RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780934|ref|YP_003065347.1| hypothetical protein CLIBASIA_04165 [Candidatus Liberibacter asiaticus str. psy62] (374 letters) >gnl|CDD|29222 cd00198, vWFA, Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of fold. The vWA domain, since its discovery, has drawn great interest because of its widespread occurrence and its involvement in a wide variety of important cellular functions. These include basal membrane formation, cell migration, cell differentiation, adhesion, haemostasis, signaling, chromosomal stability, malignant transformation and in immune defenses In integrins these domains form heterodimers while in vWF it forms multimers. There are different interaction surfaces of this domain as seen by the various molecules it complexes with. Ligand binding in most cases is mediated by the presence of a metal ion dependent adhesion site termed as the MIDAS motif that is a characteristic feature of most, if not all A domains.. Length = 161 Score = 64.5 bits (156), Expect = 4e-11 Identities = 45/175 (25%), Positives = 69/175 (39%), Gaps = 23/175 (13%) Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231 D++ +LDVS SM K+D A +++ A++ + P + V GLVTF + Sbjct: 1 ADIVFLLDVSGSMGG------EKLDKAKEALKALVSSLSASPPGDRV---GLVTFGSNAR 51 Query: 232 EFFLLEWGVSH--LQRKIKYLSK-FGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288 L L I L K G TN L+ A + + N + Sbjct: 52 VVLPLTTDTDKADLLEAIDALKKGLGGGTNIGAALRLALELLKS---------AKRPNAR 102 Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPN 343 ++I+ +TDGE E E +K G VY IGI + + L+ A Sbjct: 103 RVIILLTDGEPNDGPELLAEAA--RELRKLGITVYTIGIGDDANEDELKEIADKT 155 >gnl|CDD|143873 pfam00092, VWA, von Willebrand factor type A domain. Length = 177 Score = 63.6 bits (155), Expect = 9e-11 Identities = 47/199 (23%), Positives = 81/199 (40%), Gaps = 32/199 (16%) Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232 D++ +LD S S+ + + I ++E + + PD V GLV +S+ + Sbjct: 1 DIVFLLDGSGSI------GEANFEKVKEFIKKLVENLDIGPDGTRV---GLVQYSSDVTT 51 Query: 233 FFLL----EWG--VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDAN 286 F L +S + R I YL TN+ LKYA +F G R N Sbjct: 52 EFSLNDYKSKDDLLSAVLRNIYYLGG---GTNTGKALKYALENLFRSAGSRP-------N 101 Query: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNS-- 344 K+++ +TDG++ + +K G IV+ +G+ + E LR AS Sbjct: 102 APKVVILLTDGKSNDGGLVPAAAA--ALRRKVGIIVFGVGVGDV-DEEELRLIASEPCSE 158 Query: 345 --FYLVENPHSMYDAFSHI 361 + V + ++ D + Sbjct: 159 GHVFYVTDFDALSDIQEEL 177 >gnl|CDD|29223 cd01450, vWFA_subfamily_ECM, Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of fold. The vWA domain, since its discovery, has drawn great interest because of its widespread occurrence and its involvement in a wide variety of important cellular functions. These include basal membrane formation, cell migration, cell differentiation, adhesion, haemostasis, signaling, chromosomal stability, malignant transformation and in immune defenses In integrins these domains form heterodimers while in vWF it forms multimers. There are different interaction surfaces of this domain as seen by the various molecules it complexes with. Ligand binding in most cases is mediated by the presence of a metal ion dependent adhesion site termed as the MIDAS motif that is a characteristic feature of most, if not all A domains . Length = 161 Score = 52.7 bits (126), Expect = 2e-07 Identities = 41/180 (22%), Positives = 76/180 (42%), Gaps = 22/180 (12%) Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231 LD++ +LD S S+ + I ++E++ + PD V GLV +S+ + Sbjct: 1 LDIVFLLDGSESV------GPENFEKVKDFIEKLVEKLDIGPDKTRV---GLVQYSDDVR 51 Query: 232 EFFLL--EWGVSHLQRKIKYLSKF-GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288 F L L + +K L G TN+ L+YA Q+F R+ N Sbjct: 52 VEFSLNDYKSKDDLLKAVKNLKYLGGGGTNTGKALQYALEQLFSESNARE-------NVP 104 Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLV 348 K+I+ +TDG + + +++ + K G V+ +G+ E + P+ ++ Sbjct: 105 KVIIVLTDGRSDDGGDPKEAA---AKLKDEGIKVFVVGVGPADEEELREIASCPSERHVF 161 >gnl|CDD|29244 cd01471, vWA_micronemal_protein, Micronemal proteins: The Toxoplasma lytic cycle begins when the parasite actively invades a target cell. In association with invasion, T. gondii sequentially discharges three sets of secretory organelles beginning with the micronemes, which contain adhesive proteins involved in parasite attachment to a host cell. Deployed as protein complexes, several micronemal proteins possess vertebrate-derived adhesive sequences that function in binding receptors. The VWA domain likely mediates the protein-protein interactions of these with their interacting partners.. Length = 186 Score = 49.1 bits (117), Expect = 2e-06 Identities = 43/189 (22%), Positives = 79/189 (41%), Gaps = 31/189 (16%) Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231 LD+ +++D S S+ + + ++ ++ + + PD N+ LVTFS + Sbjct: 1 LDLYLLVDGSGSI-----GYSNWVTHVVPFLHTFVQNLNISPDEINL---YLVTFSTNAK 52 Query: 232 EFFLLEWGVS-------HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED 284 E L S + R + L STN+T L +FD +G R++ Sbjct: 53 ELIRLSSPNSTNKDLALNAIRALLSLYYPNGSTNTTSALLVVEKHLFDTRGNRENAP--- 109 Query: 285 ANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACA---- 340 ++++ MTDG ++L + ++RG I+ +G+ +HE R+ Sbjct: 110 ----QLVIIMTDGI---PDSKFRTLKEARKLRERGVIIAVLGVGQGVNHEENRSLVGCDP 162 Query: 341 --SPNSFYL 347 SP YL Sbjct: 163 DDSPCPLYL 171 >gnl|CDD|29229 cd01456, vWA_ywmD_type, VWA ywmD type:Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of fold. The vWA domain, since its discovery, has drawn great interest because of its widespread occurrence and its involvement in a wide variety of important cellular functions. These include basal membrane formation, cell migration, cell differentiation, adhesion, haemostasis, signaling, chromosomal stability, malignant transformation and in immune defenses In integrins these domains form heterodimers while in vWF it forms multimers. There are different interaction surfaces of this domain as seen by the various molecules it complexes with. Ligand binding in most cases is mediated by the presence of a metal ion dependent adhesion site termed as the MIDAS motif that is a characteristic feature of most, if not all A domains. Not much is known about the function of the members of this subgroup. All members of this subgroup however have a conserved MIDAS motif. . Length = 206 Score = 43.9 bits (103), Expect = 8e-05 Identities = 38/185 (20%), Positives = 65/185 (35%), Gaps = 19/185 (10%) Query: 154 IVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIP 213 + P + V ++ ++ IVLD S SM T++D A +++ +P Sbjct: 3 LGSPAFALEPVETEPQLPPNVAIVLDNSGSMREVDGGGETRLDNAKAALDETAN---ALP 59 Query: 214 DVNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDM 273 D + GL TFS + L+ V + + G + L A N + Sbjct: 60 DGTRL---GLWTFSGDGDN--PLDVRVLVPKGCLTA-PVNGFPSAQRSALDAALNSLQTP 113 Query: 274 QG---MRQHCNTEDANYKK----IIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIG 326 G + A ++V +TDGE+ + + E KR I Sbjct: 114 TGWTPLAAALAEAAAYVDPGRVNVVVLITDGEDTCGPDPCEVA---RELAKRRTPAPPIK 170 Query: 327 IRVIR 331 + VI Sbjct: 171 VNVID 175 >gnl|CDD|29249 cd01476, VWA_integrin_invertebrates, VWA_integrin (invertebrates): Integrins are a family of cell surface receptors that have diverse functions in cell-cell and cell-extracellular matrix interactions. Because of their involvement in many biologically important adhesion processes, integrins are conserved across a wide range of multicellular animals. Integrins from invertebrates have been identified from six phyla. There are no data to date to suggest any immunological functions for the invertebrate integrins. The members of this sub-group have the conserved MIDAS motif that is charateristic of this domain suggesting the involvement of the integrins in the recognition and binding of multi-ligands.. Length = 163 Score = 43.7 bits (103), Expect = 8e-05 Identities = 30/130 (23%), Positives = 54/130 (41%), Gaps = 21/130 (16%) Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231 LD++ VLD S S+ F+ K I ++E +++ P V L+T+S + Sbjct: 1 LDLLFVLDSSGSVRGKFEKY-------KKYIERIVEGLEIGPTATRV---ALITYSGRGR 50 Query: 232 EFFLLEWGVS----HLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287 + L K+ L G +T + ++ A Q+ +G R+ Sbjct: 51 QRVRFNLPKHNDGEELLEKVDNLRFIGGTTATGAAIEVALQQLDPSEGRRE-------GI 103 Query: 288 KKIIVFMTDG 297 K++V +TDG Sbjct: 104 PKVVVVLTDG 113 >gnl|CDD|29242 cd01469, vWA_integrins_alpha_subunit, Integrins are a class of adhesion receptors that link the extracellular matrix to the cytoskeleton and cooperate with growth factor receptors to promote celll survival, cell cycle progression and cell migration. Integrins consist of an alpha and a beta sub-unit. Each sub-unit has a large extracellular portion, a single transmembrane segment and a short cytoplasmic domain. The N-terminal domains of the alpha and beta subunits associate to form the integrin headpiece, which contains the ligand binding site, whereas the C-terminal segments traverse the plasma membrane and mediate interaction with the cytoskeleton and with signalling proteins.The VWA domains present in the alpha subunits of integrins seem to be a chordate specific radiation of the gene family being found only in vertebrates. They mediate protein-protein interactions.. Length = 177 Score = 40.2 bits (94), Expect = 9e-04 Identities = 36/159 (22%), Positives = 71/159 (44%), Gaps = 22/159 (13%) Query: 172 LDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231 +D++ VLD S S+ ++ +++++ + P GLV +S Sbjct: 1 MDIVFVLDGSGSIYP------DDFQKVKNFLSTVMKKLDIGPTKTQF---GLVQYSESFR 51 Query: 232 -EFFLLEW-GVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQ-GMRQHCNTEDANYK 288 EF L E+ +K++S+ TN+ ++Y ++F G R+ + Sbjct: 52 TEFTLNEYRTKEEPLSLVKHISQLLGLTNTATAIQYVVTELFSESNGARK-------DAT 104 Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGI 327 K++V +TDGE+ + + +A++ G I YAIG+ Sbjct: 105 KVLVVITDGESHDDPLLKDVI---PQAEREGIIRYAIGV 140 >gnl|CDD|29245 cd01472, vWA_collagen, von Willebrand factor (vWF) type A domain; equivalent to the I-domain of integrins. This domain has a variety of functions including: intermolecular adhesion, cell migration, signalling, transcription, and DNA repair. In integrins these domains form heterodimers while in vWF it forms homodimers and multimers. There are different interaction surfaces of this domain as seen by its complexes with collagen with either integrin or human vWFA. In integrins collagen binding occurs via the metal ion-dependent adhesion site (MIDAS) and involves three surface loops located on the upper surface of the molecule. In human vWFA, collagen binding is thought to occur on the bottom of the molecule and does not involve the vestigial MIDAS motif.. Length = 164 Score = 40.2 bits (94), Expect = 0.001 Identities = 39/178 (21%), Positives = 73/178 (41%), Gaps = 26/178 (14%) Query: 173 DMMIVLDVSRSM-ESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIE 231 D++ ++D S S+ S F+ + ++ ++ + V+ G+V +S+ Sbjct: 2 DIVFLVDGSESIGLSNFNLVKDFVKRVVERLD----------IGPDGVRVGVVQYSDDPR 51 Query: 232 -EFFLLEWG-VSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF-DMQGMRQHCNTEDANYK 288 EF+L + + +K L G TN+ LKY +F + G R+ Sbjct: 52 TEFYLNTYRSKDDVLEAVKNLRYIGGGTNTGKALKYVRENLFTEASGSRE-------GVP 104 Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFY 346 K++V +TDG K E K+ G V+A+G++ E + + P Y Sbjct: 105 KVLVVITDG-----KSQDDVEEPAVELKQAGIEVFAVGVKNADEEELKQIASDPKELY 157 >gnl|CDD|37564 KOG2353, KOG2353, KOG2353, L-type voltage-dependent Ca2+ channel, alpha2/delta subunit [Inorganic ion transport and metabolism, Signal transduction mechanisms]. Length = 1104 Score = 37.6 bits (87), Expect = 0.006 Identities = 47/215 (21%), Positives = 88/215 (40%), Gaps = 43/215 (20%) Query: 142 CTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKS 201 C WY + +S K D++I+LDVS SM ++D+A ++ Sbjct: 212 CRNRSWYIQA-------ATSPK---------DIVILLDVSGSMSGL------RLDLAKQT 249 Query: 202 INAMLEEVKLIPDVNNVVQSGLVTFSNK----IEEFF--LLEWGVSHLQ---RKIKYLSK 252 +N +L+ + VN ++TF+++ F L++ + + + I+ L Sbjct: 250 VNEILDTLSDNDFVN------ILTFNSEVNPVSPCFNGTLVQATMRNKKVFKEAIETLDA 303 Query: 253 FGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYC 312 G+ N T L+YA++ + D R + I++ TDG + + KE + + Sbjct: 304 KGI-ANYTAALEYAFSLLRDYNDSR-ANTQRSPCNQAIMLI-TDGVDENAKEIFEKYNWP 360 Query: 313 NEAKKRGAIVYAIGIRVI-RSHEFLRACASPNSFY 346 + KK + IG V ACA+ + Sbjct: 361 D--KKVRVFTFLIGDEVYDLDEIQWMACANKGYYV 393 >gnl|CDD|29234 cd01461, vWA_interalpha_trypsin_inhibitor, vWA_interalpha trypsin inhibitor (ITI): ITI is a glycoprotein composed of three polypeptides- two heavy chains and one light chain (bikunin). Bikunin confers the protease-inhibitor function while the heavy chains are involved in rendering stability to the extracellular matrix by binding to hyaluronic acid. The heavy chains carry the VWA domain with a conserved MIDAS motif. Although the exact role of the VWA domains remains unknown, it has been speculated to be involved in mediating protein-protein interactions with the components of the extracellular matrix.. Length = 171 Score = 37.5 bits (87), Expect = 0.006 Identities = 33/175 (18%), Positives = 66/175 (37%), Gaps = 30/175 (17%) Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232 +++ V+D S SM TKI+ +++ L+ D+ ++ FS+ +EE Sbjct: 4 EVVFVIDTSGSMSG------TKIEQTKEALLTALK------DLPPGDYFNIIGFSDTVEE 51 Query: 233 FF--LLEWGVSHLQRKIKYLSKFGVS--TNSTPGLKYAYNQIFDMQGMRQHCNTEDANYK 288 F + ++ I+Y+++ TN L+ A + G Sbjct: 52 FSPSSVSATAENVAAAIEYVNRLQALGGTNMNDALEAALELLNSSPGSVP---------- 101 Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPN 343 I+ +TDGE + + +++ EA ++ GI + L A Sbjct: 102 -QIILLTDGEVTNESQILKNV---REALSGRIRLFTFGIGSDVNTYLLERLAREG 152 >gnl|CDD|34568 COG4961, TadG, Flp pilus assembly protein TadG [Intracellular trafficking and secretion]. Length = 185 Score = 37.4 bits (86), Expect = 0.007 Identities = 26/174 (14%), Positives = 51/174 (29%), Gaps = 20/174 (11%) Query: 8 IRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67 +R F + +G + A+ P + L++ I+E F K L + D + AA + + Sbjct: 12 LRRFRRDRRGAAAVEFALVAPPLLLLVFGIVEFGIAFLAKQSLQNAAD-AAARAAARGLT 70 Query: 68 EGNGNNRKKLKGGDILCRIKNTWNMSF---RNELRDNGFVN---DIDDIVRSTSLDIVVV 121 + +F ++ G V ++ D + V Sbjct: 71 TDAADLDTIQAAATAFLN-AIAPANAFLTVQSNTPSRGTVTVTANVADATLFDTSQFTVT 129 Query: 122 PQNEGYSISAISRYKIPLKFCTFIPWYTNS-------RHIVMPITSSVKVNSQT 168 I+ +P T I + T+ V+V Sbjct: 130 SAVTVS-INLARGL----VLVAVVPDLTGPGTSGSRSATIPVGATTLVRVRIDE 178 >gnl|CDD|34274 COG4655, COG4655, Predicted membrane protein [Function unknown]. Length = 565 Score = 35.4 bits (81), Expect = 0.027 Identities = 10/52 (19%), Positives = 29/52 (55%) Query: 16 KGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMN 67 + + +LTA+F+P+ L + ++ +++ + L + D + + AA+ + + Sbjct: 9 RSMVGVLTALFVPLALATLLLGVDYGYLYLEQRELQRVADLAAIAAASNLDD 60 >gnl|CDD|29237 cd01464, vWA_subfamily, VWA subfamily: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of fold. The vWA domain, since its discovery, has drawn great interest because of its widespread occurrence and its involvement in a wide variety of important cellular functions. These include basal membrane formation, cell migration, cell differentiation, adhesion, haemostasis, signaling, chromosomal stability, malignant transformation and in immune defenses In integrins these domains form heterodimers while in vWF it forms multimers. There are different interaction surfaces of this domain as seen by the various molecules it complexes with. Ligand binding in most cases is mediated by the presence of a metal ion dependent adhesion site termed as the MIDAS motif that is a characteristic feature of most, if not all A domains. Members of this subgroup have no assigned function. This subfamily is typified by the presence of a conserved MIDAS motif.. Length = 176 Score = 35.2 bits (81), Expect = 0.031 Identities = 29/174 (16%), Positives = 60/174 (34%), Gaps = 18/174 (10%) Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229 RL + ++LD S SM I ++ + + E++ P V+ ++TF + Sbjct: 2 RRLPIYLLLDTSGSMAG---EPIEALNQG---LQMLQSELRQDPYALESVEISVITFDSA 55 Query: 230 IEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTED--ANY 287 L + L+ G ++ + A D R D ++ Sbjct: 56 ARVIVPL---TPLESFQPPRLTASGGTS-----MGAALELALDCIDRRVQRYRADQKGDW 107 Query: 288 KKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACAS 341 + + +TDGE T + ++ EA+ + A + + L+ Sbjct: 108 RPWVFLLTDGE--PTDDLTAAIERIKEARDSKGRIVACAVGPKADLDTLKQITE 159 >gnl|CDD|29247 cd01474, vWA_ATR, ATR (Anthrax Toxin Receptor): Anthrax toxin is a key virulence factor for Bacillus anthracis, the causative agent of anthrax. ATR is the cellular receptor for the anthrax protective antigen and facilitates entry of the toxin into cells. The VWA domain in ATR contains the toxin binding site and mediates interaction with protective antigen. The binding is mediated by divalent cations that binds to the MIDAS motif. These proteins are a family of vertebrate ECM receptors expressed by endothelial cells.. Length = 185 Score = 34.9 bits (80), Expect = 0.038 Identities = 35/156 (22%), Positives = 64/156 (41%), Gaps = 13/156 (8%) Query: 215 VNNVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKYLSKF--GVSTNSTPGLKYAYNQIFD 272 + ++ +TFS + + L S + + ++ L K T GL+ A QIF+ Sbjct: 36 NSPGLRFSFITFSTRATKILPLTDDSSAIIKGLEVLKKVTPSGQTYIHEGLENANEQIFN 95 Query: 273 MQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRS 332 G + +I+ +TDG+ L + + ++K GAIVY +G+ Sbjct: 96 RNGGGRETV-------SVIIALTDGQLLL-NGHKYPEHEAKLSRKLGAIVYCVGVTDFLK 147 Query: 333 HEFLRACASPNSFYLVENPHSMYDAFSHIGKDIVTK 368 + + S + V S + A S I + +V K Sbjct: 148 SQLINIADSKEYVFPVT---SGFQALSGIIESVVKK 180 >gnl|CDD|31907 COG1721, COG1721, Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) [General function prediction only]. Length = 416 Score = 34.4 bits (78), Expect = 0.048 Identities = 25/105 (23%), Positives = 42/105 (40%), Gaps = 6/105 (5%) Query: 167 QTDARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTF 226 + + +++VLD SRSM F +K + A+ A L L N + GL+ F Sbjct: 220 EEERGRTVVLVLDASRSM-LFGSGVASKFEEAV-RAAASLAYAAL----KNGDRVGLLIF 273 Query: 227 SNKIEEFFLLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIF 271 ++ G HL R +K L+ + T ++ F Sbjct: 274 GGGGPKWIPPSRGRRHLARILKALALLRPAPEETDYIRRVSKLDF 318 >gnl|CDD|112854 pfam04056, Ssl1, Ssl1-like. Ssl1-like proteins are 40kDa subunits of the Transcription factor II H complex. Length = 250 Score = 34.3 bits (79), Expect = 0.059 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 4/59 (6%) Query: 174 MMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232 + IVLD SR+ME D ++ IK + +EE D N + Q GL+T + Sbjct: 55 LYIVLDCSRAMEE-KDLRPSRFACTIKYLETFVEE---FFDQNPISQIGLITCKDGRAH 109 >gnl|CDD|29240 cd01467, vWA_BatA_type, VWA BatA type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of fold. The vWA domain, since its discovery, has drawn great interest because of its widespread occurrence and its involvement in a wide variety of important cellular functions. These include basal membrane formation, cell migration, cell differentiation, adhesion, haemostasis, signaling, chromosomal stability, malignant transformation and in immune defenses. In integrins these domains form heterodimers while in vWF it forms multimers. There are different interaction surfaces of this domain as seen by the various molecules it complexes with. Ligand binding in most cases is mediated by the presence of a metal ion dependent adhesion site termed as the MIDAS motif that is a characteristic feature of most, if not all A domains. Members of this subgroup are bacterial in origin. They are typified by the presence of a MIDAS motif.. Length = 180 Score = 33.7 bits (77), Expect = 0.090 Identities = 34/159 (21%), Positives = 70/159 (44%), Gaps = 26/159 (16%) Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232 D+MI LDVS SM + ++++ A + ++ ++ + N+ + GLV F+ Sbjct: 4 DIMIALDVSGSMLAQDFVKPSRLEAAKEVLSDFIDRRE-----NDRI--GLVVFAG--AA 54 Query: 233 FFLLEWGVSH-LQRKIKYLSKFGVSTNSTP---GLKYAYNQIFDMQGMRQHCNTEDANYK 288 F + +++ K G++ T + A ++ + + + Sbjct: 55 FTQAPLTLDRESLKELLEDIKIGLAGQGTAIGDAIGLAIKRLKNSEAK-----------E 103 Query: 289 KIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGI 327 ++IV +TDGEN + + D + AK +G +Y IG+ Sbjct: 104 RVIVLLTDGENNAGEIDPATA--AELAKNKGVRIYTIGV 140 >gnl|CDD|31433 COG1240, ChlD, Mg-chelatase subunit ChlD [Coenzyme metabolism]. Length = 261 Score = 33.0 bits (75), Expect = 0.14 Identities = 29/163 (17%), Positives = 63/163 (38%), Gaps = 24/163 (14%) Query: 170 ARLDMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNK 229 A ++ V+D S SM + ++ A + ++L + + ++ F Sbjct: 77 AGNLIVFVVDASGSMAAR-----RRMAAAKGAALSLLRDA-----YQRRDKVAVIAFRG- 125 Query: 230 IEEFFLLEWGVSHLQRKIKYLSKF--GVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANY 287 E+ LL S ++ + L + G T L+ AY ++ + R + Sbjct: 126 -EKAELLLPPTSSVELAERALERLPTGGKTPLADALRQAY-EVLAREKRR------GPDR 177 Query: 288 KKIIVFMTDGE-NLSTKED--QQSLYYCNEAKKRGAIVYAIGI 327 + ++V +TDG N+ ++L ++ + RG + I Sbjct: 178 RPVMVVITDGRANVPIPLGPKAETLEAASKLRLRGIQLLVIDT 220 >gnl|CDD|36473 KOG1259, KOG1259, KOG1259, Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms, Cytoskeleton]. Length = 490 Score = 30.4 bits (68), Expect = 0.92 Identities = 21/89 (23%), Positives = 40/89 (44%), Gaps = 4/89 (4%) Query: 192 ITKIDMAIKSINAMLEEVKLIPDVN--NVVQSGLVTFSNKIEEFFLLEWGVSHLQRKIKY 249 +T++D++ I + E VKL P + + Q+ + T N E L +S + Sbjct: 286 LTELDLSGNLITQIDESVKLAPKLRRLILSQNRIRTVQNLAELPQLQLLDLSG--NLLAE 343 Query: 250 LSKFGVSTNSTPGLKYAYNQIFDMQGMRQ 278 + + + LK A N+I + G+R+ Sbjct: 344 CVGWHLKLGNIKTLKLAQNKIETLSGLRK 372 >gnl|CDD|38018 KOG2807, KOG2807, KOG2807, RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription, Replication, recombination and repair]. Length = 378 Score = 30.3 bits (68), Expect = 1.0 Identities = 15/59 (25%), Positives = 28/59 (47%), Gaps = 4/59 (6%) Query: 174 MMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232 + IV+D SR+ME D ++ IK + + E D N + Q G+++ + + Sbjct: 63 LYIVIDCSRAMEE-KDFRPSRFANVIKYLEGFVPEFF---DQNPISQIGIISIKDGKAD 117 >gnl|CDD|29226 cd01453, vWA_transcription_factor_IIH_type, Transcription factors IIH type: TFIIH is a multiprotein complex that is one of the five general transcription factors that binds RNA polymerase II holoenzyme. Orthologues of these genes are found in all completed eukaryotic genomes and all these proteins contain a VWA domain. The p44 subunit of TFIIH functions as a DNA helicase in RNA polymerase II transcription initiation and DNA repair, and its transcriptional activity is dependent on its C-terminal Zn-binding domains. The function of the vWA domain is unclear, but may be involved in complex assembly. The MIDAS motif is not conserved in this sub-group.. Length = 183 Score = 30.2 bits (68), Expect = 1.0 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 4/59 (6%) Query: 174 MMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232 ++IV+D SRSME D +++ + +K + +EE D N + Q G+++ N E Sbjct: 6 LIIVIDCSRSMEE-QDLKPSRLAVVLKLLELFIEEFF---DQNPISQLGIISIKNGRAE 60 >gnl|CDD|39803 KOG4603, KOG4603, KOG4603, TBP-1 interacting protein [Signal transduction mechanisms]. Length = 201 Score = 29.3 bits (65), Expect = 1.7 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 5/59 (8%) Query: 272 DMQGMRQHCNTEDANYKKIIVFMTDGENLSTKEDQQSLY-----YCNEAKKRGAIVYAI 325 +MQ Q E A Y++ + + G N T ED++ +Y YC E +KR + I Sbjct: 120 EMQEEIQELKKEVAGYRERLKNIKAGTNHVTPEDKEQVYREYQKYCKEWRKRKRMFREI 178 >gnl|CDD|29236 cd01463, vWA_VGCC_like, VWA Voltage gated Calcium channel like: Voltage-gated calcium channels are a complex of five proteins: alpha 1, beta 1, gamma, alpha 2 and delta. The alpha 2 and delta subunits result from proteolytic processing of a single gene product and carries at its N-terminus the VWA and cache domains, The alpha 2 delta gene family has orthologues in D. melanogaster and C. elegans but none have been detected in aither A. thaliana or yeast. The exact biochemical function of the VWA domain is not known but the alpha 2 delta complex has been shown to regulate various functional properties of the channel complex.. Length = 190 Score = 28.7 bits (64), Expect = 2.7 Identities = 28/141 (19%), Positives = 60/141 (42%), Gaps = 24/141 (17%) Query: 173 DMMIVLDVSRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232 D++I+LDVS SM ++ +A ++++++L+ + N ++TFSN++ Sbjct: 15 DIVILLDVSGSMTGQ------RLHLAKQTVSSILDTLSDNDFFN------IITFSNEVNP 62 Query: 233 FF---------LLEWGVSHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTE 283 L+ + L G+ N T L++A++ + + Sbjct: 63 VVPCFNDTLVQATTSNKKVLKEALDMLEAKGI-ANYTKALEFAFSLLLKNLQSN--HSGS 119 Query: 284 DANYKKIIVFMTDGENLSTKE 304 + + I+ +TDG + KE Sbjct: 120 RSQCNQAIMLITDGVPENYKE 140 >gnl|CDD|144764 pfam01285, TEA, TEA/ATTS domain family. Length = 423 Score = 28.2 bits (63), Expect = 3.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Query: 342 PNSFYLVENPHSMYDAFSHIGKDIVTK 368 SFY EN S Y+++ ++ K TK Sbjct: 301 SCSFYGYENGQSQYESYENMTKPCSTK 327 >gnl|CDD|146122 pfam03325, Herpes_PAP, Herpesvirus polymerase accessory protein. The same proteins are also known as polymerase processivity factors. Length = 268 Score = 28.3 bits (63), Expect = 3.8 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 6/52 (11%) Query: 299 NLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVEN 350 N+ K QQ+L C K + +RV+ HE +S N + VEN Sbjct: 105 NVQLKNLQQALSNCAVTK------LSCTLRVVTDHETKLYVSSKNGLFTVEN 150 >gnl|CDD|36107 KOG0889, KOG0889, KOG0889, Histone acetyltransferase SAGA, TRRAP/TRA1 component, PI-3 kinase superfamily [Signal transduction mechanisms, Chromatin structure and dynamics, Replication, recombination and repair, Cell cycle control, cell division, chromosome partitioning]. Length = 3550 Score = 27.2 bits (60), Expect = 7.2 Identities = 25/132 (18%), Positives = 48/132 (36%), Gaps = 13/132 (9%) Query: 133 SRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDVSRS-MESFFDSS 191 + L FI + IV+ + ++ Q +AR + LD+ + + + Sbjct: 1724 IKQSAYLVIAHFIERFQIPPKIVLQVFVALLKTYQPEARAIVKQALDILTPALPARMELG 1783 Query: 192 ITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGVSH--LQRKIKY 249 +KI + +K I ++EE I + +V Q I L + + + Sbjct: 1784 DSKIPIWVKKI--IVEEGHSISQLLHVYQL--------IVRHSDLFYSSRVRFVTPLVNS 1833 Query: 250 LSKFGVSTNSTP 261 L + G NS Sbjct: 1834 LPRLGSMPNSNS 1845 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.137 0.403 Gapped Lambda K H 0.267 0.0580 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 4,489,598 Number of extensions: 237510 Number of successful extensions: 681 Number of sequences better than 10.0: 1 Number of HSP's gapped: 671 Number of HSP's successfully gapped: 42 Length of query: 374 Length of database: 6,263,737 Length adjustment: 95 Effective length of query: 279 Effective length of database: 4,210,882 Effective search space: 1174836078 Effective search space used: 1174836078 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 58 (26.4 bits)