RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780931|ref|YP_003065344.1| hypothetical protein CLIBASIA_04150 [Candidatus Liberibacter asiaticus str. psy62] (56 letters) >gnl|CDD|118092 pfam09556, RE_HaeIII, HaeIII restriction endonuclease. This family includes the HaeIII (recognizes and cleaves GG^CC) restriction endonuclease. Length = 300 Score = 33.7 bits (77), Expect = 0.013 Identities = 12/45 (26%), Positives = 27/45 (60%) Query: 4 PCNKEYFKTISTVFGKLGDMRAQNIFLKDIKDKDIIFYLHILIAF 48 P ++ YF I+ +F +L +++ + ++I +K+ Y+ +L AF Sbjct: 134 PSSQNYFDEINPLFEELEELKKEGELWRNISNKEERIYVPLLKAF 178 >gnl|CDD|178764 PLN03225, PLN03225, Serine/threonine-protein kinase SNT7; Provisional. Length = 566 Score = 24.8 bits (54), Expect = 5.3 Identities = 10/34 (29%), Positives = 18/34 (52%), Gaps = 4/34 (11%) Query: 11 KTISTVFGK----LGDMRAQNIFLKDIKDKDIIF 40 K I T+ + L + + I +D+K ++IIF Sbjct: 255 KIIQTIMRQILFALDGLHSTGIVHRDVKPQNIIF 288 >gnl|CDD|129885 TIGR00803, nst, UDP-galactose transporter. NSTs generally appear to function by antiport mechanisms, exchanging a nucleotide-sugar for a nucleotide. Thus, CMP-sialic acid is exchanged for CMP; GDP-mannose is preferentially exchanged for GMP, and UDP-galactose and UDP-N-acetylglucosamine are exchanged for UMP (or possibly UDP). Other nucleotide sugars (e.g., GDP-fucose, UDP-xylose, UDP-glucose, UDP-N-acetylgalactosamine, etc.) may also be transported in exchange for various nucleotides, but their transporters have not been molecularly characterized. Each compound appears to be translocated by its own transport protein. Transport allows the compound, synthesized in the cytoplasm, to be exported to the lumen of the Golgi apparatus or the endoplasmic reticulum where it is used for the synthesis of glycoproteins and glycolipids. Length = 222 Score = 24.2 bits (53), Expect = 8.4 Identities = 7/18 (38%), Positives = 10/18 (55%) Query: 28 IFLKDIKDKDIIFYLHIL 45 F K +KD D +F+ L Sbjct: 103 YFEKILKDGDTMFWSRNL 120 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.331 0.150 0.447 Gapped Lambda K H 0.267 0.0707 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 932,082 Number of extensions: 43063 Number of successful extensions: 97 Number of sequences better than 10.0: 1 Number of HSP's gapped: 97 Number of HSP's successfully gapped: 8 Length of query: 56 Length of database: 5,994,473 Length adjustment: 28 Effective length of query: 28 Effective length of database: 5,389,449 Effective search space: 150904572 Effective search space used: 150904572 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.1 bits)