HHsearch alignment for GI: 254780935 and conserved domain: pfam03330

>pfam03330 DPBB_1 Rare lipoprotein A (RlpA)-like double-psi beta-barrel. Rare lipoprotein A (RlpA) contains a conserved region that has the double-psi beta-barrel (DPBB) fold. The function of RlpA is not well understood, but it has been shown to act as a prc mutant suppressor in Escherichia coli. The DPBB fold is often an enzymatic domain. The members of this family are quite diverse, and if catalytic this family may contain several different functions. Another example of this domain is found in the N terminus of pollen allergen.
Probab=99.48  E-value=1.7e-14  Score=108.31  Aligned_cols=74  Identities=41%  Similarity=0.606  Sum_probs=64.4

Q ss_pred             EEEEEEEECCCCCCCCCCCCCEECCCCCEEECCCCCCCCEEEEEECCCCCEEEEEECCCCCCCCCEEEECCHHHHHHHCC
Q ss_conf             67998885684168706588722461010203668998489999889985799996688888696187758899987097
Q gi|254780935|r   88 AVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRV  167 (276)
Q Consensus        88 ~~G~ASwYg~~f~G~~TAnGE~~~~~~lTAAH~tLPl~s~VrVTNl~nGrsvvVrVNDRGPf~~gRiIDLS~~AA~~Lg~  167 (276)
T Consensus         2 aags~s~y~~g-----~aCG~cy~v~c~~aa-----~~~~c~~-----~~sV~V~v~D~cp~~~~~~~DLS~~Af~~ia~   66 (76)
T pfam03330         2 AAGSASLYNDG-----TACGECYQVKCLTAA-----FPTYCRV-----TRSVTVTITDRCPFPPRRHFDLSGPAFEALAK   66 (76)
T ss_pred             CCCCHHHHCCC-----CCCCCCEEEEECCCC-----CCCCCCC-----CCEEEEEEEECCCCCCCCEEEECHHHHHHHCC
T ss_conf             44598681485-----333353999956899-----8876689-----98599999737899999887838999997457


Q ss_pred             CCCCEEEEE
Q ss_conf             325818999
Q gi|254780935|r  168 EERGVSKVH  176 (276)
Q Consensus       168 ~~~Gva~V~  176 (276)
T Consensus        67 ~~~G~i~V~   75 (76)
T pfam03330        67 PRAGIVPVE   75 (76)
T ss_pred             CCCCEEEEE
T ss_conf             478688747