>cd00418 GlxRS_core Glutamyl-tRNA synthetase(GluRS)/Glutaminyl-tRNA synthetase (GlnRS) cataytic core domain. These enzymes attach Glu or Gln, respectively, to the appropriate tRNA. Like other class I tRNA synthetases, they aminoacylate the 2'-OH of the nucleotide at the 3' end of the tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. These enzymes function as monomers. Archaea, cellular organelles, and some bacteria lack GlnRS. In these cases, the "non-descriminating" form of GluRS aminoacylates both tRNA(Glu) and tRNA(Gln) with Glu, which is converted to Gln when appropriate by a transamidation enzyme. The descriminating form of GluRS differs from GlnRS and the non-descriminating form of GluRS in their C-terminal anti-codon binding domains.

Probab=97.34 E-value=0.0013 Score=44.73 Aligned_cols=83 Identities=30% Similarity=0.430 Sum_probs=55.3 Q ss_pred CCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCHHHCCHHHHHHHHHHHHHH Q ss_conf 44999986543788967799999876708983567788154540899999999767459987777989999999999999 Q gi|254780933|r 45 PPNVTGSLHMGHAFNTTIQDIMIRFERMRGKNVLWQPGTDHAGIATQITVESRLFAQSSLTREDIGRDAFIEKVWEWKKE 124 (947) Q Consensus 45 pP~~nG~lHiGH~~~~t~~Di~~Ry~rm~G~~Vl~~~G~D~~GlPiE~~vek~l~~~~~~~~~~~g~~~f~~~~~~~~~~ 124 (947) T Consensus 7 APsPtG~LHiG~ar~al~n~~~Ak~--~~G~~~LRieDTD~--------------------------~-------r~~~e 51 (223) T cd00418 7 APSPTGYLHIGHARAALLNYLYAKK--YGGKFILRFDDTDP--------------------------E-------REVEE 51 (223) T ss_pred CCCCCCCCCHHHHHHHHHHHHHHHH--HCCEEEEEECCCCC--------------------------C-------CCHHH T ss_conf 8898985428999999999999998--59989997236886--------------------------4-------01888 Q ss_pred HHHHHHHHHHHHCCEEECCC-CEECCC--HHHHHHHHHHHHHHHHCC Q ss_conf 99999999998083664279-811588--679999999999999889 Q gi|254780933|r 125 SGGSILSQLKRLGASCDWSR-ERFTMD--EGMSNAVRNAFVVLYKDG 168 (947) Q Consensus 125 ~~~~~~~~~~~lG~~~Dw~r-~y~T~d--~~y~~~v~~~F~~L~~~g 168 (947) T Consensus 52 ~~~~I~~dL~wLGl--~~d~~~~~QS~r~~~y~~~----~~~Li~~G 92 (223) T cd00418 52 AEDSILEDLKWLGI--KWDEGPYYQSDRFDIYYEY----AEKLIEEG 92 (223) T ss_pred HHHHHHHHHHHHCC--CCCCCEEEHHHHHHHHHHH----HHHHHHCC T ss_conf 99999999999189--9998685387589999999----99997569

HHsearch alignment for GI: 254780933 and conserved domain: cd00418