RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780932|ref|YP_003065345.1| hypothetical protein CLIBASIA_04155 [Candidatus Liberibacter asiaticus str. psy62] (236 letters) >gnl|CDD|151187 pfam10691, DUF2497, Protein of unknown function (DUF2497). Members of this family belong to the Alphaproteobacteria. The function of the family is not known. Length = 72 Score = 86.9 bits (216), Expect = 4e-18 Identities = 39/72 (54%), Positives = 56/72 (77%), Gaps = 2/72 (2%) Query: 163 EEALVSSDVGDQVASSFDQLVKALRES--ESRSLDQLSLDVLRPMLREWLDDNLPGIVER 220 ++AL+S + + VA++F +L +A+R S R+L+ L ++LRPML+EWLD+NLP +VER Sbjct: 1 DDALISEETAEAVAAAFGKLARAIRISRSGGRTLEDLVREMLRPMLKEWLDNNLPALVER 60 Query: 221 LVREEIERIARG 232 LVREEIERIAR Sbjct: 61 LVREEIERIARK 72 >gnl|CDD|184311 PRK13764, PRK13764, ATPase; Provisional. Length = 602 Score = 31.7 bits (73), Expect = 0.15 Identities = 19/68 (27%), Positives = 29/68 (42%), Gaps = 12/68 (17%) Query: 7 VSEPSMEEIVNSIRRILENNDQEFSTSNNVQTQVPARDEGV----IEK-------EDFVQ 55 + EI IR + + TS+ VQ +V AR +G+ ++ E F Sbjct: 83 IKLAKGGEIDALIREVAKELGATLVTSDRVQAEV-ARAKGIDVIYLKPEREPLEIEKFFD 141 Query: 56 EDKMSNHL 63 E+ MS HL Sbjct: 142 EETMSVHL 149 >gnl|CDD|171521 PRK12467, PRK12467, peptide synthase; Provisional. Length = 3956 Score = 30.5 bits (69), Expect = 0.39 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 4/65 (6%) Query: 173 DQVASSFDQLVKALRESESRSLDQLSL---DVLRPMLREWLDDNLPGIVERLVREEIER- 228 +++A SFD+L++A+ + + L +L R +L W ERLV + IE Sbjct: 3045 ERLAESFDRLLQAMLNNPAARLGELPTLAAHERRQVLHAWNATAAAYPSERLVHQLIEAQ 3104 Query: 229 IARGP 233 +AR P Sbjct: 3105 VARTP 3109 >gnl|CDD|182441 PRK10416, PRK10416, signal recognition particle-docking protein FtsY; Provisional. Length = 318 Score = 29.3 bits (67), Expect = 0.87 Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 6/47 (12%) Query: 163 EEALVSSDVGDQVASSFDQLVKALRESESRSLDQL-SLDVLRPMLRE 208 EE L+ +DVG + +++++ LR E L + L+ +L+E Sbjct: 53 EELLIEADVGVETT---EEIIEELR--ERVKRKNLKDPEELKELLKE 94 >gnl|CDD|172366 PRK13839, PRK13839, conjugal transfer protein TrbG; Provisional. Length = 277 Score = 27.5 bits (61), Expect = 3.0 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Query: 69 SHLKKY----GVEYPKKETMSLSDVAARVRAEARGDARIIAD 106 SH +Y G EYP+ + L+D+ AR+ A A + A+ Sbjct: 146 SHPTQYMARVGFEYPEDVSTKLADINARLEASTIPGAGVPAE 187 >gnl|CDD|131834 TIGR02787, codY_Gpos, GTP-sensing transcriptional pleiotropic repressor CodY. This model represents the full length of CodY, a pleiotropic repressor in Bacillus subtilis and other Firmicutes (low-GC Gram-positive bacteria) that responds to intracellular levels of GTP and branched chain amino acids. The C-terminal helix-turn-helix DNA-binding region is modeled by pfam08222 in Pfam. Length = 251 Score = 26.6 bits (59), Expect = 5.5 Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 6/40 (15%) Query: 161 GEEEALVSSDVGDQVASSFDQLVKALR--ES----ESRSL 194 G E LV+S + D+V + +V ALR ES ESRSL Sbjct: 194 GNEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSL 233 >gnl|CDD|183122 PRK11410, PRK11410, hypothetical protein; Provisional. Length = 561 Score = 26.6 bits (59), Expect = 5.7 Identities = 11/26 (42%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Query: 190 ESRSLDQLSLDVLR-PMLREWLDDNL 214 +S SL QL D+L P+LR+ L ++ Sbjct: 61 DSDSLSQLPKDLLTVPLLRDVLTEDF 86 >gnl|CDD|117067 pfam08490, DUF1744, Domain of unknown function (DUF1744). This domain is found on the epsilon catalytic subunit of DNA polymerase. It is found C terminal to pfam03104 and pfam00136. Length = 396 Score = 26.5 bits (59), Expect = 6.3 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 15/79 (18%) Query: 154 DLVDKCKGEEEALVSSDVGDQVASSFDQLVKALRESESRSLDQLS---LDVLRPMLREWL 210 L+++ +G + A +S D+ + D A+ E+ D S L VL+ M++EW Sbjct: 222 ALINEAEGADLAGISFDM------APDASGGAVNENSGYDEDAFSSAALRVLKSMVKEWW 275 Query: 211 DDNLPG------IVERLVR 223 DD L G +V+ L R Sbjct: 276 DDALSGNITADSLVQHLYR 294 >gnl|CDD|163148 TIGR03135, malonate_mdcG, holo-ACP synthase, malonate decarboxylase-specific. Malonate decarboxylase, like citrate lyase, has a unique acyl carrier protein subunit with a prosthetic group derived from, and distinct from, coenzyme A. Members of this protein family are the phosphoribosyl-dephospho-CoA transferase specific to the malonate decarboxylase system. This enzyme can also be designated holo-ACP synthase (2.7.7.61). The corresponding component of the citrate lyase system, CitX, shows little or no sequence similarity to this family. Length = 202 Score = 26.5 bits (59), Expect = 7.0 Identities = 11/39 (28%), Positives = 16/39 (41%) Query: 194 LDQLSLDVLRPMLREWLDDNLPGIVERLVREEIERIARG 232 L L L +P WL P +V R + ++A G Sbjct: 14 LASLPLPAAQPAWAAWLAAGRPLVVRRAAPADAGQVALG 52 >gnl|CDD|172020 PRK13384, PRK13384, delta-aminolevulinic acid dehydratase; Provisional. Length = 322 Score = 25.9 bits (57), Expect = 9.3 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 14/64 (21%) Query: 186 LRESES-RSL---DQLSL-DVLRPM-LREWLDD-----NLPGIV---ERLVREEIERIAR 231 LR SE+ R L ++SL D++ P+ + E + D LPGI E + +EIER+ Sbjct: 13 LRRSEAMRDLVRETEVSLSDLIYPIFIEEHITDAVPISTLPGISRLPESALADEIERLYA 72 Query: 232 GPIR 235 IR Sbjct: 73 LGIR 76 >gnl|CDD|184034 PRK13405, bchH, magnesium chelatase subunit H; Provisional. Length = 1209 Score = 25.8 bits (57), Expect = 9.3 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Query: 14 EIVNSIR-RILENNDQEFSTSNNVQTQVPARD 44 E V+++R IL N + T NV +VPA D Sbjct: 485 ESVDALREAILGGNAARYGTPANVHARVPADD 516 >gnl|CDD|181005 PRK07503, PRK07503, methionine gamma-lyase; Provisional. Length = 403 Score = 25.9 bits (57), Expect = 9.8 Identities = 9/30 (30%), Positives = 13/30 (43%) Query: 77 EYPKKETMSLSDVAARVRAEARGDARIIAD 106 E P M L D+AA A+++ D Sbjct: 157 ETPANPNMRLVDIAAVAEIAHGAGAKVVVD 186 >gnl|CDD|150567 pfam09909, DUF2138, Uncharacterized protein conserved in bacteria (DUF2138). This domain, found in various hypothetical prokaryotic proteins, has no known function. Length = 552 Score = 25.9 bits (57), Expect = 10.0 Identities = 12/22 (54%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Query: 190 ESRSLDQLSLDVLR-PMLREWL 210 +S SL QL D+LR P+LR+ L Sbjct: 52 DSDSLSQLPKDLLRVPLLRDVL 73 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.310 0.128 0.344 Gapped Lambda K H 0.267 0.0734 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,844,248 Number of extensions: 244508 Number of successful extensions: 520 Number of sequences better than 10.0: 1 Number of HSP's gapped: 519 Number of HSP's successfully gapped: 30 Length of query: 236 Length of database: 5,994,473 Length adjustment: 90 Effective length of query: 146 Effective length of database: 4,049,753 Effective search space: 591263938 Effective search space used: 591263938 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) S2: 56 (25.3 bits)