RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780932|ref|YP_003065345.1| hypothetical protein CLIBASIA_04155 [Candidatus Liberibacter asiaticus str. psy62] (236 letters) >gnl|CDD|33620 COG3827, COG3827, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 231 Score = 95.1 bits (236), Expect = 2e-20 Identities = 75/237 (31%), Positives = 115/237 (48%), Gaps = 19/237 (8%) Query: 12 MEEIVNSIRRILENNDQEFSTSNNVQTQVPARDEGVIEKEDFVQEDKMSNHLFADQNSHL 71 MEEI+ SIRRI+E++D + PA E E D+ + A ++ + Sbjct: 1 MEEILASIRRIIEDSDFSRQLDED-----PASGEAAFAAEPVAPPDRKPQAVAA-RSPAV 54 Query: 72 KKYGVEYPKKETMSLSDVAARVRAEARGDARIIADA-------------PSPIANSILPS 118 E + +L++VAARVRA DA A P+ I + + Sbjct: 55 DARMNEQSPSQAPTLAEVAARVRAAIARDAAPGPAAVAQAQNPDEKKNEPASIEDIVKEI 114 Query: 119 TDALEENAVMDKPLNEGLSPSSDLGMQAEESMYSPDLVDKCKGEEEALVSSDVGDQVASS 178 + + A K +P+S+ ++ E++ + K A++S G QVA + Sbjct: 115 SGVIAPKARPPKNAAGENAPASEDRPESTEAVTQSEEATAIKSAPAAILSEAAGRQVADA 174 Query: 179 FDQLVKALRESESRSLDQLSLDVLRPMLREWLDDNLPGIVERLVREEIERIARGPIR 235 F L A S RSL++++ ++LRPML++WLD NLP +VERLVREEIER+ RG R Sbjct: 175 FGDLSLAFNSSSRRSLEEMAAEMLRPMLQDWLDKNLPTLVERLVREEIERVVRGSKR 231 >gnl|CDD|30898 COG0552, FtsY, Signal recognition particle GTPase [Intracellular trafficking and secretion]. Length = 340 Score = 31.4 bits (71), Expect = 0.20 Identities = 17/66 (25%), Positives = 35/66 (53%), Gaps = 3/66 (4%) Query: 163 EEALVSSDVGDQVASSFDQLVKALRESESRSLDQLSLDVLRPMLREWLDDNLPGIVERLV 222 EE L+ +DVG + A +++++ LR+ E + + ++ LRE L + L + + + Sbjct: 73 EELLIEADVGVETA---EEIIEELRKREGKKKKIKDEETVKEALREALIEILRPVDKVDL 129 Query: 223 REEIER 228 EI + Sbjct: 130 PLEIPK 135 >gnl|CDD|32040 COG1855, COG1855, ATPase (PilT family) [General function prediction only]. Length = 604 Score = 28.7 bits (64), Expect = 1.6 Identities = 19/72 (26%), Positives = 25/72 (34%), Gaps = 12/72 (16%) Query: 14 EIVNSIRRILENNDQEFSTSNNVQTQV------------PARDEGVIEKEDFVQEDKMSN 61 EI IR + TS+ VQ V P + + E+F E+ MS Sbjct: 94 EIDAMIREVALEYGATLVTSDRVQRDVARAKGIEVEYLEPVEEPEEVRIEEFFDEETMSV 153 Query: 62 HLFADQNSHLKK 73 HL KK Sbjct: 154 HLKEGVPPMAKK 165 >gnl|CDD|34143 COG4465, CodY, Pleiotropic transcriptional repressor [Transcription]. Length = 261 Score = 27.9 bits (62), Expect = 2.3 Identities = 31/114 (27%), Positives = 53/114 (46%), Gaps = 13/114 (11%) Query: 89 VAARVRAEARGDARIIAD-APSPIANSILPS-TDALEENAVMDKPLNEGLSPSSDLGMQA 146 + R+ + D I+ + A + + IL + +EE A + +S S ++A Sbjct: 131 ILWRLDDKFTDDDLILVEYAATVVGMQILREKLEEIEEEARKRTVVQMAISTLSYSELEA 190 Query: 147 EESMYSPDLVDKCKGEEEALVSSDVGDQVASSFDQLVKALR--ES----ESRSL 194 E ++ ++ G E LV+S + D+V + +V ALR ES ESRSL Sbjct: 191 VEHIF-----EELDGNEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSL 239 >gnl|CDD|31620 COG1431, COG1431, Uncharacterized protein containing piwi/argonaute domain [Translation, ribosomal structure and biogenesis]. Length = 685 Score = 27.3 bits (60), Expect = 4.2 Identities = 11/61 (18%), Positives = 27/61 (44%) Query: 166 LVSSDVGDQVASSFDQLVKALRESESRSLDQLSLDVLRPMLREWLDDNLPGIVERLVREE 225 + S++ ++ S+ ++V + S L + R + D+L I++ + EE Sbjct: 349 VTDSELLTRLKSTIKKVVYGFKNSNGIDWKVEGLTLHVAGKRPKMKDDLTKIIKEIDVEE 408 Query: 226 I 226 + Sbjct: 409 L 409 >gnl|CDD|33784 COG4025, COG4025, Predicted membrane protein [Function unknown]. Length = 284 Score = 26.5 bits (58), Expect = 6.3 Identities = 9/18 (50%), Positives = 13/18 (72%) Query: 213 NLPGIVERLVREEIERIA 230 NLP IV +L++E +R A Sbjct: 23 NLPWIVVKLLKEGPKRSA 40 >gnl|CDD|145066 pfam01717, Meth_synt_2, Cobalamin-independent synthase, Catalytic domain. This is a family of vitamin-B12 independent methionine synthases or 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferases, EC:2.1.1.14 from bacteria and plants. Plants are the only higher eukaryotes that have the required enzymes for methionine synthesis. This enzyme catalyses the last step in the production of methionine by transferring a methyl group from 5-methyltetrahydrofolate to homocysteine. The aligned region makes up the carboxy region of the approximately 750 amino acid protein except in some hypothetical archaeal proteins present in the family, where this region corresponds to the entire length. This domain contains the catalytic residues of the enzyme. Length = 324 Score = 26.6 bits (59), Expect = 6.3 Identities = 7/20 (35%), Positives = 12/20 (60%) Query: 10 PSMEEIVNSIRRILENNDQE 29 PS+EEI I++ L+ + Sbjct: 274 PSVEEIKALIKKALDIVPAD 293 >gnl|CDD|36461 KOG1247, KOG1247, KOG1247, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 567 Score = 26.1 bits (57), Expect = 9.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Query: 197 LSLDVLRPMLREWLDDNLPG 216 LSLD L P L EWL L Sbjct: 202 LSLDKLEPRLEEWLRRTLVE 221 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.310 0.128 0.344 Gapped Lambda K H 0.267 0.0779 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,681,067 Number of extensions: 133235 Number of successful extensions: 369 Number of sequences better than 10.0: 1 Number of HSP's gapped: 365 Number of HSP's successfully gapped: 20 Length of query: 236 Length of database: 6,263,737 Length adjustment: 91 Effective length of query: 145 Effective length of database: 4,297,318 Effective search space: 623111110 Effective search space used: 623111110 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) S2: 56 (25.3 bits)