414 ILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +LD +RA    +  L  ++  + +  + LY A+G G+
Sbjct: 428 VLDSQRALFNQQERLVNSRGAMMRDLITLYKALGGGW 464


>gi|255015079|ref|ZP_05287205.1| outer membrane protein oprM precursor [Bacteroides sp. 2_1_7]
          Length = 459

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 107/459 (23%), Positives = 217/459 (47%), Gaps = 14/459 (3%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
           N   A F + ++  + C +G  Y +P + L     +  ++ +  +++ + W   + D +L
Sbjct: 5   NFYIAAFVVSMLAFSSCKIGKRYVRPELNLPDRIEAYTDTTDTASVENIPWESLYADEAL 64

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHR--------FIPNLK 113
             L++ AL  N  +  A  ++           A + P   A++  +          P   
Sbjct: 65  KDLIRKALDNNKDMKIAAAKVKEMIAAKRISFASMLPEVGANVYAQKERLNYGGDNPKPD 124

Query: 114 TNSTGQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                +L   W++DL+G  R    +++A+           +L +I+++  +Y       +
Sbjct: 125 PEFGAKLTLSWELDLWGNLRWANEAAIASYMETVEGQRALRLTIIAEVAANYYQLCALDQ 184

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            +SI  Q LD  ++ + L+ L++  G TS+ +  + + E+   E+ IP+LE+  ++   +
Sbjct: 185 ELSIVQQTLDARREGVRLAKLRYEGGLTSETAYNQAQVELARTETLIPSLERQIKIKESD 244

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +S LLG    E+   + +  +    +L   + IG+P+ L+  RPD+R  E KL  + A++
Sbjct: 245 LSMLLG----EYTDDIPRGLSLSDQHLPDALPIGLPSSLLERRPDMRQAEFKLRAANAQV 300

Query: 293 GIAKSDLYPSLSLNGSIALTHDNSFPG-YNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           G+A++DL+P + L  +     D       +        L  PIF  GK K+ ++ A++  
Sbjct: 301 GVAQTDLFPKIRLTSNYGFESDELSSILKSPAGFIAGSLLQPIFAMGKNKAKVKAAKARY 360

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           +++  +++++VL A KEV NA+ ++ + K+I     +      K + L+ + Y  G  S 
Sbjct: 361 EQEVYSYEKSVLGAFKEVNNAIVTVRKVKEIRASRMNLEASASKYLELAQLQYINGVISY 420

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +D+LD +R     ++ L+ A      S V LY A+G G+
Sbjct: 421 MDVLDAQRGLLDAQIGLNNAVLDELLSVVYLYKALGGGF 459


>gi|158137909|gb|ABW17373.1| OprM [Pseudomonas putida]
          Length = 482

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 97/467 (20%), Positives = 203/467 (43%), Gaps = 23/467 (4%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL--KWWESFNDTS 60
           + R+   L   LL GC++ P+Y +P   +          +  +        W + F D  
Sbjct: 1   MPRSSLILCAALLCGCSLAPDYQRPGAAVAAHYPQGPAYQGDVQAHPAVDDWRQVFQDPV 60

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL 120
           L +L+  AL  N  +  A   + A +      RA+L P   A+   +     +  +    
Sbjct: 61  LRQLIDNALANNRDLRSAALNVEAYRAQYRIQRAELLPKVSANGQGQRQYLPRRMTGTDQ 120

Query: 121 DS------------DWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
                          +++DLFG+ R + + +L    ++       +L++++ +   Y+  
Sbjct: 121 GMISSTYAATLGVSAYELDLFGRLRSLSDQALLTYLASDQARRSTQLSLVASVASVYLTW 180

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
           R  +E +++A+  L   ++++ L+  +   G  S L  ++    + S  + +   ++   
Sbjct: 181 RADQELLALANDTLVADERSLRLTVNQRRAGTVSALDQIQARTSVDSTRAAVARYKRQVA 240

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
            +++ ++ L+G P  + L  +   +          +  G+P+DL++ RPDI   E +L  
Sbjct: 241 QDLNQLTLLVGAPVADDLRALPLANEQI-----AGLQAGLPSDLLQRRPDIVQAEYQLRA 295

Query: 288 SVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNI 344
           + A IG A++  +PS+SL  +   T       F   +  W F P++ LPIF  G +++++
Sbjct: 296 ANADIGAARAAFFPSISLTANAGSTSPALSGLFDAGSGTWLFQPQINLPIFTAGSLRASL 355

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
             A    + Q   +Q+ +  A +EV + L +    ++ +   +  V  +++   L+   Y
Sbjct: 356 DYARLQKEIQVAQYQKAIQGAFQEVADGLAARATYQRQLQAQRDLVASNQRYYDLAEHRY 415

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           R G  S L  LD +R+    +  L   +     + V+LY A+G G+ 
Sbjct: 416 RIGVDSSLTFLDAQRSLFSAQQGLINDRLAQLVAEVNLYAALGGGWQ 462


>gi|330971257|gb|EGH71323.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. aceris str. M302273PT]
          Length = 487

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 112/469 (23%), Positives = 209/469 (44%), Gaps = 25/469 (5%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINID---TLKWWESFNDT 59
           I      L +VLL+ C VGP+Y KP M       +    +     D      WWE + D 
Sbjct: 15  IRPFALGLCVVLLSACAVGPDYQKPSMAAPAQFKAAQGWRTATPSDGMGKGAWWEVYKDP 74

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN-------- 111
            LN LV+     N T+ Q   +   A+  + S RA   P+   +                
Sbjct: 75  QLNALVERLNTSNQTVAQYDAQYRQAQTLVRSSRAAFLPTLDLTTGKTRSGQGTGTSNSG 134

Query: 112 -----LKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
                ++ +   QL   W+ D++G+ RR +E+  AN  ++ A +   +L++ S+L+ +Y+
Sbjct: 135 TSASGIRNSYNAQLGVSWEADVWGKLRRGLEADTANAQASLADLAAMRLSLQSELVQNYL 194

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
             R   E+  +    +D Y++++ L+  ++  G +   ++ + + ++KS ++D+  L   
Sbjct: 195 QLRVIDEQKRLLESTVDAYQRSLTLTQNQYRAGISGSDAVAQAQTQLKSTQADLIDLAWQ 254

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
                + I+ L+G    +F                     G+P+ L+  RPDI   E+ +
Sbjct: 255 RAQFENAIAVLMGMAPADFNLPASTSIPQLPQIPP-----GLPSQLLERRPDIAAAERSV 309

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG+AK+  YP  +L+ S   +     N     N  WS GP+L L +FD G+  +
Sbjct: 310 MGANANIGVAKAAYYPDFTLSMSGGYSSSTFANWISLPNRFWSVGPQLALTLFDGGRRSA 369

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            + R E+   +    +++TVLN  +EVEN L  +   ++     Q A+   + S+ L+  
Sbjct: 370 EVDRTEAVYDQTVAQYRQTVLNGFQEVENYLVQLKVYEQEAAVRQEALVSARDSLRLTNN 429

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            Y+ G    LD+++++      E  +    +    + V L  A+G G++
Sbjct: 430 QYKAGLIGYLDVVNVQATALSNERSVLSVLQSRLIASVQLIAALGGGWD 478


>gi|91203027|emb|CAJ72666.1| similar to multicomponent efflux pump (outer membrane subunit, RND
           family of ABC transporters) [Candidatus Kuenenia
           stuttgartiensis]
          Length = 493

 Score =  198 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 109/465 (23%), Positives = 218/465 (46%), Gaps = 19/465 (4%)

Query: 5   RAIFSLFIVLLAGCT-VGPEYTKPHMPLLPTQFSIGN----SKNLINIDTLKWWESFNDT 59
           R    L   LLA CT VGP+Y KP                  + L      +WW+S  D 
Sbjct: 22  RFAGLLLFTLLASCTTVGPDYKKPDRASPEAWVGQLEGGLTQQQLDPETLSQWWKSLGDP 81

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTN---- 115
            L+  V+ A+  NL +  A  ++  A+     + +  FP+  A        + +      
Sbjct: 82  VLSGFVERAIAANLDLRTAEAQLCQARAQRGIIGSTRFPTIDAEGFAIRTGSSENTGAGS 141

Query: 116 ----STGQLDSDWKID-LFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +   D+ W++D   G+ R +E++ A+  +A        ++V++++  +YI+ R F
Sbjct: 142 TSELYSSSFDAAWELDIFGGRHRALEAAEADFQAAQEARRDVLVSVLAEVAVNYIELRTF 201

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           + + ++A Q L +    +E+   +F  GA  +L L +  +  ++  S++P L ++     
Sbjct: 202 QAQYAVAKQNLLVQLDTLEIVQAQFDAGAVLELDLERAVSNAETTRSELPRLNQAITQAK 261

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + ++ L+G         +        P++   I +G+PA+ +R RPD+R  E++LA   A
Sbjct: 262 NRLAVLIGQTPGTVDKELDGLRLMSTPSV--QIAVGVPAETLRRRPDVRRAERQLAAETA 319

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNSFP---GYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
           +IG+A + LYP  +L G+I L   +        +  W  GP +   IFD G+ +  I   
Sbjct: 320 RIGVATAVLYPKFTLAGTIGLESLSPSNLIASDSRTWGIGPSVQWNIFDGGRTRQKIAVQ 379

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
            +  ++  + ++ ++LNA++EVENA+T+  +++     L  +    +++ +++   Y  G
Sbjct: 380 NALQEQAMVQYEASILNALEEVENAITAFTQEQLRYRSLVESAAAAERAANIAQTRYEAG 439

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
             + L +LD +R     +   + ++  +  + V LY ++G G+ P
Sbjct: 440 ASNFLTVLDTQRTLLSTQNRQAASQGAIMSNLVRLYKSLGGGWTP 484


>gi|326798543|ref|YP_004316362.1| transporter hydrophobe/amphiphile efflux-1 (HAE1) family
            [Sphingobacterium sp. 21]
 gi|326549307|gb|ADZ77692.1| transporter, hydrophobe/amphiphile efflux-1 (HAE1) family
            [Sphingobacterium sp. 21]
          Length = 1524

 Score =  198 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 98/483 (20%), Positives = 205/483 (42%), Gaps = 40/483 (8%)

Query: 6    AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGN----SKNLINIDTLKWWESFNDTSL 61
            A+  L I+LL+ C V  E    H  +             + +  ++ T+ W   F D  L
Sbjct: 1045 AVAVLGILLLSSCGVQKETELTHRKVPAHYLGKNQTDTLANDSTSMATISWRTFFQDEYL 1104

Query: 62   NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASI----------------- 104
             +L+  AL  N  + QA  R+  A+ N+   +  LFPS  A                   
Sbjct: 1105 LRLIDTALANNPDMQQALYRVEMARANMRLRKNALFPSIDAVAEAGLRKYGFYTMDGIGN 1164

Query: 105  ----------SHRFIPNLKTNSTGQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAK 153
                          +P+   +    L + W+ID++G+ ++ + +  A   ++Y    + +
Sbjct: 1165 YDTNFSNNLKDDEQVPDPVPDYFLGLRASWEIDIWGKLKNRKKAAFARFLASYEGRKLVQ 1224

Query: 154  LNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIK 213
              +I+++  +Y +       + I  + + L +++ EL  ++   G  ++L + ++ A + 
Sbjct: 1225 TQLIAEIAAAYFELLALDNELDILEKNIALQQESYELVQVQKEGGRATELGVQQMRAILM 1284

Query: 214  SIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIR 273
            + +S   T+ +      + ++ L G  ++      ++        L   + +G+PA ++ 
Sbjct: 1285 NSKSRKETVLQQINSKENYLNFLCGRFSSPIERKQEELDAYP---LASAVRVGLPAKMLA 1341

Query: 274  NRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSF-----PGYNTHWSFGP 328
             RPDIR  E  L  +   +  A++   PSL+ +        +          +  +    
Sbjct: 1342 LRPDIRAAELNLLAAKGDVKAARAAFLPSLNFSPYFGFQAFDLSKLFVTSPSSIAYGLLG 1401

Query: 329  KLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQH 388
             L  PIF++  I+SN  +  ++   +Y  +++TVL A +EVE  L +        +  QH
Sbjct: 1402 GLTAPIFNQRMIRSNYEQELANKGIEYQEYEKTVLKAWQEVETELNAQRHLIARRSFNQH 1461

Query: 389  AVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGS 448
             V+  + ++  S   ++ GR + LD++  +R     E+ L+    +  +S V+LY A+G 
Sbjct: 1462 EVDALRLAVDASSELFKAGRANYLDVITSQRNVLDAEITLNSTYLEYLQSIVNLYKALGG 1521

Query: 449  GYN 451
            G+ 
Sbjct: 1522 GWQ 1524


>gi|91774525|ref|YP_544281.1| RND efflux system, outer membrane lipoprotein, NodT
           [Methylobacillus flagellatus KT]
 gi|91708512|gb|ABE48440.1| RND efflux system, outer membrane lipoprotein, NodT
           [Methylobacillus flagellatus KT]
          Length = 493

 Score =  198 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 112/450 (24%), Positives = 216/450 (48%), Gaps = 23/450 (5%)

Query: 17  GC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTI 75
           GC ++ P+Y +P  P+       G      +  +L W + F DT+L  L++ AL  N  +
Sbjct: 30  GCQSMAPDYERPAAPVAEHFPQAGTG--TADAPSLAWQDYFADTTLQDLIQEALANNRDL 87

Query: 76  LQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS------------TGQLDSD 123
             A +R+  A+      RADLFP   A  S       +  S             G   ++
Sbjct: 88  RSAIQRVEGARALYGVQRADLFPGLNAQGSFGRSRTPEDMSLIGRPMVLSEYRVGFGITN 147

Query: 124 WKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILD 182
           W++D +G+ R +  ++L    +A +    + +++++++  SY++ R   +RI IA + ++
Sbjct: 148 WELDFWGRIRSLRDAALETFLAAESAQRASAISLVAQVANSYLNLRELDQRILIAEKTIE 207

Query: 183 LYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPAT 242
             ++++ +   +F  G+TSKL L +++A +   ++    L++S  + ++ ++ L+G P  
Sbjct: 208 SRQESVRIFQRRFDVGSTSKLDLKQVQALLAQAQTLRYQLQQSRAIELNALTLLVGKPVD 267

Query: 243 EFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPS 302
                        +  +   +  G+P+D++  RPDI   E  L  + A IG A++  +P 
Sbjct: 268 ----LPPASHAFSETKMLHQLKPGLPSDVLTQRPDIIAAEHILKSANANIGAARAAFFPR 323

Query: 303 LSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQ 359
           ++L  S+          F   +  WSF P + LPIFD  + +SN+  A         +++
Sbjct: 324 VTLTTSLGTASRELDGLFDTGSHAWSFAPSISLPIFDGWRNRSNLELANVRRDLAVTSYE 383

Query: 360 ETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIER 419
           +T+  A +EV +AL + +  ++ +   Q  ++   +   L+ + Y  G  S  ++LD ER
Sbjct: 384 QTIQTAFREVADALAAQHSIRQQLVSQQEMLDAQAERARLAKLRYDHGATSYFEVLDAER 443

Query: 420 ATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           +  +VE  L   +R L  S V LY A+G G
Sbjct: 444 SLLEVEQQLVQMQRALFSSQVSLYAALGGG 473


>gi|91777793|ref|YP_553001.1| efflux ABC transporter outer membrane protein [Burkholderia
           xenovorans LB400]
 gi|91690453|gb|ABE33651.1| ABC efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia xenovorans LB400]
          Length = 470

 Score =  198 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 113/452 (25%), Positives = 211/452 (46%), Gaps = 27/452 (5%)

Query: 19  TVGPEYTKPHMPLLPTQFSIGNSKNLINIDT------LKWWESFNDTSLNKLVKIALQQN 72
           ++ P Y +P +P+  T  +  ++   ++ D       + W   F D  L  L++ AL  N
Sbjct: 2   SLAPHYVRPALPVPDTWATGSSADGTLSADATPAASRIDWRSYFPDAQLQALIEQALTGN 61

Query: 73  LTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKT-----------NSTGQLD 121
             +  A +R+  A+      RAD  P+  A  S+    +                 G ++
Sbjct: 62  RELRIAVQRVEEARATYGIRRADTLPTISAGGSYVRFRSPGGLLPGGSFDGEAYQVGLME 121

Query: 122 SDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI 180
           S+W++D +G+ R++ +++L    ++ A    A ++VI+ +  +Y+  R   ERI++A + 
Sbjct: 122 SNWELDFWGRVRNLKDAALEEFLASDAARRAATISVIANVADNYLLLRELDERIAVARET 181

Query: 181 LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP 240
           +    +++ +   +F  GA SKL L + E   +  ++ +  LE+S     H ++ L+G P
Sbjct: 182 IASRAESLRIFRRRFEVGAISKLDLRQSEILFQQAQTLVAQLEQSRATQAHALAVLVGAP 241

Query: 241 ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLY 300
           A      +   S      +   ++ G+P+ L+  RPDI   E +L  + A IG A++  +
Sbjct: 242 APLQPAPLDDAS------VCPDLHAGLPSSLLERRPDIVAAEHRLRAANANIGAARAAFF 295

Query: 301 PSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYIT 357
           P ++L G++  T     N F   +  W F P + LPIFD G+ +SN+  A++   E    
Sbjct: 296 PRITLTGAVGSTSTDLQNLFASGSGAWIFTPNISLPIFDAGRNRSNLELAKAREGEAVAQ 355

Query: 358 WQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDI 417
           ++ET+ +A ++V +AL++       V      +    +   L+   Y  G    L++LD 
Sbjct: 356 YEETIQDAFRDVADALSARVWLATQVQAETDTLVAQSERARLARQRYDNGATPFLEVLDA 415

Query: 418 ERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           +R        L   +R L  S V LY A+G G
Sbjct: 416 QRDLLDARQQLIQTRRALLTSRVALYAALGGG 447


>gi|218890965|ref|YP_002439831.1| putative outer membrane protein precursor [Pseudomonas aeruginosa
           LESB58]
 gi|218771190|emb|CAW26955.1| probable outer membrane protein precursor [Pseudomonas aeruginosa
           LESB58]
          Length = 479

 Score =  198 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 112/470 (23%), Positives = 227/470 (48%), Gaps = 25/470 (5%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKN----LINIDTLKWWESFNDTSL 61
            +  +  + L  C++GP +T+P  P          + N           +WW  F+D  L
Sbjct: 5   PLLLIASLALGACSLGPNFTRPDRPAPGEWSLQAAAGNPSHLAAAPLAAQWWTLFDDAQL 64

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK-------- 113
           N L++   + NL +  A  R+  ++    S+  D  PS  AS +++              
Sbjct: 65  NALLQRVQRANLDLRSAAARLQQSRAIRRSLGGDALPSVDASGTYQRQRTTSAGLFDPSG 124

Query: 114 -------TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
                   ++    D+ W++D +G+ RR +E++ A ++++  ++   +++V+++    YI
Sbjct: 125 KAGKGNYNHALAGFDASWELDFWGRVRRELEAADATVEASENELRDVQVSVLAEAARDYI 184

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
             R  + R +I    L+  ++++EL+  +   G  + L + +  A++ S+E+ +P +EK+
Sbjct: 185 QLRGEQNRAAIIRDNLETARRSLELTRTRLANGVATDLEVAQALAQVASMEARLPEVEKN 244

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
               V+ +  L+G      L  +       +P     + +G+P++L + RPDIR  E +L
Sbjct: 245 QAHLVNALGYLVGASPGSLLAELGPARAIPRP--PGSVPVGLPSELAQRRPDIRRAEARL 302

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHDNSF---PGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG+AK+D YP ++LNG+               +  ++ GP   LPIF+ G+++ 
Sbjct: 303 HAATASIGVAKADFYPRITLNGNFGFESLQLSSLGDWDHRQFAIGPAFSLPIFEGGRLRG 362

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            +   E+  QE  I +Q TVL A +EV++A+     +++   +L  AV  +++++  +  
Sbjct: 363 RLELREAQQQEAAIDYQRTVLRAWQEVDDAMHDYAANQRRQERLGEAVAQNRRALQSARE 422

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
            YR G    L +LD +R     +     +   ++ + V+LY A+G G++P
Sbjct: 423 QYRAGAVDFLSVLDSQRQLLDNQEQQVASDEAVSLTLVNLYKALGGGWSP 472


>gi|52840899|ref|YP_094698.1| major facilitator superfamily multidrug-efflux transporter
           [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|52628010|gb|AAU26751.1| multidrug efflux MFS outer membrane protein (RND family)
           [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
          Length = 479

 Score =  198 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 121/476 (25%), Positives = 235/476 (49%), Gaps = 31/476 (6%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK--WWESFNDT 59
             L  +FS+  +   GCTVGP+Y +P + +     +    K + +   +   WW++F+D 
Sbjct: 3   RKLALLFSISCLF--GCTVGPDYQRPDIKIQEKWPTSKVEKKISSSAPVHLTWWKAFHDP 60

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASI--------------- 104
            L++ +  A   NL I  A  RI  A+       A+ +P    S                
Sbjct: 61  LLDRYINEAATNNLDIKAAEARIRQARAMKQISLANFYPQINGSASANSLQISKGTLEGI 120

Query: 105 -----SHRFIPNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVIS 158
                ++  I   +       D+ W++DLFG+ RR +E+S A+L+ AY       L+ I+
Sbjct: 121 FANSPTYTLIDRNQWIYNLGFDAQWELDLFGKTRRKVEASKASLEEAYESRRTILLSTIA 180

Query: 159 KLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESD 218
           ++  SYI+ R  ++   IA + ++L +K + L   ++  G +S++ +   E ++K+ ES 
Sbjct: 181 EIARSYIELRGAQQLYGIAQKNVELQRKTLALVRQRYKAGVSSEVDVSLAEGQLKNTESV 240

Query: 219 IPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDI 278
           +P      ++N + I+ +LG      L  + K  +  +P     + +G+ +D++R RPDI
Sbjct: 241 LPNYITQIQVNAYQIAVMLGKDPQTILKDIAKMQSLPKP--PQKVPMGLRSDILRQRPDI 298

Query: 279 RYQEKKLADSVAKIGIAKSDLYPSLSLNG----SIALTHDNSFPGYNTHWSFGPKLYLPI 334
           R  E++LA +VA+IG+A +D +P  +L+       + + D  F   +  W  GP++ LPI
Sbjct: 299 RATERQLASAVAEIGVAVADFFPQFNLSVSNLAFQSTSVDTLFQSSSGFWLMGPQVSLPI 358

Query: 335 FDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHK 394
           F  G+I++N+   ++ AQ+  I +++ +L A++E ++AL   ++       L+ A+  +K
Sbjct: 359 FRGGQIRANVESKKAVAQQAAIQYKKIILQALQEAQSALARYSQSLDTNHSLRAAIIANK 418

Query: 395 KSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +++  +   ++ G    L +L  E A    E     ++     + + LY A+G G+
Sbjct: 419 RAVQFAKKRFQYGEDDYLSLLQSEAALLNAETQEVNSEVSSLTALISLYKALGGGW 474


>gi|320107813|ref|YP_004183403.1| NodT family RND efflux system outer membrane lipoprotein
           [Terriglobus saanensis SP1PR4]
 gi|319926334|gb|ADV83409.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Terriglobus saanensis SP1PR4]
          Length = 471

 Score =  198 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 109/475 (22%), Positives = 208/475 (43%), Gaps = 28/475 (5%)

Query: 1   MNILRAIFSL------FIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK----NLINIDTL 50
           M  L  + S+        ++LAGC VGP+Y +P  P  P      +         +I   
Sbjct: 1   MKTLLKLGSMAVLGGSMALVLAGCNVGPKYKRPVYPAPPAFRGADDEAIVGEAKNSIADQ 60

Query: 51  KWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP 110
           +W + F +  L  L+  AL  N  +  A +RI   +  +   R+  FP+  A  +     
Sbjct: 61  QWTQIFKEPELQALITQALANNYDLRIAAQRILEQQAQVQITRSQQFPTISAGGTGAGAE 120

Query: 111 NLKTNSTG----------QLDSDWKIDLFG-QRRHIESSLANLDSAYAQVDIAKLNVISK 159
                 +            L + W  D +G  R+  E++   L +        +L ++ +
Sbjct: 121 IPSIGGSSITSPLVVGSFNLSAAWNPDFWGLYRKQTEAARDQLLAQTWAQRAVRLTLVQQ 180

Query: 160 LIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDI 219
           ++ +YI  R    ++ IA Q   + + ++ L+    T G+     + + E  + +  S I
Sbjct: 181 VVTAYIQLRALDHQLEIARQTYKIRQDSVGLTRQLETGGSVPLSDVRQAEQLLYTASSQI 240

Query: 220 PTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIR 279
           P LE+  +   + I  LLG      +       +    NL     +G+P++L+  RPDI+
Sbjct: 241 PQLEQQVQQQENAIKFLLGDNPGTIIRSSPTALSPVPQNLP----VGLPSELLERRPDIQ 296

Query: 280 YQEKKLADSVAKIGIAKSDLYPSLSLNGSIA---LTHDNSFPGYNTHWSFGPKLYLPIFD 336
             E +L  + A IG+A++  +P LS++ S      +  + F            L  P+F 
Sbjct: 297 QTEAQLKAANANIGVARAQFFPQLSISASGGVGGDSFPDIFKSGAQTVYGIGSLSQPLFA 356

Query: 337 KGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKS 396
            GK++  +R ++ + +E  + +Q+T+  A ++V NAL ++N+ +    + Q  V+  K +
Sbjct: 357 GGKLRGQLRLSQQTEKEMVLNYQKTIAGAFRDVSNALIAVNKQRAYREQQQLLVDAAKDA 416

Query: 397 MSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             L+ I Y+ G    L++L  +      ++ L  A++  A + V LY A+G G+ 
Sbjct: 417 TRLARIRYQGGSTGYLEVLTTDSNLFSAQLSLVTAQQNEALTLVQLYAALGGGWQ 471


>gi|298376448|ref|ZP_06986403.1| outer membrane efflux protein [Bacteroides sp. 3_1_19]
 gi|298266326|gb|EFI07984.1| outer membrane efflux protein [Bacteroides sp. 3_1_19]
          Length = 459

 Score =  198 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 108/459 (23%), Positives = 217/459 (47%), Gaps = 14/459 (3%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
           N   A F + ++  + C +G  Y +P + L     +  ++ +  +++ + W   + D +L
Sbjct: 5   NFYIAAFVVSMLAFSSCKIGKRYVRPELNLPDRIEAYTDTTDTASVENIPWESLYADEAL 64

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHR--------FIPNLK 113
             L++ AL  N  +  A  ++           A + P   A+I  +          P   
Sbjct: 65  KDLIRKALDNNKDMKIAAAKVKEMIAAKRISFASMLPEVGANIYAQKERLNYGGDNPKPD 124

Query: 114 TNSTGQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                +L   W++DL+G  R    +++A+           +L +I+++  +Y       +
Sbjct: 125 PEFGAKLTLSWELDLWGNLRWANEAAIASYMETVEGQRALRLTIIAEVAANYYQLCALDQ 184

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            +SI  Q LD  ++ + L+ L++  G TS+ +  + + E+   E+ IP+LE+  ++   +
Sbjct: 185 ELSIVQQTLDARREGVRLAKLRYEGGLTSETAYNQAQVELARTETLIPSLERQIKIKESD 244

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +S LLG    E+   + +  +    +L   + IG+P+ L+  RPD+R  E KL  + A++
Sbjct: 245 LSMLLG----EYTDDIPRGLSLSDQHLPDALPIGLPSSLLERRPDMRQAEFKLRAANAQV 300

Query: 293 GIAKSDLYPSLSLNGSIALTHDNSFPG-YNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           G+A++DL+P + L  +     D       +        L  PIF  GK K+ ++ A++  
Sbjct: 301 GVAQTDLFPKIRLTSNYGFESDELSSILKSPAGFIAGSLLQPIFAMGKNKAKVKAAKARY 360

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           +++  +++++VL A KEV NA+ ++ + K+I     +      K + L+ + Y  G  S 
Sbjct: 361 EQEVYSYEKSVLGAFKEVNNAIVTVRKVKEIRASRMNLEASASKYLELAQLQYINGVISY 420

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +D+LD +R     ++ L+ A      S V LY A+G G+
Sbjct: 421 MDVLDAQRGLLDAQIGLNNAVLDELLSVVYLYKALGGGF 459


>gi|331681988|ref|ZP_08382612.1| cation efflux system protein CusC [Escherichia coli H299]
 gi|331080667|gb|EGI51841.1| cation efflux system protein CusC [Escherichia coli H299]
          Length = 460

 Score =  198 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 108/463 (23%), Positives = 203/463 (43%), Gaps = 16/463 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQF--SIGNSKNLINIDTLKWWESFND 58
           M+  + +     + L GC++ P+Y +P MP+         G      N     W   F D
Sbjct: 1   MSPCKLLPFCVALALTGCSLAPDYQRPAMPVPQQFSLNQNGLVNAADNYQNAGWRTFFVD 60

Query: 59  TSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS-- 116
             +  L+  AL  N  +  AT ++  A+       AD +P      S  +  NLK +S  
Sbjct: 61  NQVKTLISEALVNNRDLRMATLKVQEARAQYRLTDADRYPQLNGEGSGSWSNNLKGDSAS 120

Query: 117 ----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
               +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +   
Sbjct: 121 TREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLAY 180

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
            ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       +
Sbjct: 181 AQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQANN 240

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
            +  LLG     +    Q Q+ N      + +  G+P+ ++  RPDI   E  L  + A 
Sbjct: 241 ALQLLLG----SYGKLPQAQTVNSDSLQSVKLPAGLPSQILLQRPDIMEAEHALMAANAN 296

Query: 292 IGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
           IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  AE
Sbjct: 297 IGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIAE 356

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
              Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G 
Sbjct: 357 IRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARTLYQHGA 416

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            S L++LD ER+       L         + + LY A+G G+ 
Sbjct: 417 VSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGWQ 459


>gi|332002400|gb|AED99289.1| invasion protein [Escherichia coli]
          Length = 460

 Score =  198 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 110/464 (23%), Positives = 207/464 (44%), Gaps = 18/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK---NLINIDTLKWWESFN 57
           M+  + +     + L GC++ P+Y +P MP +P QFS+  +       N     W   F 
Sbjct: 1   MSPCKILPFCVALALTGCSLAPDYQRPAMP-VPQQFSLSQNGLVNAADNYQNAGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS- 116
           D  +  L+  AL  N  +  A  ++  A+       AD +P      S  +  NLK +S 
Sbjct: 60  DNQVKTLISEALVNNRDLRMAALKVQEARAQYRLTDADRYPQLNGEDSGSWSGNLKGDSA 119

Query: 117 -----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +  
Sbjct: 120 TTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       
Sbjct: 180 YAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +    Q Q+ N      + +  G+P+ ++  RPDI   E  L  + A
Sbjct: 240 NALQLLLG----SYGKLPQAQTVNSDSLQSVKLPAGLPSQILLQRPDIMEAEHALMAANA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  A
Sbjct: 296 NIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARALYQHG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             S L++LD ER+       L         + + LY A+G G+ 
Sbjct: 416 AVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGWQ 459


>gi|218887249|ref|YP_002436570.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218758203|gb|ACL09102.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 529

 Score =  198 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 119/494 (24%), Positives = 221/494 (44%), Gaps = 48/494 (9%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKN------------------- 43
           +L     + ++ L+GC VGP+Y +P  P  PT++S   ++                    
Sbjct: 5   LLATGLMVTVLALSGCAVGPDYDRPAPPAAPTEWSAAKTRPEISGDVSGSGAPAESAGSV 64

Query: 44  ------LINIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILS------ 91
                        +WWE   D  L++LV +A+  N   L A   +  A+  +        
Sbjct: 65  APRAAVSAATPDGQWWERMGDPQLSELVAMAVGHNNDALIAAANLREARAVVGVARGALL 124

Query: 92  -----------VRADLFPSSYASISHRFIPNLKTNSTGQLDSDWKIDLFGQRRH-IESSL 139
                       R      +  S+    +P          D+ W+ID+FG  R  +E++ 
Sbjct: 125 PAAAAGGSFERSRVSTNTLTGQSLEMARMPIESDLYQAGFDARWEIDIFGGARRGVEAAR 184

Query: 140 ANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGA 199
           A   +A A +    L+V ++   +Y + R  + R+ +A +  +  ++ +EL  L+   G 
Sbjct: 185 ARQQAAEAGLSDVLLSVAAETARAYAELRGAQARLDVAERNAEAQRRTLELVRLRRDVGV 244

Query: 200 TSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNL 259
            S +++++ EA+++  E+ +P L  +    +H +  L G P       +  ++    P +
Sbjct: 245 ASDMNVLQAEAQLQRTEALVPPLRAATDAAIHRLGVLCGLPPAALRDRLAPRAPL--PAV 302

Query: 260 YIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS--- 316
              + +G+P+DL+  RPDIR  E +L  + A IG  ++DL+P  SL GS  L   +    
Sbjct: 303 PDLVPVGLPSDLLLRRPDIRRVEHELHAATADIGQREADLFPKFSLTGSYGLNSIHFSDL 362

Query: 317 FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSI 376
           F   +  W+  P +   IF+ G+ ++ +   E+  +     W++TVL A +EVE +L   
Sbjct: 363 FRDDSRAWTIMPGVRWAIFEGGRTRAAVAALEARREATLERWRKTVLVAFEEVETSLARY 422

Query: 377 NEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLA 436
            E      +L  ++E   ++  L+ + Y +G   LL +LD ER   +VE  L+ ++  + 
Sbjct: 423 AEAFVERERLSRSLEAQAEATRLAKVRYTEGVDDLLTVLDAERRQLEVEEALARSRSGVL 482

Query: 437 KSYVDLYIAIGSGY 450
              V LY A+G G+
Sbjct: 483 LHLVSLYKALGGGW 496


>gi|302186200|ref|ZP_07262873.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. syringae 642]
          Length = 487

 Score =  198 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 111/469 (23%), Positives = 208/469 (44%), Gaps = 25/469 (5%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINID---TLKWWESFNDT 59
           I      L +VLL+ C VGP+Y KP M       +    +     D      WWE + D 
Sbjct: 15  IRPFALGLCVVLLSACAVGPDYQKPSMAAPAQFKAAQGWRAATPSDGMAKGAWWEVYKDP 74

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN-------- 111
            LN LV+     N T+ Q   +   A+  + S R    P+   +                
Sbjct: 75  QLNALVERLNTSNQTVAQYDAQYRQAQTLVRSSRGAFLPTLDLTTGKTRSGQGTGTSNSG 134

Query: 112 -----LKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
                ++ +   QL   W+ D++G+ RR +E+  AN  ++ A +   +L++ S+L+ +Y+
Sbjct: 135 TSVSGIRNSYNAQLGVSWEADVWGKLRRGLEADTANAQASLADLAAMRLSLQSELVQNYL 194

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
             R   E+  +    +D Y++++ L+  ++  G +   ++ + + ++KS ++D+  L   
Sbjct: 195 QLRVIDEQKRLLESTVDAYQRSLTLTQNQYRAGISGSDAVAQAQTQLKSTQADLIDLAWQ 254

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
                + I+ L+G    +F                     G+P+ L+  RPDI   E+ +
Sbjct: 255 RAQYENAIAVLMGMAPADFNLPATTSIPQLPQIPP-----GLPSQLLERRPDIAAAERSV 309

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG+AK+  YP  +L+ S   +     N     N  WS GP+L L +FD G+  +
Sbjct: 310 MGANANIGVAKAAYYPDFTLSMSGGYSSSTFANWISLPNRFWSVGPQLALTLFDGGRRSA 369

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            + R E+   +    +++TVLN  +EVEN L  +   ++     Q A+   + S+ L+  
Sbjct: 370 EVDRTEAVYDQTVAQYRQTVLNGFQEVENYLVQLKVYEQEAAVRQEALVSARDSLRLTNN 429

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            Y+ G    LD+++++      E  +    +    + V L  A+G G++
Sbjct: 430 QYKAGLIGYLDVVNVQATALSNERSVLSVLQSRLIASVQLIAALGGGWD 478


>gi|323170690|gb|EFZ56340.1| cation efflux system protein cusC [Escherichia coli LT-68]
          Length = 460

 Score =  198 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 110/464 (23%), Positives = 209/464 (45%), Gaps = 18/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK---WWESFN 57
           M+  + +     + L GC++ P+Y +P MP +P QFS+  +  +   D  +   W   F 
Sbjct: 1   MSPCKLLPFCVALALTGCSLAPDYQRPAMP-VPQQFSLSQNGLVNAADNYQNVGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS- 116
           D  +  L+  AL  N  +  AT ++  A+       AD +P      S  +  NLK N+ 
Sbjct: 60  DNQVKTLISEALVNNRDLRMATLKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGNTA 119

Query: 117 -----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +  
Sbjct: 120 TTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       
Sbjct: 180 YAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +    Q Q+ N      + +  G+ + ++  RPDI   E  L  + A
Sbjct: 240 NALQLLLG----SYGKLPQAQTVNSDSLQSVKLPAGLSSQILLQRPDIMEAEHALMAANA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  A
Sbjct: 296 NIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARALYQHG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             S L++LD ER+       L         + + LY A+G G+ 
Sbjct: 416 AVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGWQ 459


>gi|311108821|ref|YP_003981674.1| outer membrane protein OprM 5 [Achromobacter xylosoxidans A8]
 gi|310763510|gb|ADP18959.1| outer membrane protein OprM 5 [Achromobacter xylosoxidans A8]
          Length = 494

 Score =  198 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 114/462 (24%), Positives = 213/462 (46%), Gaps = 24/462 (5%)

Query: 8   FSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDT---LKWWESFNDTSLNK 63
            +L  +L +GC ++ P+Y +P +P+     + G+     +      + W   F D +L  
Sbjct: 17  AALLTLLASGCVSMAPDYNRPALPVPAAYMAPGSEATAASAAAAAEIGWRTYFPDPALQT 76

Query: 64  LVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL----------- 112
           L+  AL  N  + +A  R+  A+      RAD FP+                        
Sbjct: 77  LISSALANNRDLRRALLRVEEARALYGIQRADQFPTIGVQADGSRARVPGDLNLTGQPLV 136

Query: 113 -KTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                 G   + W++D +G+ R + +++L N  ++ A    A L++I+++  SY+  R  
Sbjct: 137 SSQYQVGLGMASWELDFWGRVRSLKDAALQNYLASDAAARAATLSLIAEVADSYLSLREL 196

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
            ER+++  + +   ++++ +   +F +GA SKL L ++E   +  ++    LE++     
Sbjct: 197 DERLALTRETIASREESLRIFRRRFEEGAISKLDLTQVETLWQQAKALGADLEQTRAAQA 256

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  L+G P            ++    L      G+P+DL+ NRPDI   E +L  + A
Sbjct: 257 NALELLVGAPLNLPRLPTHLDDDSVMRELP----AGLPSDLLVNRPDIVAAEHQLKAANA 312

Query: 291 KIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++   P+++L G+        D  F G +  W+F P + LPIFD G+  SN+   
Sbjct: 313 NIGAARAAFLPTITLTGAFGTASSELDGLFSGGSRAWNFAPSISLPIFDAGRRSSNLDLT 372

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E+   +    +++T+  A K+V +AL++     + V  L+  V    +   L+ + Y  G
Sbjct: 373 EARRDQAVAAYEQTIQTAFKDVSDALSARYWLAEQVDVLRATVAAQSERARLAQLRYDHG 432

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
               L++LD +R     +  L+  +R L  S V LY A+G G
Sbjct: 433 ASPYLEVLDAQRDLLAAQQKLAQTRRALLSSRVRLYAALGGG 474


>gi|320353442|ref|YP_004194781.1| NodT family RND efflux system, outer membrane lipoprotein
           [Desulfobulbus propionicus DSM 2032]
 gi|320121944|gb|ADW17490.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfobulbus propionicus DSM 2032]
          Length = 491

 Score =  198 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 120/460 (26%), Positives = 220/460 (47%), Gaps = 16/460 (3%)

Query: 6   AIFSLFIVLLAGCT-VGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKL 64
            +F L + LL  C  VGP+Y  P   +         S N        WW  F D  L+ L
Sbjct: 12  ILFLLSVALLTACAPVGPDYQPPQTAMPSQWSEGTGSGNTPATTLSHWWSLFRDPLLDSL 71

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTG------ 118
           +  AL  N  +  A  R+  A+       A L PS     S+      +   +       
Sbjct: 72  IARALTANPDLRIAETRVVEARAARRIATASLLPSVDLGGSYTTSRRSERVQSSDRYQDV 131

Query: 119 ---QLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
                D+ W++DLFG  RR  E++ ANL +         +++ +++  +YI+ R  ++R+
Sbjct: 132 FETGFDAGWELDLFGGVRRQAEAAEANLAATVEDWRGVCVSLAAEVARNYIELRSSQQRL 191

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
           +IA +   + ++ +E+   KF  G  S L + + E  +    +++P LE S    +H ++
Sbjct: 192 AIARENSRIQEQTVEVVRNKFHLGLGSDLEVAQAETLLAQTRAEMPLLESSAAQAMHQLA 251

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
            LLG         ++  +    P +   +   +P++L+R RPDIR  E++LA + A +G 
Sbjct: 252 LLLGQQPQT--LKLELTAEAPLPPVPPHLPHVLPSELLRQRPDIRSAERRLAVATATVGA 309

Query: 295 AKSDLYPSLSLNGSIALTHDNSFP---GYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           A +DL+P  SL+  I L   +        +  WS GP +  P+FD G  ++ +  +E+  
Sbjct: 310 ATADLFPRFSLSALIGLQSTSLGDLIASGSRFWSAGPAVRWPLFDGGTARAAVDASEAQR 369

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           +   +T+++TVL A+ E ENAL ++  ++     LQ AV+  ++++ ++   Y+ G    
Sbjct: 370 RRAELTYEQTVLTALTETENALVTLERERTTHAILQEAVKASQRAVVIAHGQYQAGITPF 429

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           L++L  + A  + +  L+ + ++LA   + LY A+G G+ 
Sbjct: 430 LNVLQSQNALYQSQDKLAQSGQRLAIGMLTLYKALGGGWQ 469


>gi|270158445|ref|ZP_06187102.1| NodT family efflux transporter [Legionella longbeachae D-4968]
 gi|289166717|ref|YP_003456855.1| outer membrane efflux protein [Legionella longbeachae NSW150]
 gi|269990470|gb|EEZ96724.1| NodT family efflux transporter [Legionella longbeachae D-4968]
 gi|288859890|emb|CBJ13876.1| putative outer membrane efflux protein [Legionella longbeachae
           NSW150]
          Length = 517

 Score =  198 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 113/469 (24%), Positives = 219/469 (46%), Gaps = 23/469 (4%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLN 62
           +L+       ++L+ C VGP Y +P  P+         S          WW+ F+D  L 
Sbjct: 1   MLKIFTLAISLMLSACMVGPNYKEPIKPVAAHWPQKNASVKETPFKDTNWWQVFHDPVLT 60

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS------------HRFIP 110
            L+      NLT+     R+   +  +     +L+P   A++S               +P
Sbjct: 61  SLIYQGYHNNLTLQATGVRVLQTRALLAQSVGELYPQQQAAVSSFNYYKIGGSELQTVLP 120

Query: 111 NLKTNSTGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                 +    ++W+ID +G+ R  I+++ A   S+ A  D A + + + +  +YI+ R 
Sbjct: 121 PTFETLSLGFSANWEIDFWGKYRRAIQANDAVFLSSLAAYDNALVTLTADVATTYINIRM 180

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
           ++ +I +  Q + + ++ + ++  ++  G T+ + + + + E+   E+ +P LE S    
Sbjct: 181 YETKIKVTKQNIVVQREGLNIARARYNAGQTNLIDVEQAQTELSQTEASLPPLESSLEQQ 240

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            + ++ LLG       + ++K      P     + +GIP + +  RPDI     +     
Sbjct: 241 KNALALLLGTVPNGVDNQLRKSRG--IPIAPSTVAVGIPKETLARRPDIYEARLEAVSES 298

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHDNS--------FPGYNTHWSFGPKLYLPIFDKGKIK 341
           AKIG  K++L+PSL+LNG+ + + +N         F   N + + GP L  PI + G+I 
Sbjct: 299 AKIGEIKANLFPSLALNGTFSFSSNNIGPNSLSDLFQPSNRNITAGPSLTWPILNYGQIT 358

Query: 342 SNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSM 401
           + +R  +++ Q+  + +   VL A +EV+N++T+  E KK    L  A     K++ L++
Sbjct: 359 NAVRAQDAAYQQSLLRYVNLVLKAQQEVQNSITAYIEAKKAERALTTANIAAVKTLKLAI 418

Query: 402 INYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           I Y +G      +L+ E+    V+  L  A+  +  + V LY A+G G+
Sbjct: 419 IRYMEGETDFTPVLNAEQQQLSVQTSLVSAQANIPAALVSLYRALGGGW 467


>gi|307822568|ref|ZP_07652799.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Methylobacter tundripaludum SV96]
 gi|307736172|gb|EFO07018.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Methylobacter tundripaludum SV96]
          Length = 482

 Score =  198 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 125/463 (26%), Positives = 230/463 (49%), Gaps = 32/463 (6%)

Query: 16  AGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           +GC  VGP+Y +P +P +P Q++   +      +  +WW++FND  L+KL+  A+  NL 
Sbjct: 15  SGCFAVGPDYQRPKIP-IPRQWTETPAVQGSQPE--QWWKTFNDPILDKLISEAIASNLD 71

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK--------------------- 113
           +  A ER+  A+    +  A   PS  A  S     N                       
Sbjct: 72  LKLALERVKDARALRSATIAAGLPSLDAKSSASRRFNNSSSPASQTGTSSAGGGFGIGNQ 131

Query: 114 --TNSTGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                    D+ W++D FG  R  +ES+ A +D          + ++ ++  +YI+ R  
Sbjct: 132 FINIFQMGFDAQWELDFFGGVRRAVESADATIDVEVENSRDVLVTLLGEVARNYIELRAN 191

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           +  I+I  + L   ++  EL+ ++   G    L + + +A   + E+ +P  E + + ++
Sbjct: 192 QRLIAITRENLHAQQETQELTQIRQQTGLAGMLEVTQAQALAATTEAQLPNYETAVKQSI 251

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           H +S LLG      +  + +Q     P +   +   +P++L++ RPDIR  E++LA + A
Sbjct: 252 HALSVLLGKEPGALVVRLDQQGT--IPAIAANVITNLPSELLQRRPDIRRAERQLAVANA 309

Query: 291 KIGIAKSDLYPSLSLNGSI--ALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
            +G+A ++LYP ++L   I    T    F      WS    L LPIF+ GK+ +NI   +
Sbjct: 310 SVGVATAELYPKINLAAFIGLQNTTITDFTPVGKSWSAASSLTLPIFNWGKLNANIDSKK 369

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
           +  ++ ++T+Q TVL+A KEVE+AL + +++++    L  AV  ++ ++ L+   Y++G 
Sbjct: 370 AQFEQSFLTYQSTVLSAFKEVEDALIAYSKEQQRHKALAKAVAANQLAVQLANERYQKGL 429

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            + LD+L  + A  + +  L  ++ QLA + V LY A+G G+ 
Sbjct: 430 TAFLDVLTSQTALYQAQSLLVTSESQLAGNLVALYKALGGGWQ 472


>gi|319779583|ref|YP_004130496.1| RND efflux system, outer membrane lipoprotein CmeC [Taylorella
           equigenitalis MCE9]
 gi|317109607|gb|ADU92353.1| RND efflux system, outer membrane lipoprotein CmeC [Taylorella
           equigenitalis MCE9]
          Length = 461

 Score =  198 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 115/459 (25%), Positives = 207/459 (45%), Gaps = 12/459 (2%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M  +R         L  C   P+Y  P + L  T     NS N +++  LKW   F D +
Sbjct: 1   MKFIRLSIIASTAFLTACNFAPKYETPDISLPDTF--NNNSTNQVSVANLKWESFFVDQT 58

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHR-----FIPNLKTN 115
           L KLV++AL+ N  + QA+  + AA+       ++L P   AS              +T 
Sbjct: 59  LKKLVQLALENNHDLKQASLNVLAAQSQYGISVSELIPKVGASFRQNVSEVPRAGIQRTY 118

Query: 116 STGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
             G   ++++ID +G+ R   ES+L    +  +    A++N+I+ +  +Y       E  
Sbjct: 119 IVGLGINNFEIDFWGKIRNQNESALQKYFATESAQKAAQINLIAAVANTYFAYAVLSENE 178

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
            I   IL+ Y     L   KF+ G  S+L L + ++ + + +S +    K+  +  + + 
Sbjct: 179 KIIRDILNSYNTTYNLIKQKFSVGLASQLELNQAQSSVLTAQSKLEETLKNKALTYNALQ 238

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
            + G    + L+ +  Q+N F   +   +  G+P+ L+  RPDI   E  L  + A IG 
Sbjct: 239 LMTGISFKDVLN-LNNQTNVFNKKIVQDLPPGLPSSLLTRRPDIIASEHNLKSTYADIGA 297

Query: 295 AKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           A++  +PS+SL G   L   +    F   +  W+F P + LPIF  G +K+    A    
Sbjct: 298 ARAAFFPSISLTGLFGLVSGDLNKLFTPNHETWNFTPTVTLPIFAAGALKNAKDLATVRK 357

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           +   + +++TV  A KEV +AL +I   +  +       +L +++  L+ + Y  G  + 
Sbjct: 358 EIAVVNYEKTVYTAFKEVNDALITIESSENQLKNSSEQAKLMEQNSKLAFMRYEAGIDNF 417

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           L +   +      +     +  Q  ++ V+LY A+G G+
Sbjct: 418 LQVQQAQLGVLNSKQAYLNSLLQSLQAKVNLYKALGGGW 456


>gi|330900291|gb|EGH31710.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. japonica str. M301072PT]
          Length = 487

 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 113/469 (24%), Positives = 208/469 (44%), Gaps = 25/469 (5%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINID---TLKWWESFNDT 59
           I      L +VLL+ C VGP+Y KP M       +    +     D      WWE + D 
Sbjct: 15  IRPFALGLCVVLLSACAVGPDYQKPSMAAPAQFKAAQGWRTATPSDGMAKGAWWEVYKDP 74

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN-------- 111
            LN LV+     N T+ Q   +   A+  + S RA   P+   +                
Sbjct: 75  QLNALVERLNTSNQTVAQYDAQYRQAQTLVRSSRAAFLPTLDLTTGKTRSGQGTGTSNSG 134

Query: 112 -----LKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
                ++ +   QL   W+ D++G+ RR +E+  AN  ++ A +   +L++ S+L+ +Y+
Sbjct: 135 TSTSGIRNSYNAQLGVSWEADVWGKLRRGLEADTANAQASLADLAAMRLSLQSELVQNYL 194

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
             R   E+  +    +D Y++++ L+  ++  G +   ++ + + ++KS ++D+  L   
Sbjct: 195 QLRVIDEQKRLLESTVDAYQRSLTLTQNQYRAGISGSDAVAQAQTQLKSTQADLIDLAWQ 254

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
                + I+ L+G    +F                     G+P+ L+  RPDI   E+ +
Sbjct: 255 RAQYENAIAVLMGMAPADFNLPATTSIPQLPHIPP-----GLPSQLLERRPDIAAAERSV 309

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG+AK+  YP  +L+ S   +     N     N  WS GP+L L +FD G+  +
Sbjct: 310 MGANANIGVAKAAYYPDFTLSMSGGYSSSTFANWISLPNRFWSVGPQLALTLFDGGRRSA 369

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
              R E+   +    +++TVLN  +EVEN L  +   ++     Q A+   + S+ L+  
Sbjct: 370 EFDRTEAVYDQTVAQYRQTVLNGFQEVENYLVQLKVYEQEAAVRQEALVSARDSLRLTNN 429

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            Y+ G    LD+++++      E  +    +    + V L  A+G G+N
Sbjct: 430 QYKAGLIGYLDVVNVQATALSNERSVLSVLQSRLIASVQLIAALGGGWN 478


>gi|196228343|ref|ZP_03127210.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Chthoniobacter flavus Ellin428]
 gi|196227746|gb|EDY22249.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Chthoniobacter flavus Ellin428]
          Length = 469

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 107/468 (22%), Positives = 201/468 (42%), Gaps = 23/468 (4%)

Query: 1   MNILR----AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESF 56
           M   R    A+  L   L+AGC VGP+Y +P  P  P  +    ++         WW+ F
Sbjct: 1   MRRPRFFHSALSILVAGLIAGCAVGPDYQRPSSPTPPG-WGWKVAEPRDESIRGDWWQLF 59

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN----- 111
           +D  L +L   A   N T+  A  R++ A+       +   P      S           
Sbjct: 60  HDPELTRLENQATAANQTVQAAMARVDQARAVARITASRFAPQIGFDPSLNRFHTQLNHV 119

Query: 112 ----LKTNSTGQLDSDWKIDLFGQRRHIESSLANLDSAYA-QVDIAKLNVISKLIPSYID 166
                 T +T  LD  +++DL+G+ R    +     +A A       L +   +  +Y  
Sbjct: 120 PSLLTATQTTLPLDLSYEVDLWGKIRRAFEASRAQAAASAADYYQVLLTLHGDVAANYFL 179

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
            R  + ++ I  + ++L +K +++   +   G      L +   E+    + +  +++  
Sbjct: 180 LRQAEAQVEILQRTVELRQKAVDIVAQRQQVGLAPAFDLDRARTELAQSNTTLTEMQRQR 239

Query: 227 RMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLA 286
                 I+ L G PA  F     K   +        +  G+P+ L+  RPDI   E+++A
Sbjct: 240 TTLRDTIALLCGQPAPGFHIASGKLERDI-----PSVPTGLPSALVERRPDIAAAERRMA 294

Query: 287 DSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSN 343
            + A+IG+AK+  +PS++L G +  +  ++       +  +  GP + +P+ + G++ + 
Sbjct: 295 AANAQIGVAKAAFFPSITLTGDMGYSSFHASTLLDWESHLFQVGPAVTMPLLNGGRLTAG 354

Query: 344 IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
           ++ A+++ +     +Q+ VL A KEV +AL  +N   K     + AV    ++   S   
Sbjct: 355 LKDAKANYRAVCAGYQQQVLVAFKEVSDALVDVNSYAKQAGSEKDAVASSTRAADSSYER 414

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           Y+QG     D+LD +R   + E+  +        S V L  A+G G+N
Sbjct: 415 YQQGLVPYFDVLDSQRTQLQTELQAAQLNGLRLISTVHLIKALGGGFN 462


>gi|53802442|ref|YP_112818.1| outer membrane efflux family protein [Methylococcus capsulatus str.
           Bath]
 gi|53756203|gb|AAU90494.1| outer membrane efflux family protein [Methylococcus capsulatus str.
           Bath]
          Length = 518

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 121/458 (26%), Positives = 229/458 (50%), Gaps = 27/458 (5%)

Query: 17  GC-TVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNLTI 75
           GC  +GP++ +P + L  T +     K     D   WW+ FND  L++L++ A +QNL +
Sbjct: 28  GCNKIGPDFHRPEIKLTDT-WLDAPKKAAKAGDFRNWWKLFNDPVLDRLIEKAYRQNLDV 86

Query: 76  LQATERINAAKENILSVRADLFPSSYASISHRFIP--------------NLKTNSTGQLD 121
            +A  RI  A+  +   +  LFP         F                +  T      D
Sbjct: 87  QKAAIRIYQARAQLGIAKGYLFPQKQNVGMDTFYERISEYSPYYQGSDFHTFTYFQTGFD 146

Query: 122 SDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI 180
           + W++D++G+ R  I+++ A L ++  Q D   + + +++  +Y+  R F +R+++A   
Sbjct: 147 AMWELDIWGRFRRGIDAAGAELAASTLQYDDMVVTLTAEVAAAYVQIRTFNQRLALAKGN 206

Query: 181 LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP 240
            DL +++  ++  +F  G +++L + + +A  ++  ++I  LE   R + + +S LLG  
Sbjct: 207 ADLQERSFRVAESQFRNGLSTELDMQQAKALHQATLAEIANLEVGLRQSKNALSVLLGMQ 266

Query: 241 ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLY 300
            +     +   S+   P     I +GIP D++R RPD+R QE K A   A+IGIA+S+L 
Sbjct: 267 PSHLEKELGPDSD--IPAARSEIAMGIPTDILRRRPDVRAQEYKAASQCAQIGIAESELL 324

Query: 301 PSLSLNGSIALTHD--------NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQ 352
           P LSL G++             N+         FGP +  PIF  G++ +N+R  ++  Q
Sbjct: 325 PRLSLVGTVGFNSGSVDGLDVANAISPSGLAGKFGPTVIWPIFQYGRLTNNVRVQDAKFQ 384

Query: 353 EQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLL 412
           E    ++ TVL A++EVE+A+ +  + ++ V  L   V   +++  L++  Y+ G     
Sbjct: 385 ELLTDYRSTVLRALREVEDAIIAFKKAEERVASLSDGVRASQRAAELALRQYQNGLEDYT 444

Query: 413 DILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            +L+ E    + +  L+ ++  +A+S + +Y A+G G+
Sbjct: 445 RVLNSELFLVQQQDRLTASRGDVARSVIAMYKALGGGW 482


>gi|256840694|ref|ZP_05546202.1| outer membrane protein oprM [Parabacteroides sp. D13]
 gi|256737966|gb|EEU51292.1| outer membrane protein oprM [Parabacteroides sp. D13]
          Length = 459

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 109/459 (23%), Positives = 218/459 (47%), Gaps = 14/459 (3%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
           N   A F + ++  + C +G  Y +P + L     +  ++ +  +++ + W   + D +L
Sbjct: 5   NFYIAAFVVSMLAFSSCKIGKRYVRPELNLPDRIEAYTDTTDTASVENIPWESLYADEAL 64

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHR--------FIPNLK 113
             L++ AL  N  +  A  ++           A + P   A+I  +          P   
Sbjct: 65  KDLIRKALDNNKDMKIAAAKVKEMIAAKRISFASMLPEVGANIYAQKERLNYGGDNPKPD 124

Query: 114 TNSTGQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                +L   W++DL+G  R    +++A+           +L +I+++  +Y       +
Sbjct: 125 PEFGAKLTLSWELDLWGNLRWANEAAIASYMETVEGQRALRLTIIAEVAANYYQLCALDQ 184

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            +SI  Q LD  ++ + L+ L++  G TS+ +  + + E+   E+ IP+LE+  ++   +
Sbjct: 185 ELSIVQQTLDARREGVRLAKLRYEGGLTSETAYNQAQVELARTETLIPSLERQIKIKESD 244

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +STLLG    E+   + +  +    +L   + IG+P+ L+  RPD+R  E KL  + A++
Sbjct: 245 LSTLLG----EYTDDIPRGLSLSDQHLPDALPIGLPSSLLERRPDMRQAEFKLRAANAQV 300

Query: 293 GIAKSDLYPSLSLNGSIALTHDNSFPG-YNTHWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           G+A++DL+P + L  +     D       +        L  PIF  GK K+ ++ A++  
Sbjct: 301 GVAQTDLFPKIRLTSNYGFESDELSSILKSPAGFIAGSLLQPIFAMGKNKAKVKAAKARY 360

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           +++  +++++VL A KEV NA+ ++ + K+I     +      K + L+ + Y  G  S 
Sbjct: 361 EQEVYSYEKSVLGAFKEVNNAIVTVRKVKEIRASRMNLEASASKYLELAQLQYINGVISY 420

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +D+LD +R     ++ L+ A      S V LY A+G G+
Sbjct: 421 MDVLDAQRGLLDAQIGLNNAVLDELLSVVYLYKALGGGF 459


>gi|148265519|ref|YP_001232225.1| RND efflux system outer membrane lipoprotein [Geobacter
           uraniireducens Rf4]
 gi|146399019|gb|ABQ27652.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Geobacter uraniireducens Rf4]
          Length = 470

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 105/472 (22%), Positives = 203/472 (43%), Gaps = 26/472 (5%)

Query: 1   MNILRAIFSLFIVLLAGCT-VGPEYTKPHMPLLPTQFSIGNSKNLI------NIDTLKWW 53
           M     I ++    LAGC  + P+YT+P  P+     S    K++        +  + W 
Sbjct: 1   MIRTTVIVAVLAGALAGCATMAPKYTRPEPPVPAAWPSGPAYKDVAGKPADMAVADIPWA 60

Query: 54  ESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL- 112
           E F D  L K+V ++L  N  +  A   I  ++      R+DLFP   AS +        
Sbjct: 61  EFFLDPQLRKVVALSLDNNRDLRVAALNIERSRAQYQIQRSDLFPKVDASAAGSVQRVPA 120

Query: 113 -----------KTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKL 160
                         + G   S +++DLFG+ R + + +L    +        ++++++++
Sbjct: 121 DLSGSGQAMIRHQYNVGLGVSSYELDLFGRVRSLKDQALEQYLATEQARRSVQISLVAEV 180

Query: 161 IPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIP 220
             +++     +ER+ +A + L   + + +L   +   G +S L L + +  + +   DI 
Sbjct: 181 AGNWLALAADRERLQLAKETLVSQQASYQLVKSRVEAGVSSALDLHQAQTSVDTARVDIA 240

Query: 221 TLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRY 280
                   + + ++ ++G P    L                 +  G+P+D++  RPDI  
Sbjct: 241 RYTTFVAQDENALNLVVGSPVPAELLPAALSETLT---ALKDVAPGLPSDVLLRRPDILQ 297

Query: 281 QEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDK 337
            E  L  + A IG A++  +P ++L  S+ +  D     F G    WSF P++ LPIFD 
Sbjct: 298 AEGFLKGANANIGAARAAFFPRITLTSSVGVGSDGLSGLFKGGAFAWSFAPQITLPIFDA 357

Query: 338 GKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSM 397
           G  ++N++ AE         +++++  A +EV +AL         +   Q   +   +S 
Sbjct: 358 GSRQANLKVAEVDRDIAVAQYEKSIQTAFREVADALAQRGTIDDQLAAQQSLTDATGESY 417

Query: 398 SLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           +LS   Y +G  S L++LD +R+    + ++   +     +   LY  +G G
Sbjct: 418 NLSQARYEKGVDSYLNVLDSQRSLYGAQQNMISVRLARLNNLATLYKVLGGG 469


>gi|167647987|ref|YP_001685650.1| RND efflux system outer membrane lipoprotein [Caulobacter sp. K31]
 gi|167350417|gb|ABZ73152.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Caulobacter sp. K31]
          Length = 467

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 104/465 (22%), Positives = 207/465 (44%), Gaps = 19/465 (4%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M     +  L    L+ CT+ P   +P + +         +   +    L W E F D  
Sbjct: 1   MLRNLTLTLLAASALSACTLAPATVRPTLAVDNAWPIASTNAGPVTAADLGWREVFIDPR 60

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF------------ 108
           L  +++++L  N  +  A   I  A+      RA L P   A+ +               
Sbjct: 61  LQGVIELSLSNNRDLRVAVLNIEKARAQYRVQRAALVPGVDATATGTKGETSTAQTQPGA 120

Query: 109 IPNLKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
             +++T + G   + +++D+FG+ R + +++L +  +        ++++I++   +++  
Sbjct: 121 SRDVETYTAGVGVTSYELDIFGRVRSLKDAALQSYLATRETSRAVQISLIAQTANAWLAL 180

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
              ++ +++A   L   ++++ L+  +F  GA ++L L + E   ++  SD+ T      
Sbjct: 181 AADQDLLALARDTLSTREESLRLTRSRFDAGAANQLDLRQAETLAETARSDVATYIAQVE 240

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
            + + +  ++G         +          +   +  G+P+D++  RPD+   E +LA 
Sbjct: 241 QDKNALRLVVGANVPAD---LLPAGGLVTAQILPDLPAGLPSDVLTRRPDVLAAEHQLAG 297

Query: 288 SVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNI 344
           + A IG A++  +PS++L GS  +  D   + F G N  WSF P++ LPIF  G   +N+
Sbjct: 298 ANANIGAARAAFFPSITLTGSAGVASDSLGSLFDGGNGTWSFAPRISLPIFAGGANVANL 357

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
             A++S      T+++TV  A +EV + L   +  +  V   +  V     ++ LS   Y
Sbjct: 358 DGAKASRDIAVATYEKTVQTAFREVADGLAVQSTIQDRVGSQERLVAAANDTVRLSRARY 417

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
             G  S L +LD +R     +  L  A+   A +   LY A+G G
Sbjct: 418 GAGIDSSLTLLDAQRTLYASQQGLIGARLARATNLATLYKALGGG 462


>gi|238828134|pdb|3D5K|A Chain A, Crystal Structure Of The Oprm Channel In A Non-Symmetrical
           Space Group
 gi|238828135|pdb|3D5K|B Chain B, Crystal Structure Of The Oprm Channel In A Non-Symmetrical
           Space Group
 gi|238828136|pdb|3D5K|C Chain C, Crystal Structure Of The Oprm Channel In A Non-Symmetrical
           Space Group
          Length = 474

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 96/454 (21%), Positives = 188/454 (41%), Gaps = 25/454 (5%)

Query: 19  TVGPEYTKPHMPLLPTQ-----FSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQNL 73
           ++ P+Y +P  P+         +        +    + W E F D  L +L+ +AL+ N 
Sbjct: 2   SLIPDYQRPEAPVAAAYPQGQAYGQNTGAAAVPAADIGWREFFRDPQLQQLIGVALENNR 61

Query: 74  TILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDS----------- 122
            +  A   + A +      RADLFP      S          ST    +           
Sbjct: 62  DLRVAALNVEAFRAQYRIQRADLFPRIGVDGSGTRQRLPGDLSTTGSPAISSQYGVTLGT 121

Query: 123 -DWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI 180
             W++DLFG+ R +   +L    +       A+  +++ +  +Y+  +  + ++ +    
Sbjct: 122 TAWELDLFGRLRSLRDQALEQYLATEQAQRSAQTTLVASVATAYLTLKADQAQLQLTKDT 181

Query: 181 LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP 240
           L  Y+K+ +L+   +  G  S L L + +  ++   + +    +    + + +  LLG  
Sbjct: 182 LGTYQKSFDLTQRSYDVGVASALDLRQAQTAVEGARATLAQYTRLVAQDQNALVLLLG-- 239

Query: 241 ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLY 300
               +     Q       L   +  G+P+DL++ RPDI   E +L  + A IG A++  +
Sbjct: 240 --SGIPANLPQGLGLDQTLLTEVPAGLPSDLLQRRPDILEAEHQLMAANASIGAARAAFF 297

Query: 301 PSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYIT 357
           PS+SL  +           F   +  W F P + LPIF  G +++++  A+         
Sbjct: 298 PSISLTANAGTMSRQLSGLFDAGSGSWLFQPSINLPIFTAGSLRASLDYAKIQKDINVAQ 357

Query: 358 WQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDI 417
           +++ +  A +EV + L +     + +   +  V+   +   L+   YR G  + L +LD 
Sbjct: 358 YEKAIQTAFQEVADGLAARGTFTEQLQAQRDLVKASDEYYQLADKRYRTGVDNYLTLLDA 417

Query: 418 ERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +R+    +  L   +     S V+LY A+G G+N
Sbjct: 418 QRSLFTAQQQLITDRLNQLTSEVNLYKALGGGWN 451


>gi|66045721|ref|YP_235562.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. syringae B728a]
 gi|63256428|gb|AAY37524.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. syringae B728a]
          Length = 487

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 111/469 (23%), Positives = 209/469 (44%), Gaps = 25/469 (5%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINID---TLKWWESFNDT 59
           I      L +VLL+ C VGP+Y KP M       +    +     D      WWE + D 
Sbjct: 15  IRPFALGLCVVLLSACAVGPDYQKPSMAAPAQFKAAQGWRTATPSDGMGKGAWWEVYKDP 74

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN-------- 111
            LN LV+     N T+ Q   +   A+  + S RA   P+   +                
Sbjct: 75  QLNALVERLNTSNQTVAQYDAQYRQAQTLVRSSRAAFLPTLDLTTGKTRSGQGTGTSNSG 134

Query: 112 -----LKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
                ++ +   QL   W+ D++G+ RR +E+  AN  ++ A +   +L++ S+L+ +Y+
Sbjct: 135 TSASGIRNSYNAQLGVSWEADVWGKLRRGLEADTANAQASLADLAAMRLSLQSELVQNYL 194

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
             R   E+  +    +D Y++++ L+  ++  G +   ++ + + ++KS ++D+  L   
Sbjct: 195 QLRVIDEQKRLLESTVDAYQRSLTLTQNQYRAGISGSDAVAQAQTQLKSTQADLIDLAWQ 254

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
                + I+ L+G    +F                     G+P+ L+  RPDI   E+ +
Sbjct: 255 RAQFENAIAVLMGMAPADFNLPASTSIPQLPQIPP-----GLPSQLLERRPDIAAAERSV 309

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG+A++  YP  +L+ S   +     N     N  WS GP+L L +FD G+  +
Sbjct: 310 MGANANIGVARAAYYPDFTLSMSGGYSSSTFANWISLPNRFWSVGPQLALTLFDGGRRSA 369

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            + R E+   +    +++TVLN  +EVEN L  +   ++     Q A+   + S+ L+  
Sbjct: 370 EVDRTEAVYDQTVAQYRQTVLNGFQEVENYLVQLKVYEQEAAVRQEALVSARDSLRLTNN 429

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            Y+ G    LD+++++      E  +    +    + V L  A+G G++
Sbjct: 430 QYKAGLIGYLDVVNVQATALSNERSVLSVLQSRLIASVQLIAALGGGWD 478


>gi|330953402|gb|EGH53662.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae Cit 7]
          Length = 487

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 114/469 (24%), Positives = 210/469 (44%), Gaps = 25/469 (5%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINID---TLKWWESFNDT 59
           I      L +VLL+ C VGP+Y KP M       +    +     D      WWE + D 
Sbjct: 15  IRPFALGLCVVLLSACAVGPDYQKPSMAAPAQFKAAQGWRAATPSDGMAKGAWWEVYKDP 74

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN-------- 111
            LN LV+     N T+ Q   +   A+  + S RA   P+   +                
Sbjct: 75  QLNALVERLNTSNQTVAQYDAQYRQAQTLVRSSRAAFLPTLDLTTGKTRSGQGTGTSNTG 134

Query: 112 -----LKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
                ++ +   QL   W+ D++G+ RR +E+  AN  ++ A +   +L++ S+L+ +Y+
Sbjct: 135 TSASGIRNSYNAQLGVSWEADVWGKLRRGLEADTANAQASLADLAAMRLSLQSELVQNYL 194

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
             R   E+  +    +D Y++++ L+  ++  G +   ++ + + ++KS ++D+  L   
Sbjct: 195 QLRVIDEQKRLLESTVDAYQRSLTLTQNQYRAGISGSDAVAQAQTQLKSTQADLIDLAWQ 254

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
                + I+ L+G    +F   +                 G+P+ L+  RPDI   E+ +
Sbjct: 255 RAQYENAIAVLMGMAPADFNLPVTTSIPQLPQIPP-----GLPSQLLERRPDIAAAERSV 309

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG+AK+  YP  +L+ S   +     N     N  WS GP+L L +FD GK  +
Sbjct: 310 MGANANIGVAKAAYYPDFTLSMSGGYSSSTFANWISLPNRFWSVGPQLALTLFDGGKRSA 369

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            + R E+   +    +++TVLN  +EVEN L  +   ++     Q A+   + S+ L+  
Sbjct: 370 EVDRTEAVYDQTVAQYRQTVLNGFQEVENYLVQLKVYEQEAAVRQEALVSARDSLRLTNN 429

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            Y+ G    LD+++++      E  +    +    + V L  A+G G+N
Sbjct: 430 QYKAGLIGYLDVVNVQATALSNERSVLSVLQSRLIASVQLIAALGGGWN 478


>gi|323976448|gb|EGB71538.1| NodT family protein efflux transporter [Escherichia coli TW10509]
          Length = 462

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 110/464 (23%), Positives = 208/464 (44%), Gaps = 18/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK---NLINIDTLKWWESFN 57
           M+  + +     + L GC++ P+Y +P MP +P QFS+  +     + N     W   F 
Sbjct: 3   MSPCKLLPFCVALALTGCSLAPDYQRPAMP-VPQQFSLSQNGLVNAVDNYQNAGWRTFFV 61

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS- 116
           D  +  L+  AL  N  +  AT ++  A+       AD +P      S  +  NLK +S 
Sbjct: 62  DNQVKTLISEALVNNRDLRMATLKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGDSA 121

Query: 117 -----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +  
Sbjct: 122 TTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLA 181

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       
Sbjct: 182 YAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN 241

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +    Q Q+ N      + +  G+ + ++  RPDI   E  L  + A
Sbjct: 242 NALQLLLG----NYGKLPQAQTVNSDSLQSVKLPAGLSSQILLQRPDIMEAEHALMAANA 297

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  A
Sbjct: 298 NIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIQIPIFNAGRNQANLDIA 357

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G
Sbjct: 358 EIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARALYQHG 417

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             S L++LD ER+       L         + + LY A+G G+ 
Sbjct: 418 AVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGWQ 461


>gi|91209617|ref|YP_539603.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli UTI89]
 gi|117622795|ref|YP_851708.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli APEC O1]
 gi|218557512|ref|YP_002390425.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli S88]
 gi|237707458|ref|ZP_04537939.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia sp. 3_2_53FAA]
 gi|91071191|gb|ABE06072.1| probable outer membrane lipoprotein CusC precursor [Escherichia
           coli UTI89]
 gi|115511919|gb|ABI99993.1| probable outer membrane lipoprotein CusC precursor [Escherichia
           coli APEC O1]
 gi|218364281|emb|CAR01952.1| copper/silver efflux system, outer membrane component [Escherichia
           coli S88]
 gi|226898668|gb|EEH84927.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia sp. 3_2_53FAA]
 gi|294489518|gb|ADE88274.1| cation efflux system protein CusC [Escherichia coli IHE3034]
 gi|307627990|gb|ADN72294.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli UM146]
 gi|323958330|gb|EGB54036.1| NodT family protein efflux transporter [Escherichia coli H263]
          Length = 460

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 110/464 (23%), Positives = 207/464 (44%), Gaps = 18/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK---NLINIDTLKWWESFN 57
           M+  + +     + L GC++ P+Y +P MP +P QFS+  +       N     W   F 
Sbjct: 1   MSPCKLLPFCVALALTGCSLAPDYQRPAMP-VPQQFSLSQNGLVNAADNYQNAGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS- 116
           D  +  L+  AL  N  +  A  ++  A+       AD +P      S  +  NLK +S 
Sbjct: 60  DNQVKTLISEALVNNRDLRMAALKVQEARAQYRLTDADRYPQLNGEDSGSWSGNLKGDSA 119

Query: 117 -----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +  
Sbjct: 120 TTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       
Sbjct: 180 YAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +    Q Q+ N      + +  G+P+ ++  RPDI   E  L  + A
Sbjct: 240 NALQLLLG----SYGKLPQAQTVNSDSLQSVKLPAGLPSQILLQRPDIMEAEHALMAANA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  A
Sbjct: 296 NIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARALYQHG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             S L++LD ER+       L         + + LY A+G G+ 
Sbjct: 416 AVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGWQ 459


>gi|222109536|ref|YP_002551800.1| NodT family RND efflux system, outer membrane lipoprotein
           [Acidovorax ebreus TPSY]
 gi|221728980|gb|ACM31800.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Acidovorax ebreus TPSY]
          Length = 481

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 103/446 (23%), Positives = 201/446 (45%), Gaps = 12/446 (2%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGN--SKNLINIDTLKWWESFNDTSLNKLVKIALQQNLT 74
           GC+  P Y +P  P+       G   + +      + W E F D  L +L+ +AL  N  
Sbjct: 26  GCSFIPTYERPAAPVPQAYPLAGAESTTSARAAADIDWKEYFTDPRLQRLIGMALGNNRD 85

Query: 75  ILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLD------SDWKIDL 128
           +  A   +  A+      RA+ FP+  A  S    P+  T S           S W+ID 
Sbjct: 86  LRVAMLNVEQARAQFQIQRANQFPTVNAIASGTRQPSATTGSYANQFQVGLGISAWEIDF 145

Query: 129 FGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKN 187
           FG+   ++    A   +       A++++++ +   ++     +E + I+ + L+   ++
Sbjct: 146 FGRVAALKEQALAQYLATDEARKSAQISLVAAVASGWLTLMADEELLDISRRTLETRDES 205

Query: 188 IELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHY 247
           ++L+ L+   G +S+L   + E+  ++  +     ++   ++ + +  LLG P  + +  
Sbjct: 206 VKLTRLRLENGVSSELDNRQAESLAQAARATYAQQQRQRMLDENALVLLLGQPLPDDIRA 265

Query: 248 MQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNG 307
               S          +  G+P+DL+  RPD+R  E++L  + A IG A++  +P +SL  
Sbjct: 266 SLPSSRLADATPMQALPAGLPSDLLVRRPDVRMAEQQLIGANANIGAARAAFFPRISLTA 325

Query: 308 SIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLN 364
                 D     F   +  +S  P+L LPIFD G+ ++ +  A +  +     +++++  
Sbjct: 326 QFGTVSDELSGLFKSGSWAFSLAPQLALPIFDAGRNQAGLESARAGREIAVAQYEKSIQT 385

Query: 365 AIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKV 424
           A +EV +AL      ++ V   +   +   K   LS + YR G  S LD+LD +R+    
Sbjct: 386 AFREVSDALAGQATLQEQVDAQRAQAQADAKRFELSDLRYRNGVASYLDLLDAQRSLFAT 445

Query: 425 EVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +  L + + Q  ++ V LY  +G G+
Sbjct: 446 QQSLVVTRLQQLQNQVTLYKVLGGGW 471


>gi|281177712|dbj|BAI54042.1| conserved hypothetical protein [Escherichia coli SE15]
          Length = 460

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 109/464 (23%), Positives = 206/464 (44%), Gaps = 18/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK---NLINIDTLKWWESFN 57
           M+  + +     + L GC++ P+Y +P MP +P QFS+  +       N     W   F 
Sbjct: 1   MSPCKLLPFCVALALTGCSLAPDYQRPAMP-VPQQFSLSQNGLVNAADNYQNAGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS- 116
           D  +  L+  AL  N  +  A  ++  A+       AD +P      S  +  NLK +S 
Sbjct: 60  DNQVKTLISEALVNNRDLRMAALKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGDSA 119

Query: 117 -----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +  
Sbjct: 120 TTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       
Sbjct: 180 YAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +    Q Q+ N      + +  G+ + ++  RPDI   E  L  + A
Sbjct: 240 NALQLLLG----SYGKLPQAQTVNSDSLQSVKLPAGLSSQILLQRPDIMEAEHALMAANA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  A
Sbjct: 296 NIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARALYQHG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             S L++LD ER+       L         + + LY A+G G+ 
Sbjct: 416 AVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGWQ 459


>gi|71907785|ref|YP_285372.1| RND efflux system, outer membrane lipoprotein, NodT [Dechloromonas
           aromatica RCB]
 gi|71847406|gb|AAZ46902.1| RND efflux system, outer membrane lipoprotein, NodT [Dechloromonas
           aromatica RCB]
          Length = 475

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 116/470 (24%), Positives = 209/470 (44%), Gaps = 28/470 (5%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINID-----TLKWWESFN 57
           + R         L+GC +GP+Y +P   LLP+ F        + I        +WW  FN
Sbjct: 6   LYRLTPLALAFALSGCAIGPDYLRPSA-LLPSLFGEAKPAETVAIAPNPAIDPRWWTLFN 64

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF--------- 108
           D +LN LV  AL  N ++ QA  R+  A+       A  FP    S +            
Sbjct: 65  DATLNDLVDQALSNNASLRQAIARVEQAEAVAREAGASFFPEIDGSAASSNTKASTKTAT 124

Query: 109 ----IPNLKTNSTGQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPS 163
                P ++   +  L + +++D++G+ R    ++ A L ++    D  ++ V   +  +
Sbjct: 125 YVASQPAIRHARSAGLSTSFELDVWGRVRRANEAAQATLLASQYSRDSIRITVAGLVASN 184

Query: 164 YIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLE 223
           Y+  R +  ++++  + L   + +++L   +   G  S L   + E  + + +  I    
Sbjct: 185 YLALRAYDAQLALTSETLKSREDSLKLVKTRVDAGLVSPLDGYQAEGALAAAQVQIAEQR 244

Query: 224 KSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEK 283
           +   +  H ++ L G P            +  Q  L      G+P+DLI  RPD+R  E 
Sbjct: 245 RQRALAEHQLALLTGNP-----ELKLAAGDLRQLPLPPLPPAGLPSDLIEGRPDVRQAEA 299

Query: 284 KLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKI 340
           +L  + A IGIAK+  +P  +L GSI        + F   +  WS G    +PI D G+ 
Sbjct: 300 ELIATNAGIGIAKAGYFPKFTLTGSIGSESKILSDLFSAGSGTWSLGLSALMPILDFGRT 359

Query: 341 KSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLS 400
            + + +A++  Q+  I WQ ++  A KEV +AL S+ ED +  T     V+  +K++ +S
Sbjct: 360 SARVDQAKALNQQSLIAWQNSLQTAYKEVRDALVSLREDGEAETAQNIRVDSARKALDVS 419

Query: 401 MINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            + Y  G    L++LD +R        +   ++    + +DL+ A+G G+
Sbjct: 420 RLRYEAGHAGYLEVLDAQRTHNDAVTTMITMRQARLGAAIDLFKALGGGW 469


>gi|319796323|ref|YP_004157963.1| rnd efflux system, outer membrane lipoprotein, nodt family
           [Variovorax paradoxus EPS]
 gi|315598786|gb|ADU39852.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Variovorax paradoxus EPS]
          Length = 477

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 117/461 (25%), Positives = 212/461 (45%), Gaps = 22/461 (4%)

Query: 8   FSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLIN-IDTLKWWESFNDTSLNKLVK 66
           F L  ++LAGC VGP YT P     P   S        N      WW   +D  L+ LV+
Sbjct: 11  FVLSALVLAGCAVGPTYTAPS--DAPVAISAPERSLFANDAVQRDWWRQLDDPQLDALVE 68

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF------------IPNLKT 114
            AL  N  I  A  R+  A+ +      D  P      S                  L  
Sbjct: 69  RALAANHDIRIAEARLLEARASQTEAELDRLPVVTVGASKTRGIAQGNSGAQPDARALAQ 128

Query: 115 NSTGQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
           +S    D+ W+IDLFG+ + +  ++ A  +++ A ++  ++  +++L  +Y + R  ++R
Sbjct: 129 SSRAGFDASWEIDLFGRLKRLNEAATARTEASAADLEQVRIVAVAELARNYYEMRGAEQR 188

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
           +++  + L+  + ++ ++  +   G   +  L   +A + + ES +PT E + R   + +
Sbjct: 189 LAVTRRTLESLRSSLLVTEAQVQTGRGLEGDLASAQANLATTESQLPTFETTRRQAAYRV 248

Query: 234 STLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIG 293
           + L G    E    ++ Q       L   + IG   DL+R RPD+   E+ LA S A +G
Sbjct: 249 AVLAGLRPAELDPMLRPQQLRV---LDKRLPIGDVGDLLRRRPDVLRAERGLAASTADVG 305

Query: 294 IAKSDLYPSLSLNGSIAL---THDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESS 350
              ++LYP   + G +        +     +  +S  P +  P F  G +K+ +R AE+ 
Sbjct: 306 ATTAELYPRFDIGGFLGFIALRGSDLGSSSSRAFSVTPGVSWPAFRLGSVKARVRGAEAR 365

Query: 351 AQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYS 410
           A+     +++TVL AI++VE+ALT   ++++ +  L  A     ++  L+ + YR+G   
Sbjct: 366 AEGDRALYEQTVLRAIEDVESALTGYGQNQQRLQSLVQAAARSGRAAELAEVRYREGAAP 425

Query: 411 LLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            L +LD +R   + +  ++ A+     S V LY A+G G+ 
Sbjct: 426 YLSVLDAQRTLLRAQDAVAEAETASYTSLVALYKALGGGWQ 466


>gi|15800285|ref|NP_286297.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli O157:H7 EDL933]
 gi|15829864|ref|NP_308637.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli O157:H7 str. Sakai]
 gi|168747765|ref|ZP_02772787.1| cation efflux system protein CusC [Escherichia coli O157:H7 str.
           EC4113]
 gi|168754664|ref|ZP_02779671.1| cation efflux system protein CusC [Escherichia coli O157:H7 str.
           EC4401]
 gi|168760287|ref|ZP_02785294.1| cation efflux system protein CusC [Escherichia coli O157:H7 str.
           EC4501]
 gi|168770167|ref|ZP_02795174.1| cation efflux system protein CusC [Escherichia coli O157:H7 str.
           EC4486]
 gi|168774626|ref|ZP_02799633.1| cation efflux system protein CusC [Escherichia coli O157:H7 str.
           EC4196]
 gi|168779054|ref|ZP_02804061.1| cation efflux system protein CusC [Escherichia coli O157:H7 str.
           EC4076]
 gi|168786411|ref|ZP_02811418.1| cation efflux system protein CusC [Escherichia coli O157:H7 str.
           EC869]
 gi|168798124|ref|ZP_02823131.1| cation efflux system protein CusC [Escherichia coli O157:H7 str.
           EC508]
 gi|195936117|ref|ZP_03081499.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli O157:H7 str. EC4024]
 gi|208808348|ref|ZP_03250685.1| cation efflux system protein CusC [Escherichia coli O157:H7 str.
           EC4206]
 gi|208816145|ref|ZP_03257324.1| cation efflux system protein CusC [Escherichia coli O157:H7 str.
           EC4045]
 gi|208823189|ref|ZP_03263507.1| cation efflux system protein CusC [Escherichia coli O157:H7 str.
           EC4042]
 gi|209399978|ref|YP_002269203.1| cation efflux system protein CusC [Escherichia coli O157:H7 str.
           EC4115]
 gi|217325885|ref|ZP_03441969.1| cation efflux system protein CusC [Escherichia coli O157:H7 str.
           TW14588]
 gi|254791737|ref|YP_003076574.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli O157:H7 str. TW14359]
 gi|261224037|ref|ZP_05938318.1| copper/silver efflux system, outer membrane component [Escherichia
           coli O157:H7 str. FRIK2000]
 gi|261257731|ref|ZP_05950264.1| copper/silver efflux system, outer membrane component [Escherichia
           coli O157:H7 str. FRIK966]
 gi|291281522|ref|YP_003498340.1| Cation efflux system protein cusC precursor [Escherichia coli
           O55:H7 str. CB9615]
 gi|48474563|sp|Q8XBY3|CUSC_ECO57 RecName: Full=Cation efflux system protein CusC; Flags: Precursor
 gi|12513457|gb|AAG54905.1|AE005237_1 putative resistance protein [Escherichia coli O157:H7 str. EDL933]
 gi|13360068|dbj|BAB34033.1| putative resistance protein [Escherichia coli O157:H7 str. Sakai]
 gi|187769775|gb|EDU33619.1| cation efflux system protein CusC [Escherichia coli O157:H7 str.
           EC4196]
 gi|188017641|gb|EDU55763.1| cation efflux system protein CusC [Escherichia coli O157:H7 str.
           EC4113]
 gi|189002823|gb|EDU71809.1| cation efflux system protein CusC [Escherichia coli O157:H7 str.
           EC4076]
 gi|189358105|gb|EDU76524.1| cation efflux system protein CusC [Escherichia coli O157:H7 str.
           EC4401]
 gi|189360850|gb|EDU79269.1| cation efflux system protein CusC [Escherichia coli O157:H7 str.
           EC4486]
 gi|189369081|gb|EDU87497.1| cation efflux system protein CusC [Escherichia coli O157:H7 str.
           EC4501]
 gi|189373634|gb|EDU92050.1| cation efflux system protein CusC [Escherichia coli O157:H7 str.
           EC869]
 gi|189379308|gb|EDU97724.1| cation efflux system protein CusC [Escherichia coli O157:H7 str.
           EC508]
 gi|208728149|gb|EDZ77750.1| cation efflux system protein CusC [Escherichia coli O157:H7 str.
           EC4206]
 gi|208732793|gb|EDZ81481.1| cation efflux system protein CusC [Escherichia coli O157:H7 str.
           EC4045]
 gi|208737382|gb|EDZ85066.1| cation efflux system protein CusC [Escherichia coli O157:H7 str.
           EC4042]
 gi|209161378|gb|ACI38811.1| cation efflux system protein CusC [Escherichia coli O157:H7 str.
           EC4115]
 gi|209777728|gb|ACI87176.1| putative resistance protein [Escherichia coli]
 gi|209777730|gb|ACI87177.1| putative resistance protein [Escherichia coli]
 gi|209777732|gb|ACI87178.1| putative resistance protein [Escherichia coli]
 gi|209777734|gb|ACI87179.1| putative resistance protein [Escherichia coli]
 gi|209777736|gb|ACI87180.1| putative resistance protein [Escherichia coli]
 gi|217322106|gb|EEC30530.1| cation efflux system protein CusC [Escherichia coli O157:H7 str.
           TW14588]
 gi|254591137|gb|ACT70498.1| copper/silver efflux system, outer membrane component [Escherichia
           coli O157:H7 str. TW14359]
 gi|290761395|gb|ADD55356.1| Cation efflux system protein cusC precursor [Escherichia coli
           O55:H7 str. CB9615]
 gi|320192976|gb|EFW67616.1| Cation efflux system protein CusC precursor [Escherichia coli
           O157:H7 str. EC1212]
 gi|320638019|gb|EFX07783.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli O157:H7 str. G5101]
 gi|320643425|gb|EFX12595.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli O157:H- str. 493-89]
 gi|320648760|gb|EFX17387.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli O157:H- str. H 2687]
 gi|320654346|gb|EFX22393.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320660134|gb|EFX27661.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli O55:H7 str. USDA 5905]
 gi|320664823|gb|EFX31958.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli O157:H7 str. LSU-61]
 gi|326341323|gb|EGD65115.1| Cation efflux system protein CusC precursor [Escherichia coli
           O157:H7 str. 1044]
 gi|326345900|gb|EGD69639.1| Cation efflux system protein CusC precursor [Escherichia coli
           O157:H7 str. 1125]
          Length = 460

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 109/464 (23%), Positives = 208/464 (44%), Gaps = 18/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK---NLINIDTLKWWESFN 57
           M+  + +     + L GC++ P+Y +P MP +P QFS+  +       N     W   F 
Sbjct: 1   MSPCKLLPFCVALALTGCSLAPDYQRPAMP-VPQQFSLSQNGLVNAADNYQNAGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS- 116
           D  +  L+  AL+ N  +  AT ++  A+       AD +P      S  +  NLK +S 
Sbjct: 60  DNQVKTLISEALENNRDLRMATLKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGDSA 119

Query: 117 -----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +  
Sbjct: 120 TTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       
Sbjct: 180 YAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +    Q Q+ N      + +  G+ + ++  RPDI   E  L  + A
Sbjct: 240 NALQLLLG----SYGKLPQAQTVNSDSLQSVKLPAGLSSQILLQRPDIMEAEHALMAANA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  A
Sbjct: 296 NIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARALYQHG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             S L++LD ER+       +         + + LY A+G G+ 
Sbjct: 416 AVSYLEVLDAERSLFATRQTVLDLNYARQVNEISLYTALGGGWQ 459


>gi|257093303|ref|YP_003166944.1| NodT family RND efflux system, outer membrane lipoprotein
           [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
 gi|257045827|gb|ACV35015.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
          Length = 478

 Score =  197 bits (499), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 111/466 (23%), Positives = 212/466 (45%), Gaps = 22/466 (4%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLN 62
           I  A      +LLAGC VGP+Y +P   L     ++G           +WW  FND +LN
Sbjct: 11  IRLAAAVTATLLLAGCVVGPDYVRPASTLPEHYPTVGTESRATAPVNPEWWTLFNDATLN 70

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL-- 120
           +LV  AL  N  +  A  R+ A++    +V A L+P+     S          ++G+   
Sbjct: 71  QLVDQALAANQDLQAAVARLEASEAAARAVGAALYPAVGLEASASRNRISGETASGKESG 130

Query: 121 -----------DSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
                         +++DL+G+ +R  E++ A + S+    D  +L +I ++   Y+  R
Sbjct: 131 SLRYNNHRAALTLSYEVDLWGRVQRSNEAARAEVLSSRFGRDSIRLALIGQVANEYLALR 190

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
               ++ +  Q L+  ++++++   +   G+ S L L + E+ +   +     +++   +
Sbjct: 191 SHDAQLEVTRQTLESRRESLKIVQARLEAGSASGLELAQAESALSGAQGQWSQVKRLRAL 250

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
             + +  L G P         +Q       L      G+P+ L+  RPD+R  E+ L  +
Sbjct: 251 AENQLGLLTGQPGLRIAAASLEQIP-----LPPTPPAGLPSSLLAARPDVRQAEENLVAA 305

Query: 289 VAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
            A+IG+AK+  +PS+ L G          + F G    WS    L +PIF+ GK  + + 
Sbjct: 306 NARIGVAKAAYFPSIGLTGLYGGESVALADLFSGSAGIWSAAIGLAMPIFNAGKTGAGVD 365

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
           +A +  QE   T+++T+  A +EV +A+ ++ +           V   ++++ L+   Y 
Sbjct: 366 QATAIQQESVATYRKTLQTAFREVSDAIVNLGDYADEEAAFAAQVAASRRALDLAQTRYA 425

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            G  + LD+LD +R     ++    +++    + VDL+ A+G G+ 
Sbjct: 426 SGYAAYLDVLDSQRTLNAAQLLYLASRKNRLSAAVDLFKALGGGWQ 471


>gi|24111909|ref|NP_706419.1| copper/silver efflux system outer membrane protein CusC [Shigella
           flexneri 2a str. 301]
 gi|24050712|gb|AAN42126.1| putative resistance protein [Shigella flexneri 2a str. 301]
          Length = 460

 Score =  197 bits (499), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 111/464 (23%), Positives = 209/464 (45%), Gaps = 18/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK---WWESFN 57
           M+  + +     + L GC++ P+Y +P MP +P QFS+  +  +   D  +   W   F 
Sbjct: 1   MSPCKLLPFCVALALTGCSLAPDYQRPVMP-VPQQFSLSQNGLVNAADNYQNVGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS- 116
           D  +  L+  AL  N  +  AT ++  A+       AD +P      S  +  NLK +S 
Sbjct: 60  DNQVKTLISEALVNNRDLRMATLKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGDSA 119

Query: 117 -----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +  
Sbjct: 120 TTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       
Sbjct: 180 YAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +    Q Q+ N      + +  G+ + ++  RPDI   E  L  S A
Sbjct: 240 NALQLLLG----SYGKLPQAQTVNSGSLQSVKLPAGLSSQILLQRPDIMEAEHALMASNA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  A
Sbjct: 296 NIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKIQNAFKEVADALALRQSLDDQISAQQRYLASLQITLQRARALYQHG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             S L++LD ER+       L         + + LY A+G G+ 
Sbjct: 416 AVSYLEVLDAERSLFATRQTLLDLNYARQVNEIYLYTALGGGWQ 459


>gi|294055909|ref|YP_003549567.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Coraliomargarita akajimensis DSM 45221]
 gi|293615242|gb|ADE55397.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Coraliomargarita akajimensis DSM 45221]
          Length = 484

 Score =  197 bits (499), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 122/467 (26%), Positives = 233/467 (49%), Gaps = 21/467 (4%)

Query: 4   LRAIFSLFIVLLAGCT-VGPEYTKPHMPLLPTQ-FSIGNSKNLINIDTLKWWESFNDTSL 61
           +  +  L +  L GC  VG +Y +P + +       + +      + T +WW  FND  L
Sbjct: 1   MTGVSVLGLFGLTGCKIVGTDYEEPELVMPDAWHQRLADEAEAQTVVTEQWWGQFNDPVL 60

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN---------- 111
             LV  AL  NL +  A ER+  A+E     ++ L+PS  A+       N          
Sbjct: 61  VGLVDSALAANLDLAIAYERVVQAREAKDVSKSGLWPSVDATAGFSRERNSENVGLSPAA 120

Query: 112 ----LKTNSTGQLDSDWKIDLFGQRRH-IESSLANLDSAYAQVDIAKLNVISKLIPSYID 166
                +   +  LD  W++D+FG  +  +ES+ ANL +         + + +++  +YI+
Sbjct: 121 GGGSTRNYYSTGLDVAWELDVFGGVQRAVESADANLMATEESYRDFMVLLAAEVAGTYIE 180

Query: 167 ARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSF 226
            R   ER+ +A   +   +++++L+  +F  G   KL + + +  + + ++ +P L++S 
Sbjct: 181 LRTINERMELAEANIANQEESLKLALDRFDAGLAPKLDVSQAQTNLSNTQAFLPQLKQSR 240

Query: 227 RMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLA 286
              ++ ++TLLG  A +    + +   +  P         IP D++R RPDIR  E+ LA
Sbjct: 241 TAELNRLATLLGLYAADVELLLGEAEGSI-PVPPNAALSTIPVDMVRARPDIRAAERSLA 299

Query: 287 DSVAKIGIAKSDLYPSLSLNGSIA---LTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSN 343
              A+IG+A +DLYP   LNGS         N     +  + +GP +   +F+ G+++S 
Sbjct: 300 AQNARIGVAAADLYPRFFLNGSFNLLATDSSNWIDAGSRSFGWGPGVRWNLFNAGRVRSQ 359

Query: 344 IRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMIN 403
           +   ES+ +  Y +++ +VL A++EVEN+++ I   ++ +  L+   E  ++++SL   N
Sbjct: 360 VAIEESATRAAYYSYENSVLLAVEEVENSMSGIVNGRERLQALEQGTEAAREAVSLVKEN 419

Query: 404 YRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           Y +G     ++LD ER   + E + ++++  +A +YV L+ A+G G+
Sbjct: 420 YSRGLVDFQNVLDSERTLTQTEDNRALSQGSVASAYVGLFKALGGGF 466


>gi|157165073|ref|YP_001466086.1| 30S ribosomal protein S12 [Campylobacter concisus 13826]
 gi|112800533|gb|EAT97877.1| RND efflux system, outer membrane lipoprotein CmeC [Campylobacter
           concisus 13826]
          Length = 460

 Score =  197 bits (499), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 119/465 (25%), Positives = 224/465 (48%), Gaps = 24/465 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           M   +A   +    LAGC+      +P MP + T F+   +    +I  L WW+ F D +
Sbjct: 1   MKN-KAFILITAAFLAGCSF-----RPDMPNVDTNFTSTYTFETSDIRDL-WWKEFKDEN 53

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL 120
           LN LV+ AL++N  +  A   +  AK ++    A L P    ++S+          TGQ 
Sbjct: 54  LNILVESALEKNTNLRIAYLNLEKAKASLGVAEASLLPGVNLNVSYTKAKTSGETYTGQP 113

Query: 121 DS-----------DWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
            +           +++IDL+G+ R  + ++  NL+++    D A+L++ S +  SY    
Sbjct: 114 QTRYRSSSINLGLNYEIDLWGRVRNSVLAANENLNASKFDYDSARLSLSSSVAKSYFALV 173

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
               + ++  + L  Y+  + L   +   G  ++++ ++ +AE++  ++ + ++  S   
Sbjct: 174 SLNMQEAVLKETLKTYEDTLALRKTQLDLGGINEMTYLQSKAEVERAKTSLTSVLNSKSQ 233

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
            + +++ L G    E L      + N        I  GI +D++  R D+      L  +
Sbjct: 234 ALTSLAILTGKSNDEILKGAVASAQNLPS--SPEIKAGISSDVLLRRSDVAKALADLKAT 291

Query: 289 VAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIR 345
            A +G+AK+D +P++SL G +  T     N F G    W+ G  L   IFD G+ K+N+R
Sbjct: 292 NALVGVAKADYFPTISLTGLLGFTSIDFENIFVGNANTWNIGGSLAQKIFDYGRTKNNVR 351

Query: 346 RAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYR 405
            AE++ Q   +T++ TV +A+ EV +AL S    K  + ++++ ++  +K  SL+   Y 
Sbjct: 352 VAETNEQIAAVTYEATVRSALGEVRDALISRQNAKLSLDQVKNLLQSQQKIYSLAKDQYN 411

Query: 406 QGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            G    L++LD +R   + ++    AK     S V++Y A+G G+
Sbjct: 412 AGYIGHLELLDAQRNLLQAKLQDISAKLDEVDSAVEVYRALGGGF 456


>gi|312114769|ref|YP_004012365.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311219898|gb|ADP71266.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 512

 Score =  197 bits (499), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 136/460 (29%), Positives = 227/460 (49%), Gaps = 20/460 (4%)

Query: 7   IFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVK 66
              L +  L  C VGP+Y     PL P+ +   N+ +       +WW  FND  L+ L++
Sbjct: 33  AVLLLVSTLGACAVGPDYQF-SAPLTPSHW--ANASDRKAPRLSRWWTRFNDRILDALME 89

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI-----------PNLKTN 115
            A+  NL +  A  +I  A+         LFP+   S S               P + + 
Sbjct: 90  EAVAGNLDVATAKAKIREARATYRQTFGSLFPTLTNSESATRSQTSVASSGTSSPAVGSL 149

Query: 116 STGQLDSDWKIDLFGQRRHIESSLAN-LDSAYAQVDIAKLNVISKLIPSYIDARHFKERI 174
                D+ W++DLFG  R    + A  +D+A   +    L ++  +   Y+ AR ++ RI
Sbjct: 150 YQAGFDASWELDLFGANRRAVEAAAYGVDAAEENLQATLLTLVGDVASYYVQARGYQARI 209

Query: 175 SIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNIS 234
           ++A +     ++  +++  KF  G+TS + +     +  S  + IPT E S+   VH++S
Sbjct: 210 ALARRTATSQEETAQITRNKFAAGSTSAVDVANATGQAASTRATIPTFETSYAEVVHSLS 269

Query: 235 TLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGI 294
            LLG P       +        P L +P   GIPAD++ NRPD+R  E++ A   AK+G 
Sbjct: 270 ILLGKPPAALNERLAVVRPIPAPRLTVP--AGIPADVLLNRPDVRLAERQYAQYTAKVGQ 327

Query: 295 AKSDLYPSLSLNGSIALTHDNSFPGYN---THWSFGPKLYLPIFDKGKIKSNIRRAESSA 351
           A++  YPS SL GSI+ +   +          WSFGP L +PIF+ G++++ +  AE+  
Sbjct: 328 AEAARYPSASLTGSISTSAAKTGDLGKSSSIGWSFGPTLTVPIFNAGQLEAAVAVAEAQR 387

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
            + +I ++  VLNA+ +VENAL S+ ++K+    L  +   ++++ SLS   Y+ G    
Sbjct: 388 DQYFIAYKSAVLNALGDVENALVSLAKEKRRTQSLDLSASSYRQASSLSRSLYQSGAAGF 447

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           LD+L  ER+    E  L  ++  +A  Y+ L  A+G G+N
Sbjct: 448 LDVLTAERSAFSAEDALIQSRVLIATDYIALNKALGGGWN 487


>gi|256023815|ref|ZP_05437680.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia sp. 4_1_40B]
 gi|307137185|ref|ZP_07496541.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli H736]
 gi|331641065|ref|ZP_08342200.1| cation efflux system protein CusC [Escherichia coli H736]
 gi|323972195|gb|EGB67407.1| NodT family protein efflux transporter [Escherichia coli TA007]
 gi|331037863|gb|EGI10083.1| cation efflux system protein CusC [Escherichia coli H736]
          Length = 459

 Score =  197 bits (499), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 110/464 (23%), Positives = 206/464 (44%), Gaps = 18/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK---NLINIDTLKWWESFN 57
           M+  + +     + L GC++ P+Y +P MP +P QFS+  +       N     W   F 
Sbjct: 1   MSPCKLLPFCVALALTGCSLAPDYQRPAMP-VPQQFSLSQNGLVNAADNYQNAGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS- 116
           D  +  L+  AL  N  +  AT ++  A+       AD +P      S  +  NLK N+ 
Sbjct: 60  DNQVKTLISEALVNNRDLRMATLKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGNTA 119

Query: 117 -----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +  L++   +D FG+ +   E+   N  +         + ++S +  SY + +  
Sbjct: 120 TTREFSTGLNASLDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       
Sbjct: 180 YAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +    Q Q+ N      + +  G+ + ++  RPDI   E  L  + A
Sbjct: 240 NALQLLLG----SYGKLPQAQTVNSDSLQSVKLPAGLSSQILLQRPDIMEAEHALMAANA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  A
Sbjct: 296 NIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARALYQHG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             S L++LD ER+       L         + + LY A+G G+ 
Sbjct: 416 AVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGWQ 459


>gi|119356607|ref|YP_911251.1| RND efflux system outer membrane lipoprotein [Chlorobium
           phaeobacteroides DSM 266]
 gi|119353956|gb|ABL64827.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Chlorobium phaeobacteroides DSM 266]
          Length = 476

 Score =  197 bits (499), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 100/479 (20%), Positives = 201/479 (41%), Gaps = 31/479 (6%)

Query: 1   MNILRAI-FSLFIVLLAGCTVGPEYTKPHMPLLPTQF----------SIGNSKNLINIDT 49
           MN    +   L    L  C++ P Y +P  P+               +  +S        
Sbjct: 1   MNTKLLLPLCLAATTLTACSLEPAYVRPTAPVTTQWPVASGIGTTTSTAPDSGGQPRTTD 60

Query: 50  LKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI 109
           + W   F    L  L++ +L  N  +  AT  I  A+      R+DL PS  AS S    
Sbjct: 61  IGWRSMFRSPKLQSLIEESLANNRDLRIATLNIEVARNTWRIQRSDLLPSINASGSFTRQ 120

Query: 110 P------------NLKTNSTGQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNV 156
                           T +     + +++DLFG+ R + +       +       A+ ++
Sbjct: 121 ELSKSTSGTGNKEITSTYTANIGTTAYELDLFGRVRSLSNRAINQYLATEEGRKAAQTSL 180

Query: 157 ISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE 216
           I+++  +Y+      E + +    L   +   +L    +  GA S+L + +     +S  
Sbjct: 181 IAEVANAYLTYLADVELLRLTESTLRTRQDAYDLIKRSYDLGAKSRLDVAQSATLAESAR 240

Query: 217 SDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRP 276
           +     ++    + + ++ L+G      L   Q+ ++     +   +  GIP+ ++ +RP
Sbjct: 241 ASRAQYQRQVEQDKNALTLLVGKEIDPKLLEPQRLTDV---QVLDTLPAGIPSVVLLDRP 297

Query: 277 DIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTH----WSFGPKLYL 332
           D+R  E  L    A IG A++  +PS+SL GS      +    + T     WSF P++ L
Sbjct: 298 DVRQAEYALKAENANIGAARALFFPSISLTGSTGFASASLSDLFVTRSSGIWSFAPQITL 357

Query: 333 PIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVEL 392
           PIF  G++++N++ AE++       +++ +  A +EV +AL +     + +   +  V  
Sbjct: 358 PIFQSGRLRANLKLAETNRDIAVAKYEKAIQTAFREVSDALVARATYTEQLHAQRALVTE 417

Query: 393 HKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             ++ +++   Y  G  S   +LD +R+  + + +  +  +Q   + +DLY A+G G+ 
Sbjct: 418 SDQARTITKARYDHGIDSYFALLDAQRSLFEAQQNEILIHQQTLANLIDLYKALGGGWQ 476


>gi|157156221|ref|YP_001461734.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli E24377A]
 gi|193063363|ref|ZP_03044453.1| cation efflux system protein CusC [Escherichia coli E22]
 gi|193069023|ref|ZP_03049981.1| cation efflux system protein CusC [Escherichia coli E110019]
 gi|194428000|ref|ZP_03060545.1| cation efflux system protein CusC [Escherichia coli B171]
 gi|209917827|ref|YP_002291911.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli SE11]
 gi|218553113|ref|YP_002386026.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli IAI1]
 gi|218694012|ref|YP_002401679.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli 55989]
 gi|256020523|ref|ZP_05434388.1| copper/silver efflux system outer membrane protein CusC [Shigella
           sp. D9]
 gi|260842797|ref|YP_003220575.1| copper/silver efflux system protein CusC [Escherichia coli O103:H2
           str. 12009]
 gi|293418683|ref|ZP_06661118.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli B088]
 gi|307315261|ref|ZP_07594838.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Escherichia coli W]
 gi|331666918|ref|ZP_08367792.1| cation efflux system protein CusC [Escherichia coli TA271]
 gi|331676224|ref|ZP_08376936.1| cation efflux system protein CusC [Escherichia coli H591]
 gi|332281704|ref|ZP_08394117.1| copper/silver efflux system outer membrane protein CusC [Shigella
           sp. D9]
 gi|157078251|gb|ABV17959.1| cation efflux system protein CusC [Escherichia coli E24377A]
 gi|192930947|gb|EDV83551.1| cation efflux system protein CusC [Escherichia coli E22]
 gi|192957567|gb|EDV88012.1| cation efflux system protein CusC [Escherichia coli E110019]
 gi|194413975|gb|EDX30252.1| cation efflux system protein CusC [Escherichia coli B171]
 gi|209911086|dbj|BAG76160.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|218350744|emb|CAU96436.1| copper/silver efflux system, outer membrane component [Escherichia
           coli 55989]
 gi|218359881|emb|CAQ97424.1| copper/silver efflux system, outer membrane component [Escherichia
           coli IAI1]
 gi|257757944|dbj|BAI29441.1| copper/silver efflux system protein CusC [Escherichia coli O103:H2
           str. 12009]
 gi|291325211|gb|EFE64626.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli B088]
 gi|306905359|gb|EFN35898.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Escherichia coli W]
 gi|315059825|gb|ADT74152.1| copper/silver efflux system, outer membrane component [Escherichia
           coli W]
 gi|323379608|gb|ADX51876.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Escherichia coli KO11]
 gi|323945143|gb|EGB41204.1| NodT family protein efflux transporter [Escherichia coli H120]
 gi|324116645|gb|EGC10560.1| NodT family protein efflux transporter [Escherichia coli E1167]
 gi|331066142|gb|EGI38026.1| cation efflux system protein CusC [Escherichia coli TA271]
 gi|331076282|gb|EGI47564.1| cation efflux system protein CusC [Escherichia coli H591]
 gi|332104056|gb|EGJ07402.1| copper/silver efflux system outer membrane protein CusC [Shigella
           sp. D9]
          Length = 460

 Score =  197 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 110/464 (23%), Positives = 207/464 (44%), Gaps = 18/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK---NLINIDTLKWWESFN 57
           M+  + +     + L GC++ P+Y +P MP +P QFS+  +       N     W   F 
Sbjct: 1   MSPCKLLPFCVALALTGCSLAPDYQRPAMP-VPQQFSLSQNGLVNAADNYQNAGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS- 116
           D  +  L+  AL  N  +  AT ++  A+       AD +P      S  +  NLK N+ 
Sbjct: 60  DNQVKTLISEALVNNRDLRMATLKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGNTA 119

Query: 117 -----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +  
Sbjct: 120 TTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       
Sbjct: 180 YAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +    Q Q+ N      + +  G+ + ++  RPDI   E  L  + A
Sbjct: 240 NALQLLLG----SYGKLPQAQTVNSDSLQSVKLPAGLSSQILLQRPDIMEAEHALMAANA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  A
Sbjct: 296 NIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARALYQHG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             S L++LD ER+       L         + + LY A+G G+ 
Sbjct: 416 AVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGWQ 459


>gi|330823035|ref|YP_004386338.1| NodT family RND efflux system outer membrane lipoprotein
           [Alicycliphilus denitrificans K601]
 gi|329308407|gb|AEB82822.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Alicycliphilus denitrificans K601]
          Length = 481

 Score =  197 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 106/450 (23%), Positives = 202/450 (44%), Gaps = 12/450 (2%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGN--SKNLINIDTLKWWESFNDTSLNKLVK 66
            +   LLAGC+  P+Y +P  P+       GN           + W + F D  L +L+ 
Sbjct: 18  LVIAALLAGCSFIPKYERPAAPVPEAFALAGNDVPATARAAADIDWKDYFTDPRLQRLIG 77

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP------NLKTNSTGQL 120
           IAL  N  +  A   +  A+      RA  FP+  A  S    P             G  
Sbjct: 78  IALGNNRDLRVAMLNVEQARAQFQIQRAGQFPTVNAIASGTRQPSIVNGQYANQFQAGLG 137

Query: 121 DSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQ 179
            S W+ID FG+   ++    A   +       A++++++ +   ++     +E + I+ +
Sbjct: 138 ISAWEIDFFGRIGALKEQALAQFLATEEARKSAQISLVAAVASGWLTLMADEELLDISRR 197

Query: 180 ILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGY 239
            L+  +++++L+ L+   G +S+L   + E+  ++  +     ++   ++ + ++ LLG 
Sbjct: 198 TLETREESVKLTRLRLEHGVSSELDSHQAESLAQAARATYAQQQRQRLLDENALALLLGQ 257

Query: 240 PATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDL 299
           P  + +             L  P+  G+P+DL++ RPDIR  E+ L  + A IG A++  
Sbjct: 258 PLPDDIRASLPSMRLADAALMQPLPAGLPSDLLQRRPDIRQAEQLLIGANANIGAARAAF 317

Query: 300 YPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYI 356
           +P +SL        D     F   +  +S  P+L LPIFD G+ ++ +  A +  +    
Sbjct: 318 FPRISLTAQFGSVSDELSGLFKSGSWAFSLAPQLALPIFDAGRNQAGLESARAGREIAVA 377

Query: 357 TWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILD 416
            +++++  A +EV +AL      ++ +   +   +   K + LS + YR G  S LD+LD
Sbjct: 378 QYEKSIQTAFREVSDALAGQATLQQQIDAQRAQTQADAKRLDLSDLRYRNGVASYLDLLD 437

Query: 417 IERATAKVEVDLSIAKRQLAKSYVDLYIAI 446
            +R+    E  L   + Q  ++ V LY  +
Sbjct: 438 AQRSLYATEQALVQTRLQQLQNQVTLYKVL 467


>gi|323191208|gb|EFZ76472.1| cation efflux system protein cusC [Escherichia coli RN587/1]
          Length = 460

 Score =  197 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 109/464 (23%), Positives = 206/464 (44%), Gaps = 18/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK---NLINIDTLKWWESFN 57
           M+  + +     + L GC++ P+Y +P MP +P QFS+  +       N     W   F 
Sbjct: 1   MSPCKLLPFCVALALTGCSLAPDYQRPAMP-VPQQFSLSQNGLVNAADNYQNAGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS- 116
           D  +  L+  AL  N  +  A  ++  A+       AD +P      S  +  NLK +S 
Sbjct: 60  DNQVKTLISEALVNNRDLRMAALKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGDSA 119

Query: 117 -----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +  
Sbjct: 120 TTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       
Sbjct: 180 YAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +    Q Q+ N      + +  G+ + ++  RPDI   E  L  + A
Sbjct: 240 NALQLLLG----SYGKLPQAQTVNSDSLQSVKLPAGLSSQILLQRPDIMEAEHALMAANA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  A
Sbjct: 296 NIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKIQNAFKEVADALALRQTLNDQISAQQRYLASLQITLQRARALYQHG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             S L++LD ER+       L         + + LY A+G G+ 
Sbjct: 416 AVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYAALGGGWQ 459


>gi|319761175|ref|YP_004125112.1| rnd efflux system, outer membrane lipoprotein, nodt family
           [Alicycliphilus denitrificans BC]
 gi|317115736|gb|ADU98224.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Alicycliphilus denitrificans BC]
          Length = 481

 Score =  197 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 105/450 (23%), Positives = 201/450 (44%), Gaps = 12/450 (2%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGN--SKNLINIDTLKWWESFNDTSLNKLVK 66
            +   LLAGC+  P+Y +P  P+       GN           + W + F D  L +L+ 
Sbjct: 18  LVIAALLAGCSFIPKYERPAAPVPEAFALAGNDVPATARAAADIDWKDYFTDPRLQRLIG 77

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP------NLKTNSTGQL 120
           IAL  N  +  A   +  A+      RA  FP+  A  S    P             G  
Sbjct: 78  IALGNNRDLRVAMLNVEQARAQFQIQRAGQFPTVNAIASGTRQPSIVNGQYANQFQAGLG 137

Query: 121 DSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQ 179
            S W+ID FG+   ++    A   +       A++++++ +   ++     +E + I+ +
Sbjct: 138 ISAWEIDFFGRIGALKEQALAQFLATEEARKSAQISLVAAVASGWLTLMADEELLDISRR 197

Query: 180 ILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGY 239
            L+  +++++L+ L+   G +S+L   + E+  ++  +     ++   ++ + ++ LLG 
Sbjct: 198 TLETREESVKLTRLRLEHGVSSELDSHQAESLAQAARATYAQQQRQRLLDENALALLLGQ 257

Query: 240 PATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDL 299
           P  + +                P+  G+P+DL++ RPDIR  E+ L  + A IG A++  
Sbjct: 258 PLPDDIRASLPSMRLADAAPMQPLPAGLPSDLLQRRPDIRQAEQLLIGANANIGAARAAF 317

Query: 300 YPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYI 356
           +P +SL        D     F   +  +S  P+L LPIFD G+ ++ +  A +  +    
Sbjct: 318 FPRISLTAQFGSVSDELSGLFKSGSWAFSLAPQLALPIFDAGRNQAGLESARAGREIAVA 377

Query: 357 TWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILD 416
            +++++  A +EV +AL      ++ +   +   +   K + LS + YR G  S LD+LD
Sbjct: 378 QYEKSIQTAFREVSDALAGQATLQQQIDAQRAQTQADAKRLDLSDLRYRNGVASYLDLLD 437

Query: 417 IERATAKVEVDLSIAKRQLAKSYVDLYIAI 446
            +R+    E  L   + Q  ++ V LY  +
Sbjct: 438 AQRSLYATEQALVQTRLQQLQNQVTLYKVL 467


>gi|188990877|ref|YP_001902887.1| outer membrane protein of an RND superfamily export system
           [Xanthomonas campestris pv. campestris str. B100]
 gi|167732637|emb|CAP50831.1| outer membrane protein of an RND superfamily export system
           [Xanthomonas campestris pv. campestris]
          Length = 497

 Score =  197 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 107/479 (22%), Positives = 205/479 (42%), Gaps = 29/479 (6%)

Query: 1   MNILRAIFSLFIV--LLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLIN----------ID 48
           M  +R   +   V  +L+GCT+ P Y +P  P+         +  + +          I 
Sbjct: 1   MTPIRMTLAALAVTSVLSGCTLMPRYARPDAPVPAQFAGATAAATVASEAAASAETPVIA 60

Query: 49  TLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS--- 105
            + W E F D +L +++++AL  N  +  A   I  A+      RA L P   A+ +   
Sbjct: 61  DIGWREVFTDPALQQVIQLALDNNRDLRVAALNIEVARAQYRVERAALVPGVDATGTANN 120

Query: 106 ---------HRFIPNLKTNSTGQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLN 155
                        P  +T S     S +++DLFG+ R ++        S         ++
Sbjct: 121 ARTPSELAVPGQPPVFRTYSANVGVSAYELDLFGRVRSLKEQALQQFLSTAEARRSTHIS 180

Query: 156 VISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSI 215
           +++ +  +Y+     +E + +A   L     +  L    F  G  S+L+L + +  ++S 
Sbjct: 181 LVADVASAYLTLAADQELLQLAQSTLTSQSDSYRLQQRSFELGVASQLTLRQAQTTVESA 240

Query: 216 ESDIPTLEKSFRMNVHNISTLLG-YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRN 274
             D+         + + +  L+G       L        + + N+   +  G+P+ L++ 
Sbjct: 241 RVDVERYTAQVAQDRNALVLLVGTQLPESLLPRALPDGASVEGNVLAAVPAGVPSQLLQR 300

Query: 275 RPDIRYQEKKLADSVAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLY 331
           RPDI   E+ L  + A IG A++  +PS+SL    GS + +    F      WSF P+L 
Sbjct: 301 RPDILEAERNLRAANANIGAARAAFFPSISLTATLGSSSSSLSGLFESGTRAWSFVPQLT 360

Query: 332 LPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVE 391
           LP+F+ G+ ++N+  A+++   +   +++++  A +EV +AL   +   + +   Q  V+
Sbjct: 361 LPLFNAGRNRANLDMAKANRDIEVARYEKSIQTAFREVSDALAQRDTLGRQLQAQQALVD 420

Query: 392 LHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
               S  LS   + +G  S L  LD +R+    +  L   +     + V  Y A+G G+
Sbjct: 421 ATADSYRLSQARFERGIDSYLQALDAQRSLYGAQQTLITTQLSRITNLVTFYKAMGGGW 479


>gi|325925600|ref|ZP_08186985.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [Xanthomonas perforans 91-118]
 gi|325544000|gb|EGD15398.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [Xanthomonas perforans 91-118]
          Length = 501

 Score =  197 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 105/483 (21%), Positives = 206/483 (42%), Gaps = 34/483 (7%)

Query: 1   MNILRAIFSLF--IVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTL-------- 50
           M  +R          +L+GCT+ P YT+P  P +P QF+  +        T         
Sbjct: 1   MTTIRTTLCALGVASVLSGCTLMPRYTRPDAP-VPAQFAGTDVSAAPPAATADSGSAADA 59

Query: 51  ------KWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASI 104
                  W + F D +L +++ +AL  N  +  A   I  A+      RA L P+   + 
Sbjct: 60  AYIADIGWRQVFTDPALQQVIALALDNNRDLRVAALNIEVARAQYRVDRAALLPAIEGTG 119

Query: 105 SHRFIPNLK------------TNSTGQLDSDWKIDLFGQRRHIESSLANLDSAYAQ-VDI 151
           +                    T S     S +++DLFG+ R ++          A+    
Sbjct: 120 TANNARTPSELAIPGQPQVFRTYSANIGVSAYELDLFGRVRSLKEQALQQFLFTAEARRS 179

Query: 152 AKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAE 211
             +++++++  +Y+     ++ + +A   L    ++  L    F  GA S+L+L + +  
Sbjct: 180 THISLVAEVATAYLTLAADQQLLQLAQSTLASQSESYRLQQRSFELGAASQLTLRQAQTT 239

Query: 212 IKSIESDIPTLEKSFRMNVHNISTLLGYP-ATEFLHYMQKQSNNFQPNLYIPINIGIPAD 270
           +++   D+         + + +  L+G     E L +    + + + N+   +  G+P+ 
Sbjct: 240 VETARVDVERYTAQVAQDRNALVLLVGTQVPVELLPHALPDNASVEGNVLASVPAGLPSQ 299

Query: 271 LIRNRPDIRYQEKKLADSVAKIGIAKSDLYP---SLSLNGSIALTHDNSFPGYNTHWSFG 327
           L++ RPDI   E+ L  + A IG A++  +P     +  GS + +    F      WSF 
Sbjct: 300 LLQRRPDILEAERNLRAANANIGAARAAFFPSISLTASTGSSSSSLSRLFDAGTRAWSFV 359

Query: 328 PKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQ 387
           P L LPIF+ G+ ++N+  A+++   +   +++++ +A +EV +AL   +   + +   Q
Sbjct: 360 PTLTLPIFNAGRNRANLDMAKANRDIEVARYEKSIQSAFREVSDALAQRDTLGRQLQAQQ 419

Query: 388 HAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIG 447
             V+    S  LS   + +G  S L  LD +R+    +  L   +     + V  Y A+G
Sbjct: 420 ALVDATADSYRLSQARFERGIDSYLQALDAQRSLYSAQQTLINTQLSRFTNLVTFYKAMG 479

Query: 448 SGY 450
            G+
Sbjct: 480 GGW 482


>gi|212633911|ref|YP_002310436.1| RND efflux system, outer membrane lipoprotein, NodT [Shewanella
           piezotolerans WP3]
 gi|212555395|gb|ACJ27849.1| RND efflux system, outer membrane lipoprotein, NodT [Shewanella
           piezotolerans WP3]
          Length = 501

 Score =  197 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 118/451 (26%), Positives = 205/451 (45%), Gaps = 13/451 (2%)

Query: 12  IVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIALQQ 71
           ++ +AGC +GP+Y +P + +             +N     W E + D  L  L++ AL Q
Sbjct: 37  VLFIAGCAMGPDYQRPDIDIPEQYLEELQQTEGLNAGLKHWREFYLDPELQLLIEHALDQ 96

Query: 72  NLTILQATERINAAKENILSVRADLFPSSYASISHRFI---------PNLKTNSTGQLDS 122
           NL +     R+ AA+ N+    ADLFP    + S             P  +         
Sbjct: 97  NLDLEGVRSRLLAARANVTVTDADLFPVVGLNASGERALDSALTSTDPVKEDTFYVAGTV 156

Query: 123 DWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQIL 181
            W++DL+G  R    +  AN  S+   +++A +++IS +   Y +    ++R  I+    
Sbjct: 157 SWELDLWGANRRRSEAEFANFISSQEALNLATISLISDVASRYYEWLDIEQRYQISLNTA 216

Query: 182 DLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYPA 241
            L KK  +L+ L+   G  S L + + E E +S +  +P L+       + +  LLG   
Sbjct: 217 QLRKKERDLARLRKQNGVISGLQVRQAEVEYQSAKVTLPDLDYERSEKANQLRILLGEFK 276

Query: 242 TEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLYP 301
                  + Q     P       +GIP+ ++  RPD++  E+ L  + A +G+AK+  +P
Sbjct: 277 YPLTPKTEAQLKAEGPLFPDSFAVGIPSQMLSQRPDVKTAEQALVAANANVGVAKTAFFP 336

Query: 302 SLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITW 358
             +++GS     +   + F      WS    +  PIF+ GKI +    A+  A++  +++
Sbjct: 337 KFTISGSYGSESESLSDIFDSEGVTWSLLAGITAPIFNSGKISAQYDVAKEEAKQAMLSY 396

Query: 359 QETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIE 418
           + TVL A  EV +A+ S    +  +   Q  VE   +   L+M+ YR G  S LD++D +
Sbjct: 397 RSTVLAAYFEVNDAMNSFRRSELAIEAQQELVEASTEYTRLAMLRYRNGVSSSLDLMDAQ 456

Query: 419 RATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           R     ++ LS  KR    S + LY A+G G
Sbjct: 457 RNLFSAQLTLSQVKRDRLLSMITLYRALGGG 487


>gi|187478149|ref|YP_786173.1| multidrug efflux system outer membrane protein [Bordetella avium
           197N]
 gi|115422735|emb|CAJ49263.1| multidrug efflux system outer membrane protein [Bordetella avium
           197N]
          Length = 487

 Score =  197 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 105/473 (22%), Positives = 209/473 (44%), Gaps = 24/473 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLL------PTQFSIGNSKNLINIDTLKWWE 54
           M  L  + +L    LAGC++ P+Y +P  P+       P   +       +    + W +
Sbjct: 5   MKTLLTLTALASA-LAGCSLAPKYERPDAPVSASYPTGPAYAATQAGAGELAAADVGWRD 63

Query: 55  SFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNL-- 112
            F D+ L  ++ + L+ N  +  A   + AA+      RADL P+  A+ +         
Sbjct: 64  FFQDSLLQWILTLTLENNRDLRVAALNVEAARAQYRIERADLLPTVGAAGTANVQRTPAS 123

Query: 113 ----------KTNSTGQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLI 161
                     +    G   S W++DLFG+ + +         +        +L +I++  
Sbjct: 124 LTQNGSLQISRQYRVGAAVSSWELDLFGRIQSLTEQALQTYLAQDETRQATQLTLIAETA 183

Query: 162 PSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPT 221
            +Y+     +E + +  Q L   + + +L+   F QG  ++L L + E  +++ E +   
Sbjct: 184 NAYLILCADQELLQLTEQTLASQRASYDLTKQSFDQGVATELDLSQAEVSLRTAERNRAQ 243

Query: 222 LEKSFRMNVHNISTLLGYP-ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRY 280
             +    + + ++ L+G P   + +  +          +   +  G+PADL+  RPDIR 
Sbjct: 244 YLRQVARDRNALTLLVGQPLPADLITQLDAIKQLPDDVVIANLPAGLPADLLARRPDIRA 303

Query: 281 QEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDK 337
            E +L  + A IG A++  +P++SL GS  +   +    F   +  WSF P++ +PIF  
Sbjct: 304 AEHQLQGANANIGAARAAFFPTISLTGSAGVASGSLGSLFDAGSGAWSFAPQITMPIFAG 363

Query: 338 GKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSM 397
           G + +N+  A+   +     +++ +    +EV + L       + +   +  VE ++++ 
Sbjct: 364 GALLANLDLAQVRKRIGIANYEKAIQIGFREVADGLAGRATLDQQILAQRQLVEANQRAY 423

Query: 398 SLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +LS   +RQG  S L +LD +R+    +  L   +     + +DLY A+G G+
Sbjct: 424 TLSDQRFRQGVDSYLSVLDSQRSLYSSQQALVDTRLARLANLIDLYKALGGGW 476


>gi|293408695|ref|ZP_06652534.1| conserved hypothetical protein [Escherichia coli B354]
 gi|291471873|gb|EFF14356.1| conserved hypothetical protein [Escherichia coli B354]
          Length = 460

 Score =  197 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 107/463 (23%), Positives = 202/463 (43%), Gaps = 16/463 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQF--SIGNSKNLINIDTLKWWESFND 58
           M+  + +     + L GC++ P+Y +P MP+         G      N     W   F D
Sbjct: 1   MSPCKLLPFCVALALTGCSLAPDYQRPAMPVPQQFSLNQNGLVNAADNYQNAGWRTFFVD 60

Query: 59  TSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS-- 116
             +  L+  AL  N  +  AT ++  A+       AD +P      S  +  NLK +S  
Sbjct: 61  NQVKTLISEALVNNRDLRMATLKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGDSAT 120

Query: 117 ----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
               +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +   
Sbjct: 121 TREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLAY 180

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
            ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       +
Sbjct: 181 AQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQANN 240

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
            +  LLG     +    Q Q+ N      + +  G+ + ++  RPDI   E  L  + A 
Sbjct: 241 ALQLLLG----SYGKLPQAQTVNSDSLQSVKLPAGLSSQILLQRPDIMEAEHALMAANAN 296

Query: 292 IGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
           IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  AE
Sbjct: 297 IGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIAE 356

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
              Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G 
Sbjct: 357 IRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARALYQHGA 416

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            S L++LD ER+       L         + + LY A+G G+ 
Sbjct: 417 VSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGWQ 459


>gi|320194243|gb|EFW68875.1| Cation efflux system protein CusC precursor [Escherichia coli
           WV_060327]
          Length = 460

 Score =  197 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 109/464 (23%), Positives = 206/464 (44%), Gaps = 18/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK---NLINIDTLKWWESFN 57
           M+  + +     + L GC++ P+Y +P MP +P QFS+  +       N     W   F 
Sbjct: 1   MSPCKLLPFCVALALTGCSLAPDYQRPAMP-VPQQFSLSQNGLVNAADNYQNAGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS- 116
           D  +  L+  AL  N  +  A  ++  A+       AD +P      S  +  NLK +S 
Sbjct: 60  DNQVKTLISEALVNNRDLRMAALKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGDSA 119

Query: 117 -----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +  
Sbjct: 120 TTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       
Sbjct: 180 YAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +    Q Q+ N      + +  G+ + ++  RPDI   E  L  + A
Sbjct: 240 NALQLLLG----SYGKLPQAQTVNSDSLQSVKLPAGLSSQILLQRPDIMEAEHALMAANA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL   I+    +    F   +  W+F PK+ +P+F+ G+ ++N+  A
Sbjct: 296 NIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPVFNAGRNQANLDIA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ V NA KEV +AL         ++  Q  +   + ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKVQNAFKEVADALALRQTLNAQISAQQRYLASLQITLQRARALYQHG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             S L++LD ER+       L         + + LY A+G G+ 
Sbjct: 416 AVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGWQ 459


>gi|90423378|ref|YP_531748.1| RND efflux system, outer membrane lipoprotein, NodT
           [Rhodopseudomonas palustris BisB18]
 gi|90105392|gb|ABD87429.1| RND efflux system, outer membrane lipoprotein, NodT
           [Rhodopseudomonas palustris BisB18]
          Length = 509

 Score =  196 bits (498), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 129/464 (27%), Positives = 232/464 (50%), Gaps = 20/464 (4%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLIN-IDTLKWWESFNDTSLNKL 64
           A   +   +LAGC VGP+Y  P + L     +    +      D  +WW   ND  L++L
Sbjct: 25  ATLVVAATMLAGCAVGPDYGPPGIELPTAWANAKPPRTAPPVADLRQWWRRLNDPLLSRL 84

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST------- 117
           ++ A++ NL++  A  RI  A+         LFP    + S        +++T       
Sbjct: 85  IEEAVESNLSVASAKARIREARATRRQAIGALFPLLNGTGSATRNQVSASSTTSGQALTS 144

Query: 118 ------GQLDSDWKID-LFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                    D+ W++D     RR +E++   +D+A   +    L ++  +   Y +AR +
Sbjct: 145 TYNQFQAGFDASWELDIFGANRRGVEATSYGVDAAEDDLRATLLTLVGDVAAYYAEARGY 204

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           + RI++A +     ++   L+  KF  G++S + + K  A+  + E++IPT +  +   V
Sbjct: 205 QARIALARRTAASQRETAALTQRKFDAGSSSAVDVAKASAQAATTEANIPTYQVGYSEAV 264

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           H +  LLG   T     + + +    P L +P   GIPAD++  RPD+R  E++LA   A
Sbjct: 265 HRLGVLLGREPTALEQQLARGTAIPSPRLPLPK--GIPADVLVMRPDVRKAERQLAQYTA 322

Query: 291 KIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
           KIG A++ LYPS+SL GS++ +     +        WS GP L +PIF+ G++++ +  +
Sbjct: 323 KIGQAEAALYPSVSLTGSVSTSALKIGDLAKNSTIGWSVGPTLSVPIFNGGQLRAAVEIS 382

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E+   + Y+ W+  VL A+++VENA+ ++ +++  +  L  A   ++ +  LS   Y  G
Sbjct: 383 EAQRDQYYVAWRSAVLTALEDVENAIVALAQEQLRIRSLAEASRRYRDAARLSRSLYETG 442

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             S LD+LD ER+    E  L  ++  +A S++ L   +G G++
Sbjct: 443 SSSFLDVLDAERSLYTAEDSLLQSRVTVATSFIALAKGLGGGWD 486


>gi|260600072|ref|YP_003212810.1| copper/silver efflux system outer membrane protein CusC
           [Cronobacter turicensis z3032]
 gi|260219419|emb|CBA34771.1| Probable outer membrane lipoprotein silC [Cronobacter turicensis
           z3032]
          Length = 498

 Score =  196 bits (498), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 96/464 (20%), Positives = 209/464 (45%), Gaps = 19/464 (4%)

Query: 1   MNILRAIFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGNSKNLINI---DTLKWWESF 56
           M  L+ +    I +LAGC ++ PEY +P  P +P QFS+ ++     +       W   F
Sbjct: 38  MFKLKLLSISTIFILAGCVSLAPEYQRPAAP-VPQQFSLSHNSLTPAVNGYQDTGWRNFF 96

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP------ 110
            D  + +L+  AL  N  +  A  ++  A+       AD +P   AS    +        
Sbjct: 97  VDPQVTRLIGEALTNNRDLRMAALKVEEARAQFNVTDADRYPQLNASSGITYSGGLKGDK 156

Query: 111 NLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                   +L+  +++D FG+ +   ++   N  ++        + ++S +  SY   + 
Sbjct: 157 PTTQEYDARLELSYELDFFGKLKNMSDADRQNYFASEEARRAVHILLVSNVSQSYFSQQL 216

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
             E++ IA + L  Y+++      +   G+T+ L+L +   +I+S  ++I   E      
Sbjct: 217 AYEQLRIARETLKNYEQSYAFVEQQLVTGSTNVLALEQARGQIESTRAEIAKREGDLAQA 276

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            + +  +LG     +     ++         + +   + + ++  RPDI   E +L  + 
Sbjct: 277 NNALQLVLG----TYRALPSEKGMKGGEIAPVKLPPNLSSQILLQRPDIMEAEYQLKAAD 332

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           A IG A++  +PS++L   ++ +     + F   +  W+F PK+ +PIF+ G+ K+N++ 
Sbjct: 333 ANIGAARAAFFPSITLTSGLSASSTELSSLFTSGSGMWNFIPKIEIPIFNAGRNKANLKL 392

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
           AE   Q+  + +++ + +A K+V + L   +   + +   Q  ++  + ++  +   Y  
Sbjct: 393 AEIRQQQSVVNYEQKIQSAFKDVSDTLALRDSLSQQLESQQRYLDSLQITLQRARGLYAS 452

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           G  S +++LD ER+    +  +         + ++L+ A+G G+
Sbjct: 453 GAVSYIEVLDAERSLFATQQTILDLTYSRQVNEINLFTALGGGW 496


>gi|225159130|ref|ZP_03725436.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Opitutaceae bacterium TAV2]
 gi|224802285|gb|EEG20551.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Opitutaceae bacterium TAV2]
          Length = 506

 Score =  196 bits (498), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 106/469 (22%), Positives = 209/469 (44%), Gaps = 38/469 (8%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSI------------------GNSKNLINIDTLKWWESFND 58
           GC VGP+Y  P +   P   +                          +     WW+ + D
Sbjct: 40  GCAVGPDYQPPVIKSPPAFRTADDSTDGSTLTGTGQPELTAPPAKPADFGAAPWWDVYTD 99

Query: 59  TSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN------- 111
            +L  L++ AL  N  I  A  R+  A++ + + R+  +PS   S +     N       
Sbjct: 100 PALASLIQEALASNYDIAIAATRVEQARQAVATARSGYYPSVNYSGAASRGRNQFSGNPS 159

Query: 112 -----LKTNSTGQLDSDWKIDLFGQRRHIE-SSLANLDSAYAQVDIAKLNVISKLIPSYI 165
                   ++T  + + W++DL+G+ R ++ S+ A   +     +     +I+ +  ++ 
Sbjct: 160 PTLGTTGDDATVVVGASWELDLWGRVRRMDESARARYLATEEARNAVITTLIADVAQAWF 219

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
           +       ++IA    D ++++  L + +   G  S +   + EA +    + IP +E+S
Sbjct: 220 ELIELDAELTIAKDTRDSFQRSYTLFNERLKGGIASTIETARAEAAVAQTAAAIPEIERS 279

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
             +  + I+ LLG         + +Q+         P+  G+PADL+  RPD+R  E+ L
Sbjct: 280 IILKENQINLLLGRAPG----PITRQATLDTLVAPTPLPAGLPADLLARRPDLRRSEQLL 335

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHDNSFPGYNTH---WSFGPKLYLPIFDKGKIKS 342
             + A IG+A +D YP +SL G++     +     +     WS    L  PIF  G+IK+
Sbjct: 336 RSANADIGVAIADYYPRISLTGALGRISPDLSDFTHGTGNLWSILGGLTGPIFQGGRIKA 395

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
           ++  A +   +  +  +++VLNA+ EV  AL S  +      + +      ++++ +S+ 
Sbjct: 396 SVAAARARWDQARLEHEQSVLNALNEVSEALVSREKIVTTRAEQERRAAALQQAVKISLD 455

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            Y  GR S  ++L+ ++     + D++ A+R    + V LY ++G G++
Sbjct: 456 RYDAGRASYYEVLEAQQQLFPAQTDVARARRDQHLALVRLYRSLGGGWS 504


>gi|91787913|ref|YP_548865.1| RND efflux system outer membrane lipoprotein NodT [Polaromonas sp.
           JS666]
 gi|91697138|gb|ABE43967.1| RND efflux system, outer membrane lipoprotein, NodT [Polaromonas
           sp. JS666]
          Length = 489

 Score =  196 bits (498), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 106/461 (22%), Positives = 202/461 (43%), Gaps = 27/461 (5%)

Query: 17  GCTVGPEYTKPHMPLLPTQFSIGNSKNLINID----------------TLKWWESFNDTS 60
           GC++ P+Y +P  P+     +                            ++W   F+D  
Sbjct: 20  GCSMIPKYERPAAPIAAEWPASSWMAESAQATAGASPAAATAPAVPAADIEWQSFFSDPK 79

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN------LKT 114
           L  L++ AL+ N  +  A   I  A+      RAD FP+  A ++    PN        T
Sbjct: 80  LRLLIEAALRNNRDLRIAVLNIEQARAQFQIRRADQFPTVNAGLTGSRQPNADGNSITST 139

Query: 115 NSTGQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYIDARHFKER 173
            S G L + +++D FG+   ++ +  A   +        ++++I+ +  +Y+     +E 
Sbjct: 140 YSAGLLVTSYELDFFGRVASLKETALAQYLATEEGRKTTQISLIAAVANTYLSLLADEEL 199

Query: 174 ISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNI 233
           ++I  Q L   +++ +LS L+F  G TS+L   + E+  ++    +  L +   ++ + +
Sbjct: 200 LAITQQTLATREESFKLSKLRFDNGVTSELDFRQAESLTEAARVSLAQLVRQRALDQNAL 259

Query: 234 STLLGYPA-TEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           + LLG P   E    +          + + +  G+P+DL+  RPDIR  E++L  + A I
Sbjct: 260 TLLLGQPLTGELAVALPAGKGLADTPMMVDVPAGLPSDLLTRRPDIRQAEQQLLAANADI 319

Query: 293 GIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +P +SL  S      +    F   +  W+  P+L LPIFD G+ ++ +  A +
Sbjct: 320 GAARAAFFPRISLTASAGSASSHLSGLFKSGSYGWTLAPQLLLPIFDAGRNRAGLDSANA 379

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
                   +++++  A +EV +AL       + +   Q           LS + Y+ G  
Sbjct: 380 GRDIAVAQYEKSIQTAFREVSDALAGRATLGEQLRAQQAQANAEATRFKLSDLRYQNGIA 439

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           S LD+LD +R+       +   +    +S V LY  +G G+
Sbjct: 440 SYLDLLDAQRSLFTARQAVVQTRLAQLQSQVTLYKTLGGGW 480


>gi|256829692|ref|YP_003158420.1| NodT family RND efflux system outer membrane lipoprotein
           [Desulfomicrobium baculatum DSM 4028]
 gi|256578868|gb|ACU90004.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfomicrobium baculatum DSM 4028]
          Length = 531

 Score =  196 bits (498), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 117/477 (24%), Positives = 225/477 (47%), Gaps = 34/477 (7%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK-NLINIDTLKWWESFNDTSLNKL 64
           AIFSL + ++AGC VGP+Y +P  P +       ++       +   WW+  ND  L++L
Sbjct: 16  AIFSLALAVIAGCAVGPDYVRPQAPQMQEWLEKDDAGLKHGPAELAAWWKRLNDPVLDRL 75

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDS-- 122
           V +A ++N ++  A  RI  ++  +     + FP             L  ++     +  
Sbjct: 76  VALAAERNPSLHVAALRILESRARLGIATGNQFPQLQQLQGSVSDTGLSRHNANTTPAID 135

Query: 123 ------------DWKIDLFGQRRHIESSLAN-LDSAYAQVDIAKLNVISKLIPSYIDARH 169
                        W++D +G+ R    S A  +D+A A  D   + + +++   Y+  R 
Sbjct: 136 RYYATASVALDAAWELDFWGRFRRAVESGAWSVDAAMAGYDDLLVTLTAEVARVYVTLRT 195

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
            ++R+ IAH+ + L +++++++ +    G  ++L + +  A +   ++ IP LE   R +
Sbjct: 196 LEQRLFIAHENVALQERSLQIARVLHQGGDVTELDVTQAAALLAGTQASIPRLEAQLRQS 255

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            + +S LLG    E    +        P +   + +G+PA+L+R RPDIR  E ++A   
Sbjct: 256 KNGLSALLGMLPGEADRILG--GPGPVPQVPSEVAVGVPAELLRRRPDIRLAEAQMAAQC 313

Query: 290 AKIGIAKSDLYPSL----------------SLNGSIALTHDNSFPGYNTHWSFGPKLYLP 333
           A IG+A++DLYP                          +  + + G +  +S G      
Sbjct: 314 ALIGVAQADLYPRFSLFGTIGLSASNAALTFAGYPGGSSLGDLWSGESLQYSGGLGFGWD 373

Query: 334 IFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELH 393
           IF+ G+I +N+R  ++  Q+    ++  VL A +E E+ALT+ +  ++ V  L+  V   
Sbjct: 374 IFNYGRITNNVRVQDARFQQLVEQYKNIVLTAARETEDALTAFSRSREEVAFLEQGVAAA 433

Query: 394 KKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            +S+ +SMI YR+G      +LD +R+  +V+  L+  +  +  + +  Y A+G G+
Sbjct: 434 TRSVEISMIQYREGLADFQRVLDTQRSKVQVQDQLTATQGSVLTNLIATYKALGGGW 490


>gi|224588238|gb|ACN58862.1| outer membrane protein OprN precursor [uncultured bacterium BLR13]
          Length = 469

 Score =  196 bits (498), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 115/457 (25%), Positives = 206/457 (45%), Gaps = 13/457 (2%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLV 65
           A+     ++L  C+  P   K   P L + F+   S         ++W +FND  L+ LV
Sbjct: 9   AVVIGVALVLTACSSAPPVKKFE-PALDSGFANAPSVAAAGEPVGEFWRAFNDPLLDTLV 67

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP--------NLKTNST 117
           + AL+ N  I  A   +  A+       A L PS         I             N +
Sbjct: 68  QRALKANTDIRGAAASLREARALNRYADAQLLPSIGLDAGAARIRAPNDVGVVQTNNNYS 127

Query: 118 GQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISI 176
              D  W+ DLFG+     +++ AN+ +  A V  A+++V +++  +Y D R  +E++ +
Sbjct: 128 AGFDVAWEADLFGRLGDARKAAQANVLAGAAGVRAAQVSVTAEVARNYFDLRGLQEQLRV 187

Query: 177 AHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTL 236
           A   L+  +  +EL   +   G  + L   +  A +KS  ++IP LE +     + ++ L
Sbjct: 188 AVASLETQQSALELVDARLDVGRGTALDSERARALVKSTAANIPALEAALIRTRYRLAVL 247

Query: 237 LGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAK 296
            G   T     +               +IG PA L+R RPDI+  E ++A + A++G+A+
Sbjct: 248 CGLQPTALDAELGPVQPLPGLRAVRLSSIGSPASLLRRRPDIQLAEAQVAAAAAQVGVAR 307

Query: 297 SDLYPSLSLNGSIALTHDNSFPGYN---THWSFGPKLYLPIFDKGKIKSNIRRAESSAQE 353
           S L+P LSL G++     +           ++ G +L   + D G+I++ I  A++    
Sbjct: 308 SALFPVLSLGGTLGQNSSHFGDLGKGASYVYNLGAQLTWNLIDFGRIRAQISAADARNDA 367

Query: 354 QYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLD 413
             I +++ VL A++E E AL S    ++    L  A +  +++  ++   ++ G    L 
Sbjct: 368 VVIGYEKAVLGALEETEGALASYTRTQRQTELLFEAAQSSEQAAVIARERFKVGSTDFLT 427

Query: 414 ILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +LD ER        L+ A+   A S V +Y A+G G+
Sbjct: 428 VLDAERELLSARDRLAQAQAGAATSLVAVYKALGGGW 464


>gi|187927064|ref|YP_001893409.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Ralstonia pickettii 12J]
 gi|241665393|ref|YP_002983752.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Ralstonia pickettii 12D]
 gi|187728818|gb|ACD29982.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Ralstonia pickettii 12J]
 gi|240867420|gb|ACS65080.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Ralstonia pickettii 12D]
          Length = 484

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 108/469 (23%), Positives = 207/469 (44%), Gaps = 28/469 (5%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIG---NSKNLINIDTLKWWESFNDTSLN 62
           A+ +  IV LAGC++ P Y +P + +     +      ++         WW+ FND  L+
Sbjct: 11  ALAASLIVSLAGCSLAPTYERPALDVPAHWQTEAPWRAAQPADAAPKGPWWQRFNDPQLD 70

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL-- 120
           KL+  AL  N ++  A   +  A+      RA L P+  A+ +                 
Sbjct: 71  KLITQALAHNQSLKVALSNLEQAQAQTRVARASLLPTITANNNDSRTRTSSERPLSSYTS 130

Query: 121 --------------DSDWKIDLFGQRRHIESSLA-NLDSAYAQVDIAKLNVISKLIPSYI 165
                         D+ ++ DLFG+ R+  ++ A + + A A  +  +L + +++  ++ 
Sbjct: 131 PTMSTIQSDLVLRADASYEADLFGRVRNTVANAAASEEQAGANFENFRLLLAAQVATTWY 190

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
           + R     I++  + L L +K ++    +   G  S L L + +A + S  +    L K 
Sbjct: 191 NLRETDAEIAVVQEGLALQRKALDFVTSRHQDGVASGLDLAQQQALVDSTATQAELLTKQ 250

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
                H ++TL+G PA  F                  I + +P+D+I  RPD+   E+  
Sbjct: 251 RAQYEHALATLVGTPAPAFHIDPTPLKGTA-----PQIPVALPSDVIERRPDVAAAERGA 305

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKS 342
           A + A++G+A++  +PS+ LNG       +    F      WSFG ++   +FD G+ + 
Sbjct: 306 AAANAQVGVARAAFFPSVMLNGGAGWESRDLALLFSAPTLLWSFGTQIAQTVFDAGRTRG 365

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            +  A ++ Q     +++TVL A++EVE+ L  +    +   + +HAVE  +K   ++ +
Sbjct: 366 RVDIANAAYQGAIANYRQTVLGALQEVEDGLAGLQSLDRAANQARHAVESARKVYDIASV 425

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            Y  G  + LD++  +++    +        Q   + V L  A+G  +N
Sbjct: 426 RYEGGLATSLDVITAQQSLLNNQRTAVQILGQQMTTSVFLVKAVGGDWN 474


>gi|218549854|ref|YP_002383645.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia fergusonii ATCC 35469]
 gi|218357395|emb|CAQ90034.1| copper/silver efflux system, outer membrane component [Escherichia
           fergusonii ATCC 35469]
          Length = 462

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 104/463 (22%), Positives = 197/463 (42%), Gaps = 16/463 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK--NLINIDTLKWWESFND 58
           M+  + +     + L GC++ P+Y +P MP+        N +   + N     W   F D
Sbjct: 3   MSPCKLLPFCVALALTGCSLAPDYQRPAMPVPQQFSLSQNGQVNAVDNYQNAGWRTFFVD 62

Query: 59  TSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTG 118
             +  L+  AL  N  +  AT ++  A+       AD +P      S  +  NLK +S  
Sbjct: 63  NQVKTLISEALVNNRDLRMATLKVQEARTQYRLTDADRYPQLNGEGSGSWSGNLKGDSAT 122

Query: 119 QLDSDWKID-------LFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
             +    ++           +   E+   N  +         + ++S +  SY + +   
Sbjct: 123 TREFSTGLNASFDFDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLAY 182

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
            ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       +
Sbjct: 183 AQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQANN 242

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
            +  LLG     +    Q Q+ N      + +  G+ + ++  RPDI   E  L  + A 
Sbjct: 243 ALQLLLG----SYGKLPQAQTVNSDSLQSVKLPAGLSSQILLQRPDIMEAEHALMAANAN 298

Query: 292 IGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
           IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  AE
Sbjct: 299 IGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIAE 358

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
              Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G 
Sbjct: 359 IRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARALYQHGA 418

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            S L++LD ER+       L         + V LY A+G G+ 
Sbjct: 419 VSYLEVLDAERSLFATRQTLLDLNYARQVNEVSLYTALGGGWQ 461


>gi|328953228|ref|YP_004370562.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfobacca acetoxidans DSM 11109]
 gi|328453552|gb|AEB09381.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Desulfobacca acetoxidans DSM 11109]
          Length = 467

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 102/470 (21%), Positives = 202/470 (42%), Gaps = 28/470 (5%)

Query: 3   ILRAIFSLFIVL---LAGCTVGPEYTKPHMPLL------PTQFSIGNSKNLINIDTLKWW 53
           ++R I +L +++   L GCT+ PEYT+P  P+       P   +   + +      ++W 
Sbjct: 1   MIRKILALLVIIAVPLTGCTLIPEYTRPEAPIPQDWPSGPAYKNASPAPDAPLAAEVQWR 60

Query: 54  ESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK 113
             F D  L  ++ +AL+ N  +  A   +  A+      RA+LFP+    IS R      
Sbjct: 61  TFFADQRLQTIIAMALKNNRDLQVAALSVEKARAMYRVQRAELFPTVETGISARKERVKI 120

Query: 114 TNSTGQLD----------SDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIP 162
           + + G ++          S W+ID FG+ R ++        ++      A++ +IS++  
Sbjct: 121 SGTQGMVNLEEYSINLGISSWEIDFFGRIRSLKKRALEEYLASEQGRRSAEILLISEVAN 180

Query: 163 SYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTL 222
           +Y+     +E + +A   L+  +    L   +F  G   +L L +++  + +   D+   
Sbjct: 181 AYLTLAADRENLKLARSTLETQQAAYNLIRRRFEVGFAPELDLRQVQTRVDTARVDVARY 240

Query: 223 EKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQE 282
            +    + + +  L G P    L   +       P++      G  ++++  RPDI   E
Sbjct: 241 TELTAQDENALHLLAGSPIPADLLPRELSLVKPLPDVSP----GTSSEVLLRRPDILQAE 296

Query: 283 KKLADSVAKIGIAKSDLYPSLSLNGSIALTHDN---SFPGYNTHWSFGPKLYLPIFDKGK 339
             L  + A IG A++  +P +SL  +I     +    F   +  WS+ P++ LPIFD  +
Sbjct: 297 HVLKAANANIGAARAAFFPRISLTSAIGTASGDLSGLFETGSFVWSYAPRIVLPIFD-AR 355

Query: 340 IKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSL 399
            +  +   + + +     ++ ++  A +E  +AL S       +   Q  V+   ++  L
Sbjct: 356 TRPALEATQVARKIAQAQYERSIQIAFRETADALASRGTLGDRMAAQQSLVDATARTYQL 415

Query: 400 SMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           S   Y +G    L++LD +R+    +  L   +     + V LY  +G G
Sbjct: 416 SNARYEKGIDIYLNVLDAQRSLYAAQQGLIAIRLAKLANQVRLYAVLGGG 465


>gi|330981343|gb|EGH79446.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. aptata str. DSM 50252]
          Length = 487

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 113/469 (24%), Positives = 207/469 (44%), Gaps = 25/469 (5%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINID---TLKWWESFNDT 59
           I      L +VLL+ C VGP+Y KP M       +    +     D      WWE + D 
Sbjct: 15  IRPFALGLCVVLLSACAVGPDYQKPSMAAPAQFKAAQGWRAATPSDGMAKGAWWEVYKDP 74

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN-------- 111
            LN LV+     N T+ Q   +   A+  + S RA   P+   +                
Sbjct: 75  QLNALVERLNTSNQTVAQYDAQYRQAQTLVRSSRAAFLPTLDLTTGKTRSGQGTGTSNSG 134

Query: 112 -----LKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
                 + +   QL   W+ D++G+ RR +E+  AN  ++ A +   +L++ S+L+ +Y+
Sbjct: 135 TSASGTRNSYNAQLGVSWEADVWGKLRRGLEADTANAQASLADLAAMRLSLQSELVQNYL 194

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
             R   E+  +    +D Y++++ L+  ++  G +   ++ + + ++KS ++D+  L   
Sbjct: 195 QLRVIDEQKRLLESTVDAYQRSLTLTQNQYRAGISGSDAVAQAQTQLKSTQADLIDLAWQ 254

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
                + I+ L+G    +F                     G+P+ L+  RPDI   E+ +
Sbjct: 255 RAQYENAIAVLMGMAPADFNLPATTSIPQLPQIPP-----GLPSQLLERRPDIAAAERSV 309

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG+AK+  YP  +L+ S   +     N     N  WS GP+L L +FD G+  +
Sbjct: 310 MGANANIGVAKAAYYPDFTLSMSGGYSSSTFANWISLPNRFWSVGPQLALTLFDGGRRSA 369

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
              R E+   +    +++TVLN  +EVEN L  +   ++     Q A+   + S+ L+  
Sbjct: 370 EFDRTEAVYDQTVAQYRQTVLNGFQEVENYLVQLKVYEQEAAVRQEALVSARDSLRLTNN 429

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            Y+ G    LD+++++      E  +    +    + V L  A+G G+N
Sbjct: 430 QYKAGLIGYLDVVNVQATALSNERSVLSVLQSRLIASVQLIAALGGGWN 478


>gi|308270699|emb|CBX27309.1| Outer membrane protein oprM [uncultured Desulfobacterium sp.]
          Length = 508

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 97/471 (20%), Positives = 188/471 (39%), Gaps = 27/471 (5%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFS------IGNSKNLINIDTLKWWE 54
           M     +    ++ + GC++ P+YTKP  P+               +        L W  
Sbjct: 41  MKKQIILILGVLLFMGGCSMNPKYTKPLAPVPAEWPKGEAYKLTQAAPETPTAPELSWKA 100

Query: 55  SFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS--------- 105
            F D  L ++++ AL  N  +  A   +  A+      RA+L P   A+ +         
Sbjct: 101 FFTDPKLQQIIETALTNNRDLRIAALNVERARALYGVQRAELLPVVNAAGTGSKERIAAN 160

Query: 106 ---HRFIPNLKTNSTGQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLI 161
                     +  + G   + W++D FG+ R + + +L    +        ++ ++S++ 
Sbjct: 161 LISPEGSRTSEQYNVGLGIAAWEMDFFGRIRSLKDQALEEYLATDEARRSVQVALVSEVA 220

Query: 162 PSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPT 221
             Y+      E + +A   L   +   +L   ++  G  SKL L + +  + S   D+  
Sbjct: 221 RVYLTLSADLENLKLARSTLTAQQSAYDLIKRQYEVGVVSKLDLRQAQIPVDSARGDVAR 280

Query: 222 LEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQ 281
             +    + + +  L G      +      S+  + N    I  G+ ++ + NRPDI   
Sbjct: 281 FTQIAAQDRNALDLLAG----SKVPMDLLPSDLARYNPPKEIFAGLSSESLLNRPDIMAA 336

Query: 282 EKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKG 338
           E +L  + A IG A++  +P +SL  S+    D+    F   +  WSF P + +P+FD  
Sbjct: 337 EHRLKGAYAYIGAARASFFPRISLTTSVGTASDDLSGLFGSGSGTWSFTPHIVVPVFDAR 396

Query: 339 KIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMS 398
              +  R +++  +     +++ +  A +EV ++L       + V   Q        +  
Sbjct: 397 TW-AAYRVSQAQQEIALAQYEKAIQVAFREVADSLAVQGTVDQQVAAQQSLTNAVADTYR 455

Query: 399 LSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           LS I Y +G  S L +LD +R+    +  L   +     + V LY  +G G
Sbjct: 456 LSNIRYSKGIDSYLGVLDAQRSLYAAQQGLISLQLAKLANQVRLYAVLGGG 506


>gi|156179564|gb|ABU54832.1| outer membrane protein [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
          Length = 477

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 103/467 (22%), Positives = 216/467 (46%), Gaps = 25/467 (5%)

Query: 2   NILRAIFSLFI-VLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS 60
           N+ + + +L + +LL GC++ P+Y +P +P      S    +  ++     W + F D +
Sbjct: 6   NMTKTLIALSVTLLLGGCSMAPDYQRPELPQGAAWQSNQAGEAAVS----PWRQQFLDPA 61

Query: 61  LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL 120
           L +L+  AL+ N  +  A   + A +      RA   P+  A+ S          S+   
Sbjct: 62  LQQLIATALENNRDLRIAALNVEAYEARYRIQRAAQLPTLAANGSGTRQQGSDDLSSTGQ 121

Query: 121 ------------DSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDA 167
                        + +++DLFG+ + + + +L N  +        ++ +I+ +  +Y++ 
Sbjct: 122 GTISSQYGANIGITSYELDLFGRIQSLKDQALENYLAQVETQRSTQIALIASVANAYLNL 181

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
              +E ++++   L   +++  L+  K+  GA S++ L +    ++S +  +   ++  +
Sbjct: 182 LADQELLALSEATLATEQESYGLTEHKYRLGAASEMELAQGRTALESAKVSLAQYQRQVK 241

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
            + + ++ LLG      +  +  +           I +G P+ L++ RPDI   E  L  
Sbjct: 242 QDRNGLALLLG----TGVPALMTEPATLAEVQLAAIPVGAPSSLLQQRPDILAAEHSLKA 297

Query: 288 SVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNI 344
           + A IG A++  +P++SL  +     +     F G    W+F P++ LPIFD GK  +++
Sbjct: 298 ANANIGAARAAFFPTISLTATAGSASNQLSGLFDGGTGTWTFMPQINLPIFDGGKRIADL 357

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
             AE S ++   ++++++  A KEV + L +  + +K +   Q  VE ++    L+ + Y
Sbjct: 358 DVAEVSTRQAVASYEKSIQTAFKEVADTLGAQVDYQKQLQAQQALVEANQTYFKLAEVRY 417

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            +G  S L  LD +R+    +  L   +     + V LY A+G G+ 
Sbjct: 418 EKGVDSYLTRLDAQRSLFSAKQGLISTRLAQLSNQVALYKAVGGGWQ 464


>gi|270261920|ref|ZP_06190192.1| RND efflux system outer membrane lipoprotein [Serratia odorifera
           4Rx13]
 gi|270043796|gb|EFA16888.1| RND efflux system outer membrane lipoprotein [Serratia odorifera
           4Rx13]
          Length = 484

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 93/465 (20%), Positives = 196/465 (42%), Gaps = 23/465 (4%)

Query: 5   RAIFSLFIVLLAGC-TVGPEYTKPHMPLLP-----TQFSIGNSKNLINIDTLKWWESFND 58
           R I   F +LLAGC ++ P+Y +P  P+         ++  + K  ++   + W +   D
Sbjct: 4   RLITLTFPLLLAGCISLDPDYQRPQAPVPANLPQGAAYATPSGKLSLSYPDIPWRDYVVD 63

Query: 59  TSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTG 118
             L ++V + L  +  + +A   I +A+      R++LFP+  A +      +L  N   
Sbjct: 64  ARLRQVVAMGLSSSRDLREAIANIESARALYGEQRSELFPTINAGVDGTRSRSLTGNGNA 123

Query: 119 QL----------DSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYIDA 167
                        S +++DLFG+ R +  +      +        +L +I+ ++  +++ 
Sbjct: 124 TAISQSYEASAGTSSFELDLFGKNRSLSRAKFETYLAESEAAKSTRLTLIADIVTDWVNV 183

Query: 168 RHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFR 227
              +  ++ A   ++  + ++E++      G  S + +   +   +   SD+ +   S  
Sbjct: 184 AAERSLLAAAKDTMESARLSLEVTRKNQQNGILSMVDVASADTVYQQARSDVASYTTSAA 243

Query: 228 MNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLAD 287
              + +  ++G    E L     ++ +    +   +   + + ++ NRPD+   E  L  
Sbjct: 244 QAKNALDLVVGQSVPESLLPNGIEALS---GIMKDMPANVSSQVLLNRPDVLEAEHNLKS 300

Query: 288 SVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNI 344
           + A IG A++  +PS+SL  S  +      + F      WSF P + LPIF  G   S +
Sbjct: 301 ANASIGSARAAFFPSISLTASGGVGSGELSSLFSKGAGVWSFAPSISLPIFTGGYNTSQL 360

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
              ++       T+++ V  A +E  +AL       + +      V   ++   L+ + Y
Sbjct: 361 NYTKAQKDLYVATYEKAVQTAFQETADALARKGTIGEQLAAQTGYVAASREYYRLAELRY 420

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           R G  + L++LD +R        L  A++   ++ + LY  +G G
Sbjct: 421 RHGVDTYLNMLDAQRTLYTARQSLISAQQTEYQNLITLYKVLGGG 465


>gi|296103248|ref|YP_003613394.1| RND efflux system, outer membrane lipoprotein [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
 gi|295057707|gb|ADF62445.1| RND efflux system, outer membrane lipoprotein [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
          Length = 495

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 122/479 (25%), Positives = 230/479 (48%), Gaps = 41/479 (8%)

Query: 13  VLLAGCTVGPEYTKPHMPLLPTQFSIGNS----KNLINIDTLKWWESFNDTSLNKLVKIA 68
           +LLAGC VGP+Y  P  P +      G+S    +        +WW++F    L+ L++ A
Sbjct: 1   MLLAGCAVGPDYQPPAPPAVTHWNDKGDSTVKSQTTSAATNPRWWKTFGSPQLDSLIERA 60

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP------------------ 110
           +  NL++ Q   RI  A+E I       +PS   ++                        
Sbjct: 61  IAGNLSLQQTVLRIAGAREQINQAGGAFYPSVNGNLQATRQQLGLEGELKSHGVYDQLDN 120

Query: 111 -------------NLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNV 156
                               G  D+ W+IDL+G+ RR +E++ A   +A  Q + A +++
Sbjct: 121 VDPELRGALGPLTQPINLYQGSFDAQWEIDLWGKVRRQVEAAEAQQKAAIEQRNDALVSL 180

Query: 157 ISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE 216
            +++  +++  R  +  I+  +  +   ++ ++L+  +   G + ++ +    A++ ++E
Sbjct: 181 EAEVARAWLQLRGAQSIIATLNTQIKSAQQTLDLTESRQRGGLSPQMDVENARAQLGNLE 240

Query: 217 SDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRP 276
           + +P  +   R  ++ ++ LLG P       +Q  S    P L   +  GIP+ L R RP
Sbjct: 241 AQLPQYQAQERQAMNGLAILLGKPPGALDAELQ--SAQPMPALPDIVQTGIPSTLARRRP 298

Query: 277 DIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSI---ALTHDNSFPGYNTHWSFGPKLYLP 333
           D+R  E  L  + A+IG++ ++L+PS +L+G         +      +  +SFGP++ +P
Sbjct: 299 DVREAEANLHAATAQIGVSVAELFPSFTLSGQFGLRNSESNWLTDWSSHFYSFGPQVSIP 358

Query: 334 IFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELH 393
           IF  G++ S+++ A +      + +++TVL A+ +VENAL S   D++    L   ++  
Sbjct: 359 IFQGGRLVSSVKVARAQQGAAVLDYRQTVLTALGDVENALVSYRTDQQREAGLAKTIDAL 418

Query: 394 KKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
           + +  L+  +YRQG  S +D+LD +R  A+ E   + A+ Q A   V LY A+G G+ P
Sbjct: 419 QNAFDLASDSYRQGIASFIDVLDAQRQLAQAEQQRAQAQVQSALDLVALYKALGGGWEP 477


>gi|325921780|ref|ZP_08183601.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [Xanthomonas gardneri ATCC 19865]
 gi|325547741|gb|EGD18774.1| efflux transporter, outer membrane factor lipoprotein, NodT family
           [Xanthomonas gardneri ATCC 19865]
          Length = 501

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 104/483 (21%), Positives = 200/483 (41%), Gaps = 33/483 (6%)

Query: 1   MNILRAIFSLFIVL--LAGCTVGPEYTKPHMPLLPTQF--------------SIGNSKNL 44
           M  +R   +   V   L+GCT+ P Y +P  P+                   +   +   
Sbjct: 1   MTPIRMTLTAIAVASVLSGCTLMPRYARPDAPVPDRFAGTDITVASNATEVVANTGTDEA 60

Query: 45  INIDTLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASI 104
            +I  + W + F D +L +++ +AL+ N  +  A   I  A+      RA L PS   + 
Sbjct: 61  TDIANIGWRQVFTDPALQQVIALALENNRDLRVAALNIEVARAQYRVERAALLPSVQGTG 120

Query: 105 SHRFIPNLK------------TNSTGQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDI 151
           +                    T S     S +++DLFG+ R ++        S       
Sbjct: 121 TSNNARTPSELAIPGQPQVFRTYSANIGISAYELDLFGRVRSLKEQALQQFLSTAEARRS 180

Query: 152 AKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAE 211
             +++++++  +Y+     ++ + +A   L     +  L    F  G  S+L+L + +  
Sbjct: 181 THISLVAEVATAYLTLAADQQLLQLAQSTLSSQSDSYRLQQRSFELGVASQLTLRQAQTT 240

Query: 212 IKSIESDIPTLEKSFRMNVHNISTLLGYP-ATEFLHYMQKQSNNFQPNLYIPINIGIPAD 270
           +++   D+         + + +  L+G     + L        +   N+   +  G+P+ 
Sbjct: 241 VETARVDVERYTAQVAQDRNALVLLVGTQVPVDLLPRALPDGASVDGNVLAGVPAGLPSQ 300

Query: 271 LIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFG 327
           L++ RPDI   E+ L  + A IG A++  +PS+SL    GS   +  N F      WSF 
Sbjct: 301 LLQRRPDILEAERNLRAANANIGAARAAFFPSISLTASQGSSTSSLSNLFDSGTRAWSFV 360

Query: 328 PKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQ 387
           P L LPIF+ G+ ++N+  A+++   +   +++ + +A +EV +AL       + +   Q
Sbjct: 361 PTLTLPIFNAGRNRANLDMAKANRAIEVAQYEKAIQSAFREVSDALAQRETLGRQLQAQQ 420

Query: 388 HAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIG 447
             V+    S  LS   + +G  S L  LD +R+    +  L   +     +    Y A+G
Sbjct: 421 ALVDATADSYRLSQARFERGVDSYLQALDAQRSLYSAQQTLIATQLSRFTNLATFYKAMG 480

Query: 448 SGY 450
            G+
Sbjct: 481 GGW 483


>gi|300313892|ref|YP_003777984.1| outer membrane drug efflux lipoprotein [Herbaspirillum seropedicae
           SmR1]
 gi|300076677|gb|ADJ66076.1| outer membrane drug efflux lipoprotein [Herbaspirillum seropedicae
           SmR1]
          Length = 497

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 89/462 (19%), Positives = 188/462 (40%), Gaps = 30/462 (6%)

Query: 17  GCT-VGPEYTKPHMPLLPTQFSIGNSKNLI----------NIDTLKWWESFNDTSLNKLV 65
           GC  + P+YT+P  P+  +  S   ++  +          + D L W E F D  L +++
Sbjct: 27  GCANLAPDYTQPAAPVPASWTSQAAAQPAVGSAGPAAGEIDADHLGWREFFLDPRLQQVI 86

Query: 66  KIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDS--- 122
             AL  N  +  A   I  A+       A+ +PS  A+ +          ST    +   
Sbjct: 87  AAALDNNRDLRVAALNIEKARAQYRITDANRYPSISATGTSSASRTPAELSTTGSAAVSH 146

Query: 123 ---------DWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                     +++D FG+ +++ +++L +            +++++++  +++     ++
Sbjct: 147 QQSVTVGVSAYELDFFGRLKNLSDAALESYQYQVETRRSTHISLVAEVATAWLTLASDRD 206

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + +A        +   LS      G  S + L   EA ++S  +D+         +++ 
Sbjct: 207 LLKLAQDTYASQSRTFALSQRSHDIGTVSGVDLASQEATVESARADVARYASQVEQDLNA 266

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  L+G    +    +         ++      G+P+ ++  RPD+   E  L  + A I
Sbjct: 267 LRLLVG---ADIDAALLPAGLPDTASVLPATPAGLPSQVLLRRPDVLAAEHTLKSANADI 323

Query: 293 GIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +PS+SL  +           F   +  W+F P + LPIF+ G +++++  A+ 
Sbjct: 324 GAARAAFFPSISLTANGGTASRTLGGLFKAGSGSWTFSPSINLPIFNAGSLRASLDSAKI 383

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
           +       +++ +  A +EV +AL       + +     A    +K+  LS   YR G  
Sbjct: 384 TRDIDVANYEKAIQTAFREVADALAVRATLDQRLDAQGKATAASEKAFRLSDARYRNGVD 443

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           S L  L  +R     +  L   +     + + LY  +G G++
Sbjct: 444 SYLTTLVAQRTLYSAQQTLISLRLTEQSNRITLYKVLGGGWS 485


>gi|323967517|gb|EGB62933.1| NodT family protein efflux transporter [Escherichia coli M863]
          Length = 460

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 112/464 (24%), Positives = 208/464 (44%), Gaps = 18/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK---NLINIDTLKWWESFN 57
           M+  + +     + L GC++ PEY +P MP +P QFS+  +     + N     W   F 
Sbjct: 1   MSPCKLLPFCVALALTGCSLAPEYQRPAMP-VPQQFSLSQNGLVNAVDNYQNAGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS- 116
           D  +  L+  AL  N  +  AT ++  A+       AD +P      S  +  NLK +S 
Sbjct: 60  DNQVKTLISEALVNNRDLRMATLKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGDSA 119

Query: 117 -----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +  
Sbjct: 120 TTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       
Sbjct: 180 YAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +    Q Q+ N      + +  G+ + ++  RPDI   E  L  + A
Sbjct: 240 NALQLLLG----NYGKLPQAQTVNSDSLQSVKLPAGLSSQILLQRPDIMEAEHALMAANA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  A
Sbjct: 296 NIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARALYQHG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             S L++LD ER+       L         + V LY A+G G+ 
Sbjct: 416 AVSYLEVLDAERSLFATRQTLLDLNYARQVNEVSLYTALGGGWQ 459


>gi|157738362|ref|YP_001491046.1| RND efflux system, outer membrane lipoprotein [Arcobacter butzleri
           RM4018]
 gi|157700216|gb|ABV68376.1| RND efflux system, outer membrane lipoprotein [Arcobacter butzleri
           RM4018]
          Length = 466

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 104/464 (22%), Positives = 203/464 (43%), Gaps = 19/464 (4%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQF---SIGNSKNLINIDTLKWWESFN 57
           MN +     L  +L +GCT+ P        ++P  F   S+ NS + +++    W     
Sbjct: 1   MNKINISIILTTILFSGCTLTPNLETLDSNVIPQTFKNNSVENSSDDLSLVKPNWENFVQ 60

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKT--- 114
           D +L K+V +AL+ N  +  A   I +A+      RAD FP+  A  S     ++ +   
Sbjct: 61  DETLKKVVSLALENNKDLKIALLNIESARATYRIARADNFPTFDAKGSATHSKSMNSENS 120

Query: 115 -----NSTGQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLNVISKLIPSYIDAR 168
                N +  + + ++IDLFG+ R +  S   +  S     +  K+++IS+ I ++I   
Sbjct: 121 TSISHNYSANISASYEIDLFGKVRSLSQSALDSFLSTQYAANATKISLISETITAWITLA 180

Query: 169 HFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRM 228
             +E++ +A + +   +K  EL+  ++  G  SK  +   +A +   +  + +   S   
Sbjct: 181 IHQEQLKLATETVKNLEKVYELTQKRYLAGVVSKTDVFDAKASLNEAQISVISYSNSVEQ 240

Query: 229 NVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADS 288
           + + +  ++  P  + L     +++     L  P    I ++++  RPDI   E  L   
Sbjct: 241 DKNALELIVAQPLNDDLLPKSFETHTSWLMLVKP---AISSNILLGRPDIMQAEYNLKSK 297

Query: 289 VAKIGIAKSDLYPSLSLNGSIALTHDNSFP----GYNTHWSFGPKLYLPIFDKGKIKSNI 344
            A IG A++  +P++SL  +  +   +            WSF P + +PIF  G+  +N+
Sbjct: 298 NANIGAARAAFFPTISLTANSGIASRSLSDLFNGNAQNVWSFSPNISIPIFSGGENMANL 357

Query: 345 RRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINY 404
               +        +++++  A KEV + L       + + K +  VE   KS  +S+ +Y
Sbjct: 358 DYTYAQRDIALQEYEKSIQTAFKEVNDTLVIRKTINEQIQKQKELVEAVSKSYEISLNSY 417

Query: 405 RQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGS 448
           + G  S L++L  +R     +  L         + V+LY   G 
Sbjct: 418 KIGIGSFLNVLTSQRTLINAQQTLINNYSLELTNRVNLYSVFGG 461


>gi|163858505|ref|YP_001632803.1| outer membrane efflux protein [Bordetella petrii DSM 12804]
 gi|163262233|emb|CAP44535.1| probable outer membrane efflux protein [Bordetella petrii]
          Length = 487

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 109/465 (23%), Positives = 207/465 (44%), Gaps = 21/465 (4%)

Query: 6   AIFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGN--SKNLINIDTLKWWESFNDTSLN 62
           A+  L   +LAGC ++ PEY +P  P+     +     + ++     L W   F D  L 
Sbjct: 9   ALAVLTSSVLAGCVSLAPEYQRPAAPIAQQWPADSAVDATHVAAPVDLSWQTLFADPKLR 68

Query: 63  KLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQLDS 122
           + V +AL+ N  + +A   I  A+      RADL P   A +S        + S+     
Sbjct: 69  QTVDLALENNRDLRKAVLNIERARALYRIQRADLLPEVSAGVSGNSGRTPASVSSTGTAV 128

Query: 123 D-----------WKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                       W++DLFG+ R + + +L +  +  A     +L +IS++  +Y+     
Sbjct: 129 TSHSYRADLNIGWELDLFGRVRSLSDQALQDYFATEAAQYATRLGLISEVSTTYLTLAAD 188

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
           +E++++A + L   +   ++       G  S L+L + E+E+++       L+ S   + 
Sbjct: 189 REQLALAEETLRSRQDAYDMQRQLRDIGNASDLALRQAESELEAARDQALALQASVATDR 248

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  L+G P        +   +         +  G+P+DL++ RPDI   E +L  + A
Sbjct: 249 NALELLVGAPLPADGQPDRPLESML---AVQDLPAGLPSDLLQRRPDILAAEYRLQGANA 305

Query: 291 KIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL G I    D   N F G    W+F P++ +PIF  G++++N+  A
Sbjct: 306 NIGAARAAFFPSISLTGGIGRASDSLSNLFDGGTRAWNFLPQISVPIFSGGRLRANLAVA 365

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           +         ++  +  A +EV +AL   +     +   +  V+   ++ +L    Y  G
Sbjct: 366 KVDRDLAVADYEHAIQGAFREVADALAIGSRLDGRLDAQKRRVDAASEAYALVQRRYDNG 425

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP 452
             S L++LD +R     + +    +     + + LY A+G  + P
Sbjct: 426 VSSYLEVLDAQRTLYAAQQNWITTRLARQSNVITLYKALGGDFAP 470


>gi|222054326|ref|YP_002536688.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Geobacter sp. FRC-32]
 gi|221563615|gb|ACM19587.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Geobacter sp. FRC-32]
          Length = 476

 Score =  196 bits (497), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 106/476 (22%), Positives = 208/476 (43%), Gaps = 30/476 (6%)

Query: 1   MNILRAIFSL---FIVLLAGCT--VGPEYTKPHMPLL------PTQFSIGNSKNLINIDT 49
           MN ++ +  L    ++ L+GC   + PEY++P  P+       P   +         +  
Sbjct: 1   MNRIKNMLYLSLGALLWLSGCATTMAPEYSQPAAPVTNAWPSGPAYKTEAAKPEQKPLAE 60

Query: 50  LKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI 109
           + W E F D  L KL+ +AL  N  +  +   +   +      RADLFP+  A+    + 
Sbjct: 61  IPWQEFFVDPQLQKLIALALDNNRDLRVSILNMERFRAQYQIRRADLFPNVDATAGATYQ 120

Query: 110 PNLKTNSTGQLDS------------DWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNV 156
              +  S     +             +++DLFG+ R + + +L    S        ++++
Sbjct: 121 RIPEDFSATGRATTVHQYDVGLGVSSYEVDLFGRVRSLKDQALEQYLSTEQARRSVQISL 180

Query: 157 ISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIE 216
           +S++  +Y+      ER+ +A   L   +++ +L+  +F  G +S L L + +  + +  
Sbjct: 181 VSQVATAYLTLASDLERLKLAKDTLANQQESFKLTKSRFDSGVSSALDLQQAQTSVDAAR 240

Query: 217 SDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRP 276
            DI         + + ++ ++G         +  QS +        +  G+P+D++  RP
Sbjct: 241 VDIARFTALTAQDANGLNLVVGASVPA---ELLPQSLSETLTALKDVAPGLPSDVLLYRP 297

Query: 277 DIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLP 333
           DI   E  L  + A IG A++  +P ++L  ++    D     F G    W F P++ +P
Sbjct: 298 DILQAEFLLKGANANIGAARAAFFPRITLTSNVGFGSDELGGLFKGGAFTWGFTPRISVP 357

Query: 334 IFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELH 393
           IF+ G+ ++N++ AE         +++ +  A +EV +AL       + V   Q   +  
Sbjct: 358 IFEGGRNRANLKVAEVDRDIAVAQYEKAIQVAFREVADALAQRGTIDEQVAAQQSLTDAT 417

Query: 394 KKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
            +S  LS   Y +G  S L++LD +R+    + +L  A+     + V LY  +G G
Sbjct: 418 AESFRLSEARYERGVDSYLNVLDSQRSLYAAQQNLISARLIRLNNLVSLYKVLGGG 473


>gi|332768458|gb|EGJ98642.1| putative efflux pump outer membrane protein ttgC [Shigella flexneri
           2930-71]
          Length = 458

 Score =  196 bits (497), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 106/462 (22%), Positives = 203/462 (43%), Gaps = 16/462 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK---WWESFN 57
           M+  + +     + L GC++ P+Y +P MP +P QFS+  +  +   D  +   W   F 
Sbjct: 1   MSPCKLLPFCVALALTGCSLAPDYQRPVMP-VPQQFSLSQNGLVNAADNYQNVGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI----PNLK 113
           D  +  L+  AL  N  +  AT ++  A+       AD +P      S            
Sbjct: 60  DNQVKTLISEALVNNRDLRMATLKVQEARAQYRLTDADRYPQLNGEGSWSGNLKGDSATT 119

Query: 114 TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
              +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +    
Sbjct: 120 REFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLAYA 179

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
           ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       + 
Sbjct: 180 QLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQANNA 239

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           +  LLG     +    Q Q+ N      + +  G+ + ++  RPDI   E  L  + A I
Sbjct: 240 LQLLLG----SYGKLPQAQTVNSGSLQSVKLPAGLSSQILLQRPDIMEAEHALMAANANI 295

Query: 293 GIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  AE 
Sbjct: 296 GAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIAEI 355

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G  
Sbjct: 356 RQQQSVVNYEQKIQNAFKEVADALALRQSLDDQISAQQRYLASLQITLQRARALYQHGAV 415

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           S L++LD ER+       L         + + LY A+G G+ 
Sbjct: 416 SYLEVLDAERSLFATRQTLLDLNYARQVNEIYLYTALGGGWQ 457


>gi|289673890|ref|ZP_06494780.1| RND efflux system, outer membrane lipoprotein, NodT [Pseudomonas
           syringae pv. syringae FF5]
          Length = 487

 Score =  196 bits (497), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 113/469 (24%), Positives = 209/469 (44%), Gaps = 25/469 (5%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINID---TLKWWESFNDT 59
           I      L +VLL+ C VGP+Y KP M       +    +     D      WWE + D 
Sbjct: 15  IRPFALGLCVVLLSACAVGPDYQKPSMAAPAQFKAAQGWRAATPSDGMAKGAWWEVYKDP 74

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPN-------- 111
            LN LV+     N T+ Q   +   A+  + S RA   P+   +                
Sbjct: 75  QLNALVERLNTSNQTVAQYDAQYRQAQTLVRSSRAAFLPTLDLTTGKTRSGQGTGTSNSG 134

Query: 112 -----LKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYI 165
                ++ +   QL   W+ D++G+ RR +E+  AN  ++ A +   +L++ S+L+ +Y+
Sbjct: 135 TSASGIRNSYNAQLGVSWEADVWGKLRRGLEADTANAQASLADLAAMRLSLQSELVQNYL 194

Query: 166 DARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKS 225
             R   E+  +    +D Y++++ L+  ++  G +   ++ + + ++KS ++D+  L   
Sbjct: 195 QLRVIDEQKRLLESTVDAYQRSLTLTQNQYRAGISGSDAVAQAQTQLKSTQADLIDLAWQ 254

Query: 226 FRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKL 285
                + I+ L+G    +F                     G+P+ L+  RPDI   E+ +
Sbjct: 255 RAQYENAIAVLMGMAPADFNLPATTSIPQLPQIPP-----GLPSQLLERRPDIAAAERSV 309

Query: 286 ADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKS 342
             + A IG+AK+  YP  +L+ S   +     N     N  WS GP+L L +FD G+  +
Sbjct: 310 MGANANIGVAKAAYYPDFTLSMSGGYSSSTFANWISLPNRFWSVGPQLALTLFDGGRRSA 369

Query: 343 NIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMI 402
            + R E+   +    +++TVLN  +EVEN L  +   ++     Q A+   + S+ L+  
Sbjct: 370 EVDRTEAVYDQTVAQYRQTVLNGFQEVENYLVQLKVYEQEAAVRQEALVSARDSLRLTNN 429

Query: 403 NYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            Y+ G    LD+++++      E  +    +    + V L  A+G G+N
Sbjct: 430 QYKAGLIGYLDVVNVQATALSNERSVLSVLQSRLIASVQLIAALGGGWN 478


>gi|94497996|ref|ZP_01304560.1| probable outer membrane drug efflux lipoprotein [Sphingomonas sp.
           SKA58]
 gi|94422579|gb|EAT07616.1| probable outer membrane drug efflux lipoprotein [Sphingomonas sp.
           SKA58]
          Length = 470

 Score =  196 bits (497), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 100/472 (21%), Positives = 193/472 (40%), Gaps = 27/472 (5%)

Query: 1   MNILRAIFSL-FIVLLAGCTVGPEYTKPHMPLL------PTQFSIGNSKNLINIDTLKWW 53
           M  ++A+ ++   + LA C + P+Y +P +P+       P     G     I  +T  W 
Sbjct: 1   MRSIKALSAVTLSLALAACDMAPKYVRPDLPVPVESPQGPAYAETGEGVAAIPAETA-WR 59

Query: 54  ESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLK 113
           + F D  + ++++ AL  N  +  A   +  A+      RADLFPS  AS +  +     
Sbjct: 60  DFFTDPRMVRVIETALTNNRDLRIAVANVAQARAQYRVQRADLFPSVNASGTATYSEQPL 119

Query: 114 TNSTGQLDSDWKIDLFGQRRHIE-------------SSLANLDSAYAQVDIAKLNVISKL 160
                    +  +                       ++L    +       A+ +++++ 
Sbjct: 120 VQFGQTQRLNNDVYQAQVGISAWEIDLFGRVRNLSKAALEQFFATDENRKAAQTSLVAET 179

Query: 161 IPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIP 220
             +++     +ER+ IA ++   + K + L+  +F +G  S+L + + +       SDI 
Sbjct: 180 ANAWLVMAADQERLRIARELEGAFGKTLALTKARFERGIASELEVRQAQTSYDQARSDIA 239

Query: 221 TLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRY 280
                   + + ++ L G             S   +      +   I +D++  RPDI  
Sbjct: 240 EATTLVAQDQNALNLLAGTTVPASDL---PDSLTPEGATLENLPANITSDVLLQRPDIAS 296

Query: 281 QEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDK 337
            E +L  + A IG A++  +P++SL  +         N F   +  WS  P   LPIFD 
Sbjct: 297 AEHQLRAANANIGAARAAFFPNISLTAAFGSISQGLSNLFGSGSDFWSVAPSANLPIFDF 356

Query: 338 GKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSM 397
           G+ + N+R A ++      T++++V    +EV +AL      ++ +       +  + + 
Sbjct: 357 GRNQGNLRYARATYDAMVATYEKSVQTGFREVADALARRGTMERQLEAQTSLRDSARVAY 416

Query: 398 SLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
           +LS   +R G  S L  LD +R+    E  L   +     + V+LY A+G G
Sbjct: 417 TLSEARFRAGVDSFLTTLDSQRSLYTAEQSLVATRLTREANMVELYRAMGGG 468


>gi|30062022|ref|NP_836193.1| copper/silver efflux system outer membrane protein CusC [Shigella
           flexneri 2a str. 2457T]
 gi|30040266|gb|AAP15999.1| putative resistance protein [Shigella flexneri 2a str. 2457T]
 gi|281599866|gb|ADA72850.1| putative resistance protein [Shigella flexneri 2002017]
 gi|313646836|gb|EFS11293.1| cation efflux system protein cusC [Shigella flexneri 2a str. 2457T]
 gi|332763838|gb|EGJ94076.1| cation efflux system protein cusC [Shigella flexneri K-671]
 gi|333021878|gb|EGK41126.1| cation efflux system protein cusC [Shigella flexneri K-304]
          Length = 460

 Score =  196 bits (497), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 110/464 (23%), Positives = 209/464 (45%), Gaps = 18/464 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK---WWESFN 57
           M+  + +     + L GC++ P+Y +P MP +P QFS+  +  +   D  +   W   F 
Sbjct: 1   MSPCKLLPFCVALALTGCSLAPDYQRPVMP-VPQQFSLSQNGLVNAADNYQNVGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS- 116
           D  +  L+  AL  N  +  AT ++  A+       AD +P      S  +  NLK +S 
Sbjct: 60  DNQVKTLISEALVNNRDLRMATLKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGDSA 119

Query: 117 -----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +  
Sbjct: 120 TTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       
Sbjct: 180 YAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +    Q Q+ N      + +  G+ + ++  RPDI   E  L  + A
Sbjct: 240 NALQLLLG----SYGKLPQAQTVNSGSLQSVKLPAGLSSQILLQRPDIMEAEHALMAANA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  A
Sbjct: 296 NIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKIQNAFKEVADALALRQSLDDQISAQQRYLASLQITLQRARALYQHG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             S L++LD ER+       L         + + LY A+G G+ 
Sbjct: 416 AVSYLEVLDAERSLFATRQTLLDLNYARQVNEIYLYTALGGGWQ 459


>gi|253998869|ref|YP_003050932.1| NodT family RND efflux system outer membrane lipoprotein
           [Methylovorus sp. SIP3-4]
 gi|253985548|gb|ACT50405.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Methylovorus sp. SIP3-4]
          Length = 483

 Score =  196 bits (497), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 111/480 (23%), Positives = 206/480 (42%), Gaps = 33/480 (6%)

Query: 1   MNILRAIFSLFIVLLAGCT-VGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDT 59
           M       ++   +LAGC  + P+Y +P  P+   Q+    S        + W E   D 
Sbjct: 1   MKYSLITQAVLAAMLAGCASMAPDYQRPAAPVA-EQWPAQASNQGTPAADIGWREFLLDN 59

Query: 60  SLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSY------------------ 101
            L +LV++ALQ N  +  A   I  A+      RADLFP+                    
Sbjct: 60  RLQQLVELALQNNRDLRVAALNIEQARAEYQVQRADLFPTVNVIASRTAQLGSASSTSSS 119

Query: 102 ------ASISHRFIPNLKTNSTGQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKL 154
                 A  S      +++       S +++D +G+ R +      +  +         +
Sbjct: 120 TNATTGAVTSSSGGSVVQSYRATVGFSAYELDFWGRIRSLNEQALQSFFATEEARRSTHI 179

Query: 155 NVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKS 214
           +++S++  +++      +R+ +A   L   + + +L+   F  G  S L L +++  + +
Sbjct: 180 SLVSEVASAWLTLAADMQRLKLAQDTLQSQQASYDLTKQGFDIGVYSALELRQIQISVDT 239

Query: 215 IESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRN 274
             +D+       + + + +  L+G P  E    +  QS   Q      +  GIP+++++ 
Sbjct: 240 ARADVANYRSQVKQDQNALVLLVGQPVPEN---LLPQSQPDQVTSVADLPAGIPSEVLQR 296

Query: 275 RPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLY 331
           RPDI   E  L  + A IG A++  +P+++L  ++    +     F   +  WSF P+L 
Sbjct: 297 RPDILQAEHSLQAANANIGAARAAFFPTITLTTTLGSASNQLSGLFASGSKVWSFAPQLT 356

Query: 332 LPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVE 391
           LPIFD G+ +S ++ AE + Q     +++ + +A KEV +AL       + +   Q  VE
Sbjct: 357 LPIFDAGRNRSKLKSAEVAQQITVAQYEKAIQSAFKEVADALAIRENLTERLQAQQSLVE 416

Query: 392 LHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
             ++S  LS   +R G  S L +LD +R     +  L         + V LY  +G G+N
Sbjct: 417 ASQESYKLSDARFRGGIDSYLAVLDAQRTLYSAQQTLITVNLTAQTNQVTLYKVLGGGWN 476


>gi|167564942|ref|ZP_02357858.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Burkholderia oklahomensis EO147]
          Length = 510

 Score =  196 bits (497), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 108/482 (22%), Positives = 211/482 (43%), Gaps = 39/482 (8%)

Query: 3   ILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGN------------SKNLINIDTL 50
            + A   L + LLA C VGP+Y +P +                       ++        
Sbjct: 15  KIAAASGLLVTLLAACAVGPDYKRPDVATPAAFKEAPALSPGEQAGTWKTAEPADAAHRG 74

Query: 51  KWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFI- 109
           +WW +F D  L+ L + AL  N  +  A  R+  A+    + R+  FP            
Sbjct: 75  EWWRAFGDPVLDALEEQALAANQNLKAAAARVEQARAATRAARSQWFPQVGVGFGPTREG 134

Query: 110 -------------PNLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLN 155
                        P   T    Q    ++ DLFG+  R++E+S A+   + A     +L 
Sbjct: 135 LSSASQFQPQGAGPTNATLWRAQGTVSYEADLFGRVSRNVEASRADAAQSEALFRSVQLA 194

Query: 156 VISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSI 215
           + + +  +Y + R       +  + ++L ++ ++L   +F++G  S+L + + + E+ + 
Sbjct: 195 LQADVAQNYFELRRLDSDQDLYRRTVELREQALKLVQRRFSEGDISELDVSRAKNELATA 254

Query: 216 ESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNR 275
           ++D   + +   ++ H ++ LLG    +F       +      + + +  G+P+ L+  R
Sbjct: 255 QADAVGVARRRAVSEHALAILLGKAPADFSFKETPIAP-----VAVRVPAGLPSALLERR 309

Query: 276 PDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKL-- 330
           PDI   E+ +  + A++G+AKS  +P L + G+         N F   +  +  GP    
Sbjct: 310 PDIAAAERAMMAANARVGLAKSAYFPKLDITGAFGFEAATLGNLFLWSSRTFLLGPFAGT 369

Query: 331 --YLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQH 388
              LPIFD G+  + + +A +   E+   +++ VL A +EVE+ L  +      +     
Sbjct: 370 ALTLPIFDGGRRSAGVAQARAKYDEEVANYRQQVLVAFREVEDNLADLRLLDDQIRAQND 429

Query: 389 AVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGS 448
           AV   +++ +LS   Y++G  S LD++D ER+  + ++  +      A S V+L  A+G 
Sbjct: 430 AVNASRRAATLSRTQYQEGAVSYLDVIDSERSVLESQLQSNQLTGTQAASTVNLIRALGG 489

Query: 449 GY 450
           G+
Sbjct: 490 GW 491


>gi|320198301|gb|EFW72905.1| Cation efflux system protein CusC precursor [Escherichia coli
           EC4100B]
          Length = 460

 Score =  196 bits (497), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 110/463 (23%), Positives = 207/463 (44%), Gaps = 18/463 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSK---NLINIDTLKWWESFN 57
           M+  + +     + L GC++ P+Y +P MP +P QFS+  +       N     W   F 
Sbjct: 1   MSPCKLLPFCVALALTGCSLAPDYQRPAMP-VPQQFSLSQNGLVNAADNYQNAGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS- 116
           D  +  L+  AL  N  +  AT ++  A+       AD +P      S  +  NLK N+ 
Sbjct: 60  DNQVKTLISEALVNNRDLRMATLKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGNTA 119

Query: 117 -----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +  
Sbjct: 120 TTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       
Sbjct: 180 YAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +    Q Q+ N      + +  G+ + ++  RPDI   E  L  + A
Sbjct: 240 NALQLLLG----SYGKLPQAQTVNSDSLQSVKLPAGLSSQILLQRPDIMEAEHALMAANA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  A
Sbjct: 296 NIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARALYQHG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
             S L++LD ER+       L         + + LY A+G G+
Sbjct: 416 AVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGW 458


>gi|94969859|ref|YP_591907.1| RND efflux system, outer membrane lipoprotein, NodT [Candidatus
           Koribacter versatilis Ellin345]
 gi|94551909|gb|ABF41833.1| RND efflux system, outer membrane lipoprotein, NodT [Candidatus
           Koribacter versatilis Ellin345]
          Length = 520

 Score =  196 bits (497), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 106/484 (21%), Positives = 206/484 (42%), Gaps = 39/484 (8%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDT------------ 49
            I   +  L +  L+ C VGP+Y KP +   P+      S                    
Sbjct: 7   KIATTLPLLAMACLSACVVGPKYHKPAVDAPPSYKEATPSAQSAQPAPGAPAPTWQPASP 66

Query: 50  ------LKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYAS 103
                  KWWE +ND  LNKL +     N ++  A      A+  +   RA  FP+   S
Sbjct: 67  NDAMLKGKWWEIYNDADLNKLEEEVNVSNQSVKAAEASFLGARALVKQARAAYFPTIGVS 126

Query: 104 ISHRFIPNLKTNSTGQLDSDWKIDLFGQRRHIESSLAN-------------LDSAYAQVD 150
            S      L  +S G++      D                              + A ++
Sbjct: 127 PSITATRQLSVDSNGKVTGGTGTDFDFPANAAWVPDIWGKVRNQVRAQASAAQMSAADLE 186

Query: 151 IAKLNVISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEA 210
             +L++  ++  +Y   R       +    +  Y+++++L+   +  G  S+ S+++ E 
Sbjct: 187 NIRLSLQVEVANNYFQLRSQDALKDLLDATVKAYQESVDLTQALYETGIDSQESVLQAET 246

Query: 211 EIKSIESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPAD 270
           ++ + ++    +        H I+ L+G PA++F       S+         I IG+P++
Sbjct: 247 QLATAQAQDTNVGILRAQYEHAIAMLIGKPASQFSLAHLPLSSE-----PPSIPIGVPSN 301

Query: 271 LIRNRPDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFG 327
           L+  RPDI   E+ +  S A IG+A +  YP+++L+G+    +    + F   + +WS G
Sbjct: 302 LLERRPDIASAERSMEQSNALIGVAVAAYYPNVTLSGTFGFRNTSIADWFTWPSHYWSVG 361

Query: 328 PKLYLPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQ 387
           P+L   IF+ G  K+ + +A++   +    +++TVL A ++VE+ L ++    + V +  
Sbjct: 362 PQLAQTIFEGGLRKATVVQAQAQYDQSVANYRQTVLTAFQQVEDNLAALRILSQEVQQQA 421

Query: 388 HAVELHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIG 447
            AV+  +K+++L++  Y+ G    L++L  +      +  L   K Q   +   L  A+G
Sbjct: 422 AAVDFAQKNLNLAIDRYKLGIDPYLNVLTAQTTLFSNQQGLVQLKLQQMNASAQLIEALG 481

Query: 448 SGYN 451
            G++
Sbjct: 482 GGWD 485


>gi|168998688|ref|YP_001687956.1| copper/silver efflux system outer membrane protein CusC [Klebsiella
           pneumoniae NTUH-K2044]
 gi|238549703|dbj|BAH66054.1| outer membrane protein [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 461

 Score =  196 bits (497), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 97/464 (20%), Positives = 209/464 (45%), Gaps = 19/464 (4%)

Query: 1   MNILRAIFSLFIVLLAGC-TVGPEYTKPHMPLLPTQFSIGN---SKNLINIDTLKWWESF 56
           M  L+ +    I +LAGC ++ PEY +P  P +P QFS+     +  + +     W   F
Sbjct: 1   MFKLKLLSISTIFILAGCVSLAPEYQRPPAP-VPQQFSLSKNSLTPAVNSYQDTGWRNFF 59

Query: 57  NDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIP------ 110
            D  +++L+  AL  N  +  A  ++  A+       AD +P   AS    +        
Sbjct: 60  VDPQVSRLIGEALTNNRDLRMAALKVEEARAQFNVTDADRYPQLNASSGITYSGGLKGDK 119

Query: 111 NLKTNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARH 169
                    L+  +++D FG+ +   E+   N  ++        + ++S +  SY   + 
Sbjct: 120 PTTQEYDAGLELSYELDFFGKLKNMSEADRQNYFASEEARRAVHILLVSSVSQSYFSQQL 179

Query: 170 FKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMN 229
             E++ IA + L  Y+++      +   G+T+ L+L +   +I+S  ++I   E      
Sbjct: 180 AYEQLRIARETLKNYEQSYAFVEQQLVTGSTNVLALEQARGQIESTRAEIAKREGDLAQA 239

Query: 230 VHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSV 289
            + +  +LG     +     ++         + +   + + ++  RPDI   E +L  + 
Sbjct: 240 NNALQLVLG----TYRALPSEKGMKGGEIAPVKLPPNLSSQILLQRPDIMEAEYQLKAAD 295

Query: 290 AKIGIAKSDLYPSLSLNGSIALTHD---NSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRR 346
           A IG A++  +PS++L   ++ +     + F   +  W+F PK+ +PIF+ G+ K+N++ 
Sbjct: 296 ANIGAARAAFFPSITLTSGLSASSTELSSLFTSGSGMWNFIPKIEIPIFNAGRNKANLKL 355

Query: 347 AESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQ 406
           AE   Q+  + +++ + +A K+V + L   +   + +   Q  ++  + ++  +   Y  
Sbjct: 356 AEIRQQQSVVNYEQKIQSAFKDVSDTLALRDSLSQQLESQQRYLDSLQITLQRARGLYAS 415

Query: 407 GRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           G  S +++LD ER+    +  +         + ++L+ A+G G+
Sbjct: 416 GAVSYIEVLDAERSLFATQQTILDLTYSRQVNEINLFTALGGGW 459


>gi|160888975|ref|ZP_02069978.1| hypothetical protein BACUNI_01395 [Bacteroides uniformis ATCC 8492]
 gi|317479262|ref|ZP_07938397.1| NodT family efflux transporter [Bacteroides sp. 4_1_36]
 gi|156861442|gb|EDO54873.1| hypothetical protein BACUNI_01395 [Bacteroides uniformis ATCC 8492]
 gi|316904550|gb|EFV26369.1| NodT family efflux transporter [Bacteroides sp. 4_1_36]
          Length = 458

 Score =  196 bits (497), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 102/460 (22%), Positives = 209/460 (45%), Gaps = 17/460 (3%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
             +  I  L +  L  C VG  Y +P M L     S+   ++ ++I   +W   + D++L
Sbjct: 4   KNIYIILLLSMFALTSCKVGKSYVRPEMALPD---SLAQQQDSMSIADEQWQAVYTDSTL 60

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF--------IPNLK 113
             L+  AL+ N  +L A  R+           A+L P     +              ++ 
Sbjct: 61  RALIDRALEYNKDMLIAASRVKEMAAQKRISVANLLPQLTGKVEAEREVENYGGHSRDVG 120

Query: 114 TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                +    W++DL+G  R    +++A    +       ++ +++++  +Y +      
Sbjct: 121 NTYEAKALLSWELDLWGNLRWKKVAAVAEYLQSVEAQRALRMTIVAEVAQAYYELVALDT 180

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + I  Q     ++ + L+ ++F  G TS+ S  + + E+    + +P LE+   +  ++
Sbjct: 181 ELEIVRQTQKAREEGVRLARIRFEGGLTSETSYQQAQVELARTATLVPDLERRISLKEND 240

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           IS L+G   T        Q  +   +L     +G+P+DL+  RPD+R  E++L    A++
Sbjct: 241 ISFLVGEFPTRIKRVNFLQELDVPESLP----VGLPSDLLERRPDVRVAEQQLRAEHARV 296

Query: 293 GIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSF-GPKLYLPIFDKGKIKSNIRRAESSA 351
            +A ++++P L+L G   L  D       + +S     +  P+F  GK ++ +   ++S 
Sbjct: 297 KVAYTNMFPRLALTGQFGLESDVLSNFLESPYSLLNGAVLAPLFGWGKNRAALNAQKASF 356

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           + +  ++++TVLNA KE +NA+   N+ K++           K  + L+ + Y  G  + 
Sbjct: 357 EAEVHSYEKTVLNAFKEAKNAIVDFNKIKEVYQLRAKLERSAKGYVDLAQLQYINGVINY 416

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +D+LD +R     ++ +S A R    + V++Y A+G G+ 
Sbjct: 417 MDVLDAQRGYFDAQIGVSNAIRDELIAMVNVYKALGGGWQ 456


>gi|46446186|ref|YP_007551.1| putative outer membrane protein, componenet of multidrug efflux
           systems [Candidatus Protochlamydia amoebophila UWE25]
 gi|46399827|emb|CAF23276.1| putative outer membrane protein, componenet of multidrug efflux
           systems [Candidatus Protochlamydia amoebophila UWE25]
          Length = 489

 Score =  196 bits (497), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 119/478 (24%), Positives = 225/478 (47%), Gaps = 42/478 (8%)

Query: 9   SLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVKIA 68
           S  ++ L+ C + P Y +P +  +P ++     +        +WWE+F+D  L KL+  +
Sbjct: 3   SCLLLALSSCVLHPPYQQPCLE-IPKKWRTPF-EETSTAANFRWWEAFDDPILKKLIFES 60

Query: 69  LQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL-------- 120
           L+ N  +  A  R    K  +  VR+  FP                 S G+         
Sbjct: 61  LENNKDLKLALARTAEFKARLGIVRSQFFPQISGVGLASRQRTPTELSGGKTSSGVSSQG 120

Query: 121 ------------------------DSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLN 155
                                   ++ +++DL+G+     E++LA+L           L+
Sbjct: 121 QPGLTPVGTNLIPSPYTNNYRVVAEAAYELDLWGRVYSSSEAALADLLGQVQARRALVLS 180

Query: 156 VISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSI 215
           ++S +  SYI  R F +++ ++ Q +   K++ EL+ L+F  G TS+L + +  AE+   
Sbjct: 181 IVSSVATSYIQMRQFDQQLIVSKQTVTSRKESYELAKLRFEGGLTSELEVKQAAAEVDEA 240

Query: 216 ESDIPTLEKSFRMNVHNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNR 275
            +++  LE       + IS L+G+   E    +++  N  +    + +  G+P++L+  R
Sbjct: 241 IAEVFRLEVLIPQQENLISILIGHSPRE----IERGLNINEWPTPLAVPAGLPSELLEQR 296

Query: 276 PDIRYQEKKLADSVAKIGIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYL 332
           PDI   E+ L  + A+IG A++  +PS+SL G          + F      W +   L  
Sbjct: 297 PDIIQAEQGLIAANARIGEARAQYFPSISLTGYFGSESLQLHHLFTSPTRAWQYAANLLQ 356

Query: 333 PIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVEL 392
           PIF  GKI S I  A++  +  Y  +Q+TVLNA KEV+NAL +  + ++++   +++V +
Sbjct: 357 PIFTGGKISSGIDVAKAQKRIAYYNYQQTVLNAFKEVDNALIAHQKSRELLEVQKNSVVV 416

Query: 393 HKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
            K  + L+ + Y  G+   L++LD ER     +++L+ A+  +  + V++Y  +G G+
Sbjct: 417 LKDYLHLAKLQYDNGQTDYLNVLDAERKLFTAQLNLAQAEADVFLTLVNVYKVLGGGW 474


>gi|270293901|ref|ZP_06200103.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|270275368|gb|EFA21228.1| conserved hypothetical protein [Bacteroides sp. D20]
          Length = 458

 Score =  196 bits (497), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 102/460 (22%), Positives = 209/460 (45%), Gaps = 17/460 (3%)

Query: 2   NILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSL 61
             +  I  L +  L  C VG  Y +P M L     S+   ++ ++I   +W   + D++L
Sbjct: 4   KNIYIILLLSMFALTSCKVGKSYVRPEMALPD---SLAQQQDSMSIADEQWQAVYTDSTL 60

Query: 62  NKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF--------IPNLK 113
             L+  AL+ N  +L A  R+           A+L P     +              ++ 
Sbjct: 61  RALIDRALEYNKDMLIAASRVKEMAAQKRISVANLLPQLTGKVEAEREVEIYGGHSRDVG 120

Query: 114 TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
                +    W++DL+G  R    +++A    +       ++ +++++  +Y +      
Sbjct: 121 NTYEAKALLSWELDLWGNLRWKKVAAVAEYLQSVEAQRALRMTIVAEVAQAYYELVALDT 180

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
            + I  Q     ++ + L+ ++F  G TS+ S  + + E+    + +P LE+   +  ++
Sbjct: 181 ELEIVRQTQKAREEGVRLARIRFEGGLTSETSYQQAQVELARTATLVPDLERRISLKEND 240

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           IS L+G   T        Q  +   +L     +G+P+DL+  RPD+R  E++L    A++
Sbjct: 241 ISFLVGEFPTRIKRVNFLQELDVPESLP----VGLPSDLLERRPDVRAAEQQLKAEHARV 296

Query: 293 GIAKSDLYPSLSLNGSIALTHDNSFPGYNTHWSF-GPKLYLPIFDKGKIKSNIRRAESSA 351
            +A ++++P L+L G   L  D       + +S     +  P+F  GK ++ +   ++S 
Sbjct: 297 KVAYTNMFPRLALTGQFGLESDVLSNFLESPYSLLNGAVLAPLFGWGKNRAALNAQKASF 356

Query: 352 QEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSL 411
           + +  ++++TVLNA KE +NA+   N+ K++           K  + L+ + Y  G  + 
Sbjct: 357 EAEVHSYEKTVLNAFKEAKNAIVDFNKIKEVYQLRAKLERSAKGYVDLAQLQYINGVINY 416

Query: 412 LDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
           +D+LD +R     ++ +S A R    + V++Y A+G G+ 
Sbjct: 417 MDVLDAQRGYFDAQIGVSNAIRDELIAMVNVYKALGGGWQ 456


>gi|188494248|ref|ZP_03001518.1| cation efflux system protein CusC [Escherichia coli 53638]
 gi|188489447|gb|EDU64550.1| cation efflux system protein CusC [Escherichia coli 53638]
          Length = 457

 Score =  196 bits (496), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 110/462 (23%), Positives = 208/462 (45%), Gaps = 18/462 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK---WWESFN 57
           M+  + +     + L GC++ P+Y +P MP +P QFS+  +  +   D  +   W   F 
Sbjct: 1   MSPCKLLPFCVALALTGCSLAPDYQRPAMP-VPQQFSLSQNGLVNAADNYQNVGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS- 116
           D  +  L+  AL  N  +  AT ++  A+       AD +P      S  +  NLK +S 
Sbjct: 60  DNQVKTLISEALVNNRDLRMATLKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGDSA 119

Query: 117 -----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +  
Sbjct: 120 TTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       
Sbjct: 180 YSQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +    Q Q+ N      + +  G+ + ++  RPDI   E  L  + A
Sbjct: 240 NALQLLLG----SYGKLPQAQTVNSDSLQSVKLPAGLSSQILLQRPDIMEAEHALMAANA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  A
Sbjct: 296 NIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARALYQHG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
             S L++LD ER+       L         + + LY A+G G
Sbjct: 416 AVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGG 457


>gi|21232112|ref|NP_638029.1| outer membrane protein [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66767760|ref|YP_242522.1| outer membrane protein [Xanthomonas campestris pv. campestris str.
           8004]
 gi|21113859|gb|AAM41953.1| outer membrane protein [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66573092|gb|AAY48502.1| outer membrane protein [Xanthomonas campestris pv. campestris str.
           8004]
          Length = 497

 Score =  196 bits (496), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 107/479 (22%), Positives = 205/479 (42%), Gaps = 29/479 (6%)

Query: 1   MNILRAIFSLFIV--LLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLIN----------ID 48
           M  +R   +   V  +L+GCT+ P Y +P  P+         +  + +          I 
Sbjct: 1   MTPIRMTLAALAVTSVLSGCTLMPRYARPDAPVPAQFAGATAAATVASEAAASAETPVIA 60

Query: 49  TLKWWESFNDTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASIS--- 105
            + W E F D +L +++++AL  N  +  A   I  A+      RA L P   A+ +   
Sbjct: 61  DIGWREVFTDPALQQVIQLALDNNRDLRVAALNIEVARAQYRVERAALVPGVDATGTANN 120

Query: 106 ---------HRFIPNLKTNSTGQLDSDWKIDLFGQRRHIESSL-ANLDSAYAQVDIAKLN 155
                        P  +T S     S +++DLFG+ R ++        S         ++
Sbjct: 121 ARTPSELAVPGQPPVFRTYSANVGVSAYELDLFGRVRSLKEQALQQFLSTAEARRSTHIS 180

Query: 156 VISKLIPSYIDARHFKERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSI 215
           +++ +  +Y+     +E + +A   L     +  L    F  G  S+L+L + +  ++S 
Sbjct: 181 LVADVATAYLTLAADQELLQLAQSTLTSQSDSYRLQQRSFELGVASQLTLRQAQTTVESA 240

Query: 216 ESDIPTLEKSFRMNVHNISTLLG-YPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRN 274
             D+         + + +  L+G       L        + + N+   +  G+P+ L++ 
Sbjct: 241 RVDVERYTAQVAQDRNALVLLVGTQLPESLLPRALPDGASVEGNVLAAVPAGVPSQLLQR 300

Query: 275 RPDIRYQEKKLADSVAKIGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLY 331
           RPDI   E+ L  + A IG A++  +PS+SL    GS + +    F      WSF P+L 
Sbjct: 301 RPDILEAERNLRAANANIGAARAAFFPSISLTATLGSSSSSLSGLFESGTRAWSFVPQLT 360

Query: 332 LPIFDKGKIKSNIRRAESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVE 391
           LP+F+ G+ ++N+  A+++   +   +++++  A +EV +AL   +   + +   Q  V+
Sbjct: 361 LPLFNAGRNRANLDMAKANRDIEVARYEKSIQTAFREVSDALAQRDTLGRQLQAQQALVD 420

Query: 392 LHKKSMSLSMINYRQGRYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
               S  LS   + +G  S L  LD +R+    +  L   +     + V  Y A+G G+
Sbjct: 421 ATADSYRLSQARFERGIDSYLQALDAQRSLYGAQQTLITTQLSRITNLVTFYKAMGGGW 479


>gi|237748467|ref|ZP_04578947.1| RND efflux system outer membrane lipoprotein [Oxalobacter
           formigenes OXCC13]
 gi|229379829|gb|EEO29920.1| RND efflux system outer membrane lipoprotein [Oxalobacter
           formigenes OXCC13]
          Length = 487

 Score =  196 bits (496), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 111/461 (24%), Positives = 212/461 (45%), Gaps = 23/461 (4%)

Query: 7   IFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTSLNKLVK 66
           I + F   L GC +GP+Y +P MP  P  +     +        +WWE F D  LN +V+
Sbjct: 10  IVAAFSASLGGCMMGPDYRRPDMPT-PQSYRFMPDQASQQALDSRWWEDFGDPVLNGMVE 68

Query: 67  IALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRF-------------IPNLK 113
            A+  N  +  A      A   I+  RA LFP   A+                  +PN +
Sbjct: 69  EAIANNRDLKAALANSEKAAAAIMQTRAGLFPQINATAQVGRERLSEMDAEPVIGVPNPQ 128

Query: 114 TNSTGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKE 172
              +  L + W+IDL+G+ RR  E++ A+  +       A L+++S ++  Y++     E
Sbjct: 129 NAKSASLGASWEIDLWGKIRRMTEAAEADAKAMEQTRRAALLSIVSNVVTQYVNLLALDE 188

Query: 173 RISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHN 232
           ++ IA      Y++++ +  L+F  G TS++++ +  ++ ++ +S IP +  +     + 
Sbjct: 189 QLKIAQNTSANYRESLRIIDLQFKYGVTSQMTVAQAASQYETAQSQIPQIRHNITQTENA 248

Query: 233 ISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKI 292
           I+ L G           ++ +         +   +P++L+  RPDI   E+ L  + A I
Sbjct: 249 INILRGRNPGAV-----ERGSTLATLKTPVVPADLPSNLLLRRPDILSAEQDLVAANAMI 303

Query: 293 GIAKSDLYPSLSLNGSIALTH---DNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAES 349
           G  ++  +P++SL G+   +     N F G +  WSF   + LPIF  G I S +++AE+
Sbjct: 304 GATRAMYFPTISLTGAFGTSSEHLRNLFKGPSKAWSFAGGISLPIFQGGSIYSQVKQAEA 363

Query: 350 SAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRY 409
             +     ++  V +A  +V+NAL+      + + K    V   K    L+ + Y +G  
Sbjct: 364 GQRAALARYEGAVQSAFADVDNALSYRQRVNEQLDKETRLVNQLKDYSRLAKLQYDEGYS 423

Query: 410 SLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
           +   +L  +++    ++ L+  +     S V +Y ++G G+
Sbjct: 424 AYSVVLQADQSLFPRQLTLAQLRASSLTSVVGVYKSMGGGW 464


>gi|161615478|ref|YP_001589443.1| hypothetical protein SPAB_03249 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161364842|gb|ABX68610.1| hypothetical protein SPAB_03249 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 496

 Score =  196 bits (496), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 101/463 (21%), Positives = 206/463 (44%), Gaps = 18/463 (3%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQ-FSIGNSKNLINIDTLKWWESFNDTSLNKL 64
                F+  LAGCT+ P++ +P  P      ++        +   + W + F+D  L +L
Sbjct: 25  LATLAFVTTLAGCTMAPKHERPASPTAMVYPYATSTVSGAPDAADIGWRDFFHDPLLQEL 84

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST------- 117
           + IAL+ N  + +A   + AA+      RA++ P+   + +          S        
Sbjct: 85  IAIALRNNRDLRKAGLNVEAARALYRIQRAEMLPTLGIATAMDASRTPADLSVMDESEIN 144

Query: 118 -----GQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
                    + W++DL+G+ R + + +LA   +       A+++++S++  +++  R  +
Sbjct: 145 RRYEAAGATTAWELDLWGRVRSLSDQALAAYMALDETYIAARMSLVSEVASAWLTLRADR 204

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
           E + +    L   K +  L+      G  ++L L   E  ++S E +     +    + +
Sbjct: 205 ELLRLTEDTLAAQKSSYTLTTQLARTGNATQLDLRMAEIALRSAEINRAAYTRQLARDRN 264

Query: 232 NISTLLGYPA-TEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
            +  LLG P   E    + +     +  +   +  G+P+DL+  RPDIR  E +L  + A
Sbjct: 265 ALELLLGQPLTPELSRRLNEAVTLTEGAIPTTLPGGLPSDLLVRRPDIRAAEYRLRGANA 324

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
           +IG A++  +P++SL GS      +    F   +  W F P++ LP+F  G +++++ RA
Sbjct: 325 RIGAARAAFFPTISLTGSAGTASASLSGLFEPGSGSWRFLPQITLPLFHGGALRADLDRA 384

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
               Q +  +++  +  A ++V + L         V   Q AVE  + +  L+ + +++G
Sbjct: 385 HVQKQIEIASYENVIQQAFRDVADGLAGQRTLNDQVQSEQRAVEASQIAYELAGLRFQEG 444

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
               L +LD  R     +  L   +     + ++LY A+G G+
Sbjct: 445 VDDYLTLLDTHRMLYGAQQRLVRTRLMQQLNIINLYKALGGGW 487


>gi|194471563|ref|ZP_03077547.1| outer membrane efflux protein OprA [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194457927|gb|EDX46766.1| outer membrane efflux protein OprA [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
          Length = 485

 Score =  196 bits (496), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 99/463 (21%), Positives = 204/463 (44%), Gaps = 18/463 (3%)

Query: 6   AIFSLFIVLLAGCTVGPEYTKPHMPLLPTQ-FSIGNSKNLINIDTLKWWESFNDTSLNKL 64
                F+  LAGCT+ P++ +P  P      ++        +   + W + F+D  L +L
Sbjct: 14  LATLAFVTTLAGCTMAPKHERPTSPTAVVYPYATSTVSGAPDAADIGWRDFFHDPLLQEL 73

Query: 65  VKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNST------- 117
           + IAL+ N  + +A   + AA+      RA++ P+   + +          S        
Sbjct: 74  IAIALRNNRDLRKAGLNVEAARALYRIQRAEMLPTLGIATAMDAGRTPADLSVTDEPEIN 133

Query: 118 -----GQLDSDWKIDLFGQRRHI-ESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
                    + W++DL+G+ R + + +LA   +       A+++++S++  +++  R  +
Sbjct: 134 RRYEMAGATTAWELDLWGRVRSLSDQALAAYMALDETYIAARMSLVSEVASAWLTLRADR 193

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
           E + +    L   K +  L+      G  ++L L   E  ++S E +     +    + +
Sbjct: 194 ELLRLTEDTLAAQKSSYTLTTQLARTGNATQLDLRMAEIALRSAEINRAAYTRQLARDRN 253

Query: 232 NISTLLGYPA-TEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
            +  LLG P   E    + +     +  +   +  G+P+DL+  RPDI   E +L  + A
Sbjct: 254 ALELLLGQPLTPELSRRLNEAVTLTEGAIPTTLPGGLPSDLLVRRPDICAAEYRLRGANA 313

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
           +IG A++  +P++SL G+      +    F   +  W F P++ LP+F  G +++++ RA
Sbjct: 314 RIGAARAAFFPTISLTGAAGTASASLSGLFEPGSGSWRFLPQITLPLFHGGALRADLDRA 373

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
               Q +   ++  +  A ++V + L         V   Q AVE  + +  L+ + +++G
Sbjct: 374 HVQKQIEIARYENVIQQAFRDVADGLAGQRTLNDQVQSEQRAVEASQIAYELAGLRFQEG 433

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGY 450
               L +LD  R     +  L   +     + ++LY A+G G+
Sbjct: 434 VDDYLTLLDTHRMLYGAQQRLVRTRLMQQLNIINLYKALGGGW 476


>gi|323963249|gb|EGB58815.1| NodT family protein efflux transporter [Escherichia coli H489]
          Length = 457

 Score =  196 bits (496), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 110/462 (23%), Positives = 208/462 (45%), Gaps = 18/462 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLK---WWESFN 57
           M+  + +     + L GC++ P+Y +P MP +P QFS+  +  +   D  +   W   F 
Sbjct: 1   MSPCKLLPFCVALALTGCSLAPDYQRPAMP-VPQQFSLSQNGLVNAADNYQNVGWRTFFV 59

Query: 58  DTSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS- 116
           D  +  L+  AL  N  +  AT ++  A+       AD +P      S  +  NLK N+ 
Sbjct: 60  DNQVKTLISEALVNNRDLRMATLKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGNTA 119

Query: 117 -----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHF 170
                +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +  
Sbjct: 120 TTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLA 179

Query: 171 KERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNV 230
             ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       
Sbjct: 180 YAKLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQAN 239

Query: 231 HNISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVA 290
           + +  LLG     +    Q Q+ N      + +  G+ + ++  RPDI   E  L  + A
Sbjct: 240 NALQLLLG----SYGKLPQAQTVNSDSLQSVKLPAGLSSQILLQRPDIMEAEHALMAANA 295

Query: 291 KIGIAKSDLYPSLSLNGSIALTHDNS---FPGYNTHWSFGPKLYLPIFDKGKIKSNIRRA 347
            IG A++  +PS+SL   I+    +    F   +  W+F PK+ +PIF+ G+ ++N+  A
Sbjct: 296 NIGAARAAFFPSISLTSGISTASSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIA 355

Query: 348 ESSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQG 407
           E   Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G
Sbjct: 356 EIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARALYQHG 415

Query: 408 RYSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSG 449
             S L++LD ER+       L         + + LY A+G G
Sbjct: 416 AVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGG 457


>gi|218703904|ref|YP_002411423.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli UMN026]
 gi|293403834|ref|ZP_06647828.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli FVEC1412]
 gi|298379611|ref|ZP_06989216.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli FVEC1302]
 gi|218431001|emb|CAR11877.1| copper/silver efflux system, outer membrane component [Escherichia
           coli UMN026]
 gi|291428420|gb|EFF01445.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli FVEC1412]
 gi|298279309|gb|EFI20817.1| copper/silver efflux system outer membrane protein CusC
           [Escherichia coli FVEC1302]
          Length = 462

 Score =  196 bits (496), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 106/463 (22%), Positives = 202/463 (43%), Gaps = 16/463 (3%)

Query: 1   MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQF--SIGNSKNLINIDTLKWWESFND 58
           M+  + +     + L GC++ P+Y +P MP+         G      N     W   F D
Sbjct: 3   MSPCKLLPFCVALALTGCSLAPDYQRPAMPVPQQFSLNQNGLVNAADNYQNAGWRTFFVD 62

Query: 59  TSLNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNS-- 116
             +  L+  AL  N  +  AT ++  A+       AD +P      S  +  NLK +S  
Sbjct: 63  NQVKTLISEALVNNRDLRMATLKVQEARAQYRLTDADRYPQLNGEGSGSWSGNLKGDSAT 122

Query: 117 ----TGQLDSDWKIDLFGQ-RRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFK 171
               +  L++ + +D FG+ +   E+   N  +         + ++S +  SY + +   
Sbjct: 123 TREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHILLVSNVAQSYFNQQLAY 182

Query: 172 ERISIAHQILDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVH 231
            ++ IA + L  Y+++      +   G+++ L+L +    I+S  SDI   +       +
Sbjct: 183 AQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIESTRSDIAKRQGELAQANN 242

Query: 232 NISTLLGYPATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAK 291
            +  LLG     +    Q Q+ N      + +  G+ + ++  RPDI   E  L  + A 
Sbjct: 243 ALQLLLG----SYGKLPQAQTVNSHSLQSVKLPAGLSSQILLQRPDIMEAEHALMAANAN 298

Query: 292 IGIAKSDLYPSLSLN---GSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAE 348
           IG A++  +PS+SL     + +    + F   +  W+F PK+ +PIF+ G+ ++N+  AE
Sbjct: 299 IGAARAAFFPSISLTSGISTTSSDLSSLFNASSGMWNFIPKIEIPIFNAGRNQANLDIAE 358

Query: 349 SSAQEQYITWQETVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGR 408
              Q+  + +++ + NA KEV +AL         ++  Q  +   + ++  +   Y+ G 
Sbjct: 359 IRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLASLQITLQRARALYQHGA 418

Query: 409 YSLLDILDIERATAKVEVDLSIAKRQLAKSYVDLYIAIGSGYN 451
            S L++LD ER+       L         + + LY A+G G+ 
Sbjct: 419 VSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGGWQ 461


>gi|163851944|ref|YP_001639987.1| RND efflux system outer membrane lipoprotein [Methylobacterium
           extorquens PA1]
 gi|163663549|gb|ABY30916.1| RND efflux system, outer membrane lipoprotein, NodT family
           [Methylobacterium extorquens PA1]
          Length = 532

 Score =  196 bits (496), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 98/473 (20%), Positives = 209/473 (44%), Gaps = 29/473 (6%)

Query: 3   ILRAIFSLFIVLL-AGCTVGPEYTKPHMPL----------------LPTQFSIGNSKNLI 45
           + R      +  L +GC VGP+Y++P +                  +  Q