BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780935|ref|YP_003065348.1| rare lipoprotein A [Candidatus
Liberibacter asiaticus str. psy62]
         (276 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780935|ref|YP_003065348.1| rare lipoprotein A [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040612|gb|ACT57408.1| rare lipoprotein A [Candidatus Liberibacter asiaticus str. psy62]
          Length = 276

 Score =  571 bits (1472), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 276/276 (100%), Positives = 276/276 (100%)

Query: 1   MKRFSCDCLLKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPR 60
           MKRFSCDCLLKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPR
Sbjct: 1   MKRFSCDCLLKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPR 60

Query: 61  GGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHP 120
           GGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHP
Sbjct: 61  GGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHP 120

Query: 121 TLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           TLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL
Sbjct: 121 TLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180

Query: 181 GMALLNGMDQEYLRSTVMVNSATVLPLGCQYREEIVVIPYLLTRSRTVHLNNCDDDSLQK 240
           GMALLNGMDQEYLRSTVMVNSATVLPLGCQYREEIVVIPYLLTRSRTVHLNNCDDDSLQK
Sbjct: 181 GMALLNGMDQEYLRSTVMVNSATVLPLGCQYREEIVVIPYLLTRSRTVHLNNCDDDSLQK 240

Query: 241 QREISLRERKKSNLIPLPNGYSPPRKMGKIPIPSRF 276
           QREISLRERKKSNLIPLPNGYSPPRKMGKIPIPSRF
Sbjct: 241 QREISLRERKKSNLIPLPNGYSPPRKMGKIPIPSRF 276


>gi|315122348|ref|YP_004062837.1| rare lipoprotein A [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495750|gb|ADR52349.1| rare lipoprotein A [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 315

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 188/261 (72%), Positives = 213/261 (81%), Gaps = 8/261 (3%)

Query: 1   MKRFSCDCLLKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPR 60
           M RFS     +  ++ +  LGMSSCFFSS    +  EYFPES YGV+ASDRIV GKRVPR
Sbjct: 1   MARFSFSFFWRMGIISITSLGMSSCFFSSDSIKNNYEYFPESKYGVSASDRIVFGKRVPR 60

Query: 61  GGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHP 120
           GGGRY LGKPYQI GR Y+PRQY +YAA+GMASWYGKAFHGRLTANGE+YGTEYITAAHP
Sbjct: 61  GGGRYLLGKPYQIKGRQYIPRQYISYAAIGMASWYGKAFHGRLTANGEIYGTEYITAAHP 120

Query: 121 TLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           TLPLPSYVRVTN+ENGISLVVRVNDRGPYH NRLIDLSNAAAKIL +EERG++KVHV+YL
Sbjct: 121 TLPLPSYVRVTNLENGISLVVRVNDRGPYHDNRLIDLSNAAAKILHIEERGIAKVHVQYL 180

Query: 181 GMALLNGMDQEYLRSTVMVNSAT---VLPLGCQYREEIVVIPYLLTRSRTVHLNNCDDDS 237
           GMA L+G DQ YL+S  M+ S T    LPLGCQY EEIV IPYLLTR +TV L+NCDD+S
Sbjct: 181 GMASLSGTDQGYLKS--MIGSYTQKMSLPLGCQYVEEIVKIPYLLTRRQTVSLSNCDDNS 238

Query: 238 LQKQREISLRERKKSNLIPLP 258
           L++Q +ISL    K   IP+P
Sbjct: 239 LRRQNDISL---GKKTAIPIP 256


>gi|150396512|ref|YP_001326979.1| rare lipoprotein A [Sinorhizobium medicae WSM419]
 gi|150028027|gb|ABR60144.1| rare lipoprotein A [Sinorhizobium medicae WSM419]
          Length = 346

 Score =  217 bits (553), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 134/186 (72%), Gaps = 6/186 (3%)

Query: 14  VVCVVVLGMSSCFFSSTYKDDK---LEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKP 70
           ++C V   ++SC  +S+ K  K    EYF ES+YGV AS R+ +G  +P+GGGRY +GKP
Sbjct: 21  LLCAV---LASCGSTSSVKKTKPRSKEYFAESVYGVKASPRVATGNNIPKGGGRYQVGKP 77

Query: 71  YQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRV 130
           YQ+ GRWY P++   Y   GMASWYG AFHGRLTANGEVY T +++AAHPT PLPSY RV
Sbjct: 78  YQVKGRWYKPKEDFGYNKSGMASWYGSAFHGRLTANGEVYDTNHLSAAHPTFPLPSYARV 137

Query: 131 TNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQ 190
           TN ENG S+VVRVNDRGPY   R+ID+S+  A +L ++ +G +KV V+Y+G A L G D 
Sbjct: 138 TNTENGTSVVVRVNDRGPYEYGRIIDVSSKTADLLDIKRKGSAKVRVQYIGRAPLEGNDM 197

Query: 191 EYLRST 196
            YL ++
Sbjct: 198 PYLMAS 203


>gi|241204718|ref|YP_002975814.1| rare lipoprotein A [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240858608|gb|ACS56275.1| rare lipoprotein A [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 364

 Score =  215 bits (548), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 97/184 (52%), Positives = 128/184 (69%)

Query: 13  SVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQ 72
           S +C  V    +       K    EYF ES YGV AS R+ +G  +P+GGGRY +G PY+
Sbjct: 20  SAMCATVAACGTTQAVPKKKSHGKEYFSESEYGVKASPRVATGNNIPKGGGRYIVGNPYE 79

Query: 73  IMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTN 132
           + G+WY P++  AY  VG+ASWYG AFHGRLTANGEVY   +++AAHPT PLPSY RVTN
Sbjct: 80  VKGKWYYPKEDFAYNKVGVASWYGSAFHGRLTANGEVYDQMHLSAAHPTFPLPSYARVTN 139

Query: 133 MENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEY 192
           +E+G S++VRVNDRGPYH+ R+IDLSN  A +L ++  G  KV V+Y+G A ++G D  Y
Sbjct: 140 LESGSSVIVRVNDRGPYHAGRIIDLSNKTADMLDLQHSGTGKVRVQYVGRARMDGHDMPY 199

Query: 193 LRST 196
           L ++
Sbjct: 200 LMAS 203


>gi|116252225|ref|YP_768063.1| outer membrane protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115256873|emb|CAK07967.1| putative outer membrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 368

 Score =  214 bits (546), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 97/184 (52%), Positives = 127/184 (69%)

Query: 13  SVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQ 72
           S +C  V    +       K    EYF ES YGV AS R+ +G  +P+GGGRY +G PY+
Sbjct: 20  SAMCATVAACGTTQAVPKKKAHGKEYFSESEYGVKASPRVATGNNIPKGGGRYIVGNPYE 79

Query: 73  IMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTN 132
           + G+WY P++  AY  VG+ASWYG AFHGRLTANGEVY   +++AAHPT PLPSY RVTN
Sbjct: 80  VKGKWYYPKEDFAYNKVGVASWYGSAFHGRLTANGEVYDQMHLSAAHPTFPLPSYARVTN 139

Query: 133 MENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEY 192
           +E+G S++VRVNDRGPYH  R+IDLSN  A +L ++  G  KV V+Y+G A ++G D  Y
Sbjct: 140 LESGSSVIVRVNDRGPYHEGRIIDLSNKTADMLDLQHSGTGKVRVQYVGRARMDGHDMPY 199

Query: 193 LRST 196
           L ++
Sbjct: 200 LMAS 203


>gi|209549401|ref|YP_002281318.1| lipoprotein A [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209535157|gb|ACI55092.1| rare lipoprotein A [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 364

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 128/187 (68%)

Query: 10  LKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGK 69
           L  S +C  V    +       K    EYF ES YGV AS R+ +G  +P+GGGRY +G 
Sbjct: 17  LAVSAMCATVAACGTTQAVPKKKAHGKEYFSESEYGVKASPRVATGNNIPKGGGRYIVGN 76

Query: 70  PYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           PY++ G+WY P++  AY  VG+ASWYG AFHGRLTANGEVY   +++AAHPT PLPSY R
Sbjct: 77  PYEVKGKWYYPKEDFAYNKVGVASWYGSAFHGRLTANGEVYDQMHLSAAHPTFPLPSYAR 136

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN+E+G S++VRVNDRGPYH  R+IDLSN  A +L ++  G  KV V+Y+G A ++G D
Sbjct: 137 VTNLESGSSVIVRVNDRGPYHEGRIIDLSNKTADMLDLQHSGTGKVRVQYVGRARMDGHD 196

Query: 190 QEYLRST 196
             YL ++
Sbjct: 197 MPYLMAS 203


>gi|190891839|ref|YP_001978381.1| rare lipoprotein A precursor protein [Rhizobium etli CIAT 652]
 gi|190697118|gb|ACE91203.1| rare lipoprotein A precursor protein [Rhizobium etli CIAT 652]
          Length = 368

 Score =  213 bits (543), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 97/184 (52%), Positives = 126/184 (68%)

Query: 13  SVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQ 72
           S +C  V    +       K    EYF ES YGV AS R+ +G  +P+GGGRY +G PY 
Sbjct: 20  SAMCATVAACGTTQAVPKKKAHGKEYFSESEYGVKASPRVATGNNIPKGGGRYMVGNPYV 79

Query: 73  IMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTN 132
           + G+WY P++  +Y  VG+ASWYG AFHGRLTANGEVY   +++AAHPT PLPSY RVTN
Sbjct: 80  VKGKWYYPKEDFSYNKVGIASWYGSAFHGRLTANGEVYDQMHLSAAHPTFPLPSYARVTN 139

Query: 133 MENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEY 192
           +ENG S++VRVNDRGPYH  R+IDLSN  A +L ++  G  KV V+Y+G A ++G D  Y
Sbjct: 140 VENGSSIIVRVNDRGPYHEGRIIDLSNKTADMLDLQHSGTGKVRVQYVGQARMDGHDMPY 199

Query: 193 LRST 196
           L ++
Sbjct: 200 LMAS 203


>gi|307312734|ref|ZP_07592365.1| rare lipoprotein A [Sinorhizobium meliloti BL225C]
 gi|307317218|ref|ZP_07596659.1| rare lipoprotein A [Sinorhizobium meliloti AK83]
 gi|306897306|gb|EFN28051.1| rare lipoprotein A [Sinorhizobium meliloti AK83]
 gi|306899459|gb|EFN30091.1| rare lipoprotein A [Sinorhizobium meliloti BL225C]
          Length = 346

 Score =  213 bits (542), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 127/183 (69%)

Query: 14  VVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQI 73
           ++C V+    S       K    EYF ES+YGV AS R+ +G  +P+GGGRY +GKPYQ+
Sbjct: 21  LLCAVLAACGSTSSVKKTKSRSKEYFAESVYGVKASPRVATGNNIPKGGGRYQVGKPYQV 80

Query: 74  MGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNM 133
            GRWY P++   Y   GMASWYG AFHGRLTANGEVY   +++AAHPT PLPSY RVTN+
Sbjct: 81  KGRWYQPKEDFGYNKSGMASWYGSAFHGRLTANGEVYDKHHLSAAHPTFPLPSYARVTNL 140

Query: 134 ENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYL 193
           ENG S++VRVNDRGPY   R+ID+S+  A +L ++ +G + V V+Y+G A L G D  YL
Sbjct: 141 ENGTSVIVRVNDRGPYEYGRIIDVSSKTADLLDIKRKGSANVRVQYVGRAPLEGNDMPYL 200

Query: 194 RST 196
            ++
Sbjct: 201 MAS 203


>gi|15965359|ref|NP_385712.1| putative rare lipoprotein A precursor [Sinorhizobium meliloti 1021]
 gi|15074539|emb|CAC46185.1| Putative rare lipoprotein A precursor [Sinorhizobium meliloti 1021]
          Length = 346

 Score =  213 bits (542), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 127/183 (69%)

Query: 14  VVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQI 73
           ++C V+    S       K    EYF ES+YGV AS R+ +G  +P+GGGRY +GKPYQ+
Sbjct: 21  LLCAVLAACGSTSSVKKTKSRSKEYFAESVYGVKASPRVATGNNIPKGGGRYQVGKPYQV 80

Query: 74  MGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNM 133
            GRWY P++   Y   GMASWYG AFHGRLTANGEVY   +++AAHPT PLPSY RVTN+
Sbjct: 81  KGRWYQPKEDFGYNKSGMASWYGSAFHGRLTANGEVYDKHHLSAAHPTFPLPSYARVTNL 140

Query: 134 ENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYL 193
           ENG S++VRVNDRGPY   R+ID+S+  A +L ++ +G + V V+Y+G A L G D  YL
Sbjct: 141 ENGTSVIVRVNDRGPYEYGRIIDVSSKTADLLDIKRKGSANVRVQYVGRAPLEGNDMPYL 200

Query: 194 RST 196
            ++
Sbjct: 201 MAS 203


>gi|222086015|ref|YP_002544547.1| rare lipoprotein A precursor protein [Agrobacterium radiobacter
           K84]
 gi|221723463|gb|ACM26619.1| rare lipoprotein A precursor protein [Agrobacterium radiobacter
           K84]
          Length = 395

 Score =  213 bits (542), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 128/184 (69%)

Query: 13  SVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQ 72
           S++C  V    +    +T +    EYF E  YGV AS R+V+   VP+GGGR+ +G PYQ
Sbjct: 27  SLMCATVTACGTSQQVATKRQHGKEYFSEKEYGVKASPRVVANGPVPKGGGRFLVGNPYQ 86

Query: 73  IMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTN 132
           + G+WY P++  AY   G+ASWYG AFHGRLTANGEVY  + +TAAHPT PLPSY RVTN
Sbjct: 87  VKGKWYYPKEDYAYNKTGIASWYGSAFHGRLTANGEVYDQQALTAAHPTFPLPSYARVTN 146

Query: 133 MENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEY 192
           +E G S++VRVNDRGPYH  R+IDLSN  A++L ++  G   V V+Y+G A ++G D+ Y
Sbjct: 147 VETGSSIIVRVNDRGPYHPGRIIDLSNKTAQLLDLQHSGTGDVRVQYVGRARMDGHDEPY 206

Query: 193 LRST 196
           L ++
Sbjct: 207 LMAS 210


>gi|218516197|ref|ZP_03513037.1| rare lipoprotein A precursor protein [Rhizobium etli 8C-3]
          Length = 347

 Score =  212 bits (540), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 96/182 (52%), Positives = 125/182 (68%)

Query: 15  VCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQIM 74
           +C  V    +       K    EYF ES YGV AS R+ +G  +P+GGGRY +G PY + 
Sbjct: 1   MCATVAACGTTQAVPKKKAHGKEYFSESEYGVKASPRVATGNNIPKGGGRYMVGNPYVVK 60

Query: 75  GRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNME 134
           G+WY P++  +Y  VG+ASWYG AFHGRLTANGEVY   +++AAHPT PLPSY RVTN+E
Sbjct: 61  GKWYYPKEDFSYNKVGIASWYGSAFHGRLTANGEVYDQMHLSAAHPTFPLPSYARVTNVE 120

Query: 135 NGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLR 194
           NG S++VRVNDRGPYH  R+IDLSN  A +L ++  G  KV V+Y+G A ++G D  YL 
Sbjct: 121 NGSSIIVRVNDRGPYHEGRIIDLSNKTADMLDLQHSGTGKVRVQYVGQARMDGHDMPYLM 180

Query: 195 ST 196
           ++
Sbjct: 181 AS 182


>gi|86357780|ref|YP_469672.1| rare lipoprotein A precursor protein [Rhizobium etli CFN 42]
 gi|86281882|gb|ABC90945.1| rare lipoprotein A precursor protein [Rhizobium etli CFN 42]
          Length = 368

 Score =  212 bits (540), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 126/184 (68%)

Query: 13  SVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQ 72
           S +C  V    +       +    EYF ES YGV AS R+ +G  +P+GGGRY +G PY 
Sbjct: 20  SAMCATVAACGTTQAVPKKRSHGKEYFSESEYGVKASPRVATGNNIPKGGGRYMVGNPYV 79

Query: 73  IMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTN 132
           + G+WY P++  +Y  VG+ASWYG AFHGRLTANGEVY   +++AAHPT PLPSY RVTN
Sbjct: 80  VKGKWYYPKEDFSYNKVGIASWYGSAFHGRLTANGEVYDQMHLSAAHPTFPLPSYARVTN 139

Query: 133 MENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEY 192
           +ENG S++VRVNDRGPYH  R+IDLSN  A +L ++  G  KV V+Y+G A ++G D  Y
Sbjct: 140 VENGSSIIVRVNDRGPYHEGRIIDLSNKTADMLDLQHSGTGKVRVQYVGRARMDGHDMPY 199

Query: 193 LRST 196
           L ++
Sbjct: 200 LMAS 203


>gi|218463770|ref|ZP_03503861.1| rare lipoprotein A precursor protein [Rhizobium etli Kim 5]
          Length = 347

 Score =  212 bits (540), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 96/182 (52%), Positives = 126/182 (69%)

Query: 15  VCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQIM 74
           +C  V    +       K    EYF ES YGV AS R+ +G  +P+GGGRY +G PY + 
Sbjct: 1   MCATVAACGTTQAVPKKKAHGKEYFSESEYGVKASPRVATGNNIPKGGGRYIVGNPYVVK 60

Query: 75  GRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNME 134
           G+WY P++  +Y+ VG+ASWYG AFHGRLTANGEVY   +++AAHPT PLPSY RVTN+E
Sbjct: 61  GKWYYPKEDFSYSKVGIASWYGSAFHGRLTANGEVYDQMHLSAAHPTFPLPSYARVTNVE 120

Query: 135 NGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLR 194
           NG S++VRVNDRGPYH  R+IDLSN  A +L ++  G  KV V+Y+G A ++G D  YL 
Sbjct: 121 NGSSVIVRVNDRGPYHEGRIIDLSNKTANMLDLQHSGTGKVRVQYVGRARMDGHDMPYLM 180

Query: 195 ST 196
           ++
Sbjct: 181 AS 182


>gi|227822157|ref|YP_002826128.1| lipoprotein [Sinorhizobium fredii NGR234]
 gi|227341157|gb|ACP25375.1| lipoprotein [Sinorhizobium fredii NGR234]
          Length = 346

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 128/183 (69%)

Query: 14  VVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQI 73
           ++C  +    S     T K    EYF ES+YGV AS R+ +G+ +P+GGGRY +GK YQ+
Sbjct: 24  LLCAALAACGSASSVKTSKSRSKEYFAESVYGVKASPRVATGRNIPKGGGRYQVGKAYQV 83

Query: 74  MGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNM 133
            G+WY P++   Y   GMASWYG AFHGRLTANGEVY   +++AAHPT PLPSY RVTNM
Sbjct: 84  KGKWYQPKEDFGYNKSGMASWYGSAFHGRLTANGEVYDKYHLSAAHPTFPLPSYARVTNM 143

Query: 134 ENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYL 193
           ENG S++VRVNDRGPY   R+ID+S+  A +L ++ +G +KV V+Y+G A L G D  YL
Sbjct: 144 ENGTSVIVRVNDRGPYEYGRIIDVSSKTADMLDMKRKGSAKVRVQYVGRAPLEGNDMPYL 203

Query: 194 RST 196
            ++
Sbjct: 204 MAS 206


>gi|110633931|ref|YP_674139.1| rare lipoprotein A [Mesorhizobium sp. BNC1]
 gi|110284915|gb|ABG62974.1| rare lipoprotein A [Chelativorans sp. BNC1]
          Length = 408

 Score =  209 bits (533), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 133/197 (67%), Gaps = 3/197 (1%)

Query: 2   KRFSCDCLLKGSVVCVVVL-GMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSG-KRVP 59
           KR +      G V   V L G  S     + K  K EYFPES YGV AS R+  G  ++P
Sbjct: 18  KRVNTGLACVGIVALSVFLAGCGSAVEKVSLKSSK-EYFPESKYGVKASPRVAYGASKLP 76

Query: 60  RGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAH 119
           RGGGRY +GKPYQ+ GRWY P++   Y A G ASWYG AFHGRLTANGE+Y   ++TAAH
Sbjct: 77  RGGGRYQVGKPYQVKGRWYRPKEDPDYRAEGAASWYGDAFHGRLTANGEIYDMTHLTAAH 136

Query: 120 PTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEY 179
           PT+PLPSY RVTNM+NG S++VRVNDRGP+   R+IDLS  AA++L     GV++V VEY
Sbjct: 137 PTMPLPSYARVTNMDNGSSVIVRVNDRGPFAKGRVIDLSKRAAELLDYTHSGVARVQVEY 196

Query: 180 LGMALLNGMDQEYLRST 196
           +G A L G D  +L ++
Sbjct: 197 VGPAPLEGRDDSFLLAS 213


>gi|328543896|ref|YP_004304005.1| Rare lipoprotein A [polymorphum gilvum SL003B-26A1]
 gi|326413640|gb|ADZ70703.1| Rare lipoprotein A [Polymorphum gilvum SL003B-26A1]
          Length = 412

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 96/161 (59%), Positives = 122/161 (75%), Gaps = 1/161 (0%)

Query: 37  EYFPESMYGVTASDRIVS-GKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWY 95
           EYFPES YGV AS R+V+ GK VP+GGGRY +G+ Y++ GRWY P++   Y   G ASWY
Sbjct: 36  EYFPESKYGVKASPRVVADGKPVPKGGGRYHVGQKYKVAGRWYHPKEDPNYDKSGNASWY 95

Query: 96  GKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLI 155
           G AFHGR TANGE+Y  + +TAAHPTLPLPSY RVTN+ENG S+VVR+NDRGP+H NR+I
Sbjct: 96  GSAFHGRKTANGEIYDRKGLTAAHPTLPLPSYARVTNLENGRSMVVRINDRGPFHGNRVI 155

Query: 156 DLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRST 196
           DLS   A +L  +  G+ KV V+Y+G A L+G D+ YL ++
Sbjct: 156 DLSERVATMLDTKAAGIGKVRVQYVGPARLDGQDEAYLMAS 196


>gi|325292853|ref|YP_004278717.1| rare lipoprotein A [Agrobacterium sp. H13-3]
 gi|325060706|gb|ADY64397.1| rare lipoprotein A [Agrobacterium sp. H13-3]
          Length = 386

 Score =  205 bits (522), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 123/184 (66%)

Query: 13  SVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQ 72
           SV+C      S+   +   +    EYF ES YGV AS R+  G+ +P+GGGR  LG  Y 
Sbjct: 46  SVLCAATASCSTTSETKPKQKRSKEYFSESEYGVKASPRVADGQNIPKGGGRELLGNAYT 105

Query: 73  IMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTN 132
           + GR Y P++   Y   G+ASWYG AFHGRLTANGEVY  E+++AAHPT PLPSY R+TN
Sbjct: 106 VKGRRYFPKEEPGYNKTGLASWYGSAFHGRLTANGEVYDKEHLSAAHPTFPLPSYARITN 165

Query: 133 MENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEY 192
           MENG S++VRVNDRGP+H  RLID+S+  A +L ++  G + V V+Y G A L+G D  Y
Sbjct: 166 MENGASVLVRVNDRGPFHEGRLIDVSSKTADLLDMKGTGTANVRVQYAGRAPLDGHDMPY 225

Query: 193 LRST 196
           L ++
Sbjct: 226 LMAS 229


>gi|319783487|ref|YP_004142963.1| lipoprotein A [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317169375|gb|ADV12913.1| rare lipoprotein A [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 410

 Score =  205 bits (522), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 96/161 (59%), Positives = 122/161 (75%), Gaps = 1/161 (0%)

Query: 37  EYFPESMYGVTASDRIVS-GKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWY 95
           EYF ES YGV AS R++S   R+ RGGGR  LGKPYQ+ G+WY P++   YA VG+ASWY
Sbjct: 46  EYFAESEYGVKASPRVISRNGRIQRGGGRDQLGKPYQVRGKWYYPKEDKRYAKVGLASWY 105

Query: 96  GKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLI 155
           G AFHGRLTANGEVY   ++TAAHPT+PLPSY RVTN++ G S++VRVNDRGPYH  R+I
Sbjct: 106 GDAFHGRLTANGEVYDMTHLTAAHPTMPLPSYARVTNLKTGSSVIVRVNDRGPYHEGRII 165

Query: 156 DLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRST 196
           D+S  AA++L     G ++V VEY+G A L+G D +YL ++
Sbjct: 166 DVSERAAQMLDYANTGTAQVKVEYVGRAPLDGDDDQYLMAS 206


>gi|153009405|ref|YP_001370620.1| rare lipoprotein A [Ochrobactrum anthropi ATCC 49188]
 gi|151561293|gb|ABS14791.1| rare lipoprotein A [Ochrobactrum anthropi ATCC 49188]
          Length = 424

 Score =  204 bits (520), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 100/194 (51%), Positives = 129/194 (66%), Gaps = 2/194 (1%)

Query: 5   SCDCLLKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIV--SGKRVPRGG 62
           S   +L    + V + G +S     +      EYF ES YGV AS R+    GK +PRGG
Sbjct: 23  SSVVILSFMAIAVALAGCASAPQPKSKTKRSKEYFAESKYGVKASPRVAFSKGKPLPRGG 82

Query: 63  GRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTL 122
           GR   G+PY++ GRWY P++   Y  VG ASWYG+AFHGRLTANGEVY   ++TAAHPT+
Sbjct: 83  GRDQTGQPYKVKGRWYYPKEDKKYVKVGHASWYGEAFHGRLTANGEVYDMTHLTAAHPTM 142

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           PLPSY RVTN+ NG S++VRVNDRGPY  +R+IDLS  AA++L  +  G + V VEY+G 
Sbjct: 143 PLPSYARVTNLANGSSVIVRVNDRGPYEYDRVIDLSQKAAEMLDYQHHGTANVKVEYVGR 202

Query: 183 ALLNGMDQEYLRST 196
           A LNG D  +L ++
Sbjct: 203 APLNGNDDAFLMAS 216


>gi|159184786|ref|NP_354506.2| rare lipoprotein A [Agrobacterium tumefaciens str. C58]
 gi|159140074|gb|AAK87291.2| rare lipoprotein A [Agrobacterium tumefaciens str. C58]
          Length = 347

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 122/184 (66%)

Query: 13  SVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQ 72
           SV+C      S+   +        EYF ES YGV AS R+  GK +P+GGGR  +G  Y 
Sbjct: 7   SVLCAATASCSTTSETKPKPKRSKEYFSESEYGVKASPRVADGKSIPKGGGRELVGNAYT 66

Query: 73  IMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTN 132
           + GR Y P++   Y   G+ASWYG AFHGRLTANGEVY  E+++AAHPT PLPSY R+TN
Sbjct: 67  VKGRRYFPKEEPGYNKTGLASWYGSAFHGRLTANGEVYDKEHLSAAHPTFPLPSYARITN 126

Query: 133 MENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEY 192
           MENG S++VRVNDRGP+H  RLID+S+  A +L ++  G + V V+Y G A L+G D  Y
Sbjct: 127 MENGSSVLVRVNDRGPFHEGRLIDVSSKTADLLDMKATGTANVRVQYAGRAPLDGHDMPY 186

Query: 193 LRST 196
           L ++
Sbjct: 187 LMAS 190


>gi|254719068|ref|ZP_05180879.1| Rare lipoprotein A [Brucella sp. 83/13]
 gi|306838350|ref|ZP_07471195.1| rare lipoprotein A [Brucella sp. NF 2653]
 gi|306406490|gb|EFM62724.1| rare lipoprotein A [Brucella sp. NF 2653]
          Length = 421

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 132/194 (68%), Gaps = 3/194 (1%)

Query: 2   KRFSCDCLLKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKR--VP 59
           KR S   L+  +V   +    S+    S +K  K EYF ES YGV AS R+V GK   +P
Sbjct: 19  KRGSAAMLVLMAVAVTLAGCASTPQTKSKHKRSK-EYFAESKYGVKASPRVVYGKGQPMP 77

Query: 60  RGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAH 119
           RGGGR   GKPY++ GRWY P++   Y AVG ASWYG+AFHGRLTANGEVY   ++TAAH
Sbjct: 78  RGGGRDQTGKPYKVKGRWYYPKEDKNYTAVGRASWYGEAFHGRLTANGEVYDMTHLTAAH 137

Query: 120 PTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEY 179
           PT+PLPSY RVTN++ G S++VRVNDRGPY  +R+IDLS  AA++L  +  G + V VEY
Sbjct: 138 PTMPLPSYARVTNLDTGSSVIVRVNDRGPYEYDRVIDLSWKAAEMLDYQRHGTANVKVEY 197

Query: 180 LGMALLNGMDQEYL 193
           +G A L G D  +L
Sbjct: 198 VGRAPLEGNDDAFL 211


>gi|306840478|ref|ZP_07473237.1| rare lipoprotein A [Brucella sp. BO2]
 gi|306289493|gb|EFM60711.1| rare lipoprotein A [Brucella sp. BO2]
          Length = 407

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 132/194 (68%), Gaps = 3/194 (1%)

Query: 2   KRFSCDCLLKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGK--RVP 59
           KR S   L+  +V   +    S+    S +K  K EYF ES YGV AS R+V GK   +P
Sbjct: 5   KRGSAAMLVLMAVAVTLAGCASTPQTKSKHKRSK-EYFAESKYGVKASPRVVYGKGQPMP 63

Query: 60  RGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAH 119
           RGGGR   GKPY++ GRWY P++   Y AVG ASWYG+AFHGRLTANGEVY   ++TAAH
Sbjct: 64  RGGGRDQTGKPYKVKGRWYYPKEDKNYTAVGRASWYGEAFHGRLTANGEVYDMTHLTAAH 123

Query: 120 PTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEY 179
           PT+PLPSY RVTN++ G S++VRVNDRGPY  +R+IDLS  AA++L  +  G + V VEY
Sbjct: 124 PTMPLPSYARVTNLDTGSSVIVRVNDRGPYEYDRVIDLSWKAAEMLDYQRHGTANVKVEY 183

Query: 180 LGMALLNGMDQEYL 193
           +G A L G D  +L
Sbjct: 184 VGRAPLEGNDDAFL 197


>gi|265984059|ref|ZP_06096794.1| rare lipoprotein A [Brucella sp. 83/13]
 gi|264662651|gb|EEZ32912.1| rare lipoprotein A [Brucella sp. 83/13]
          Length = 419

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 132/194 (68%), Gaps = 3/194 (1%)

Query: 2   KRFSCDCLLKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKR--VP 59
           KR S   L+  +V   +    S+    S +K  K EYF ES YGV AS R+V GK   +P
Sbjct: 17  KRGSAAMLVLMAVAVTLAGCASTPQTKSKHKRSK-EYFAESKYGVKASPRVVYGKGQPMP 75

Query: 60  RGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAH 119
           RGGGR   GKPY++ GRWY P++   Y AVG ASWYG+AFHGRLTANGEVY   ++TAAH
Sbjct: 76  RGGGRDQTGKPYKVKGRWYYPKEDKNYTAVGRASWYGEAFHGRLTANGEVYDMTHLTAAH 135

Query: 120 PTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEY 179
           PT+PLPSY RVTN++ G S++VRVNDRGPY  +R+IDLS  AA++L  +  G + V VEY
Sbjct: 136 PTMPLPSYARVTNLDTGSSVIVRVNDRGPYEYDRVIDLSWKAAEMLDYQRHGTANVKVEY 195

Query: 180 LGMALLNGMDQEYL 193
           +G A L G D  +L
Sbjct: 196 VGRAPLEGNDDAFL 209


>gi|222148587|ref|YP_002549544.1| rare lipoprotein A [Agrobacterium vitis S4]
 gi|221735573|gb|ACM36536.1| rare lipoprotein A [Agrobacterium vitis S4]
          Length = 382

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 135/202 (66%), Gaps = 6/202 (2%)

Query: 1   MKRFSCDCLLKGSVVCVVVLGMSSCFFS------STYKDDKLEYFPESMYGVTASDRIVS 54
           ++R S    L+ + V +  + ++SC  +      ST K    EYF ES YGV AS R+V 
Sbjct: 3   LQRRSVSGCLRMAWVVLAGVAVTSCGANHDVSKVSTTKKRSKEYFAESAYGVKASPRVVE 62

Query: 55  GKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEY 114
              VP+GGGR  +G PY + G+ Y PR+   Y A G+ASWYG AFHGR TANGEVY    
Sbjct: 63  NGPVPKGGGRRLVGNPYVVAGKVYKPRENPNYEASGLASWYGSAFHGRYTANGEVYDQYG 122

Query: 115 ITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSK 174
           I+AAHPT+PLPSY RVTN++ G S++VRVNDRGP+H+NRLIDLS+ AA++L V+  G + 
Sbjct: 123 ISAAHPTMPLPSYARVTNLDTGSSVIVRVNDRGPFHANRLIDLSDKAAELLDVKGHGTAN 182

Query: 175 VHVEYLGMALLNGMDQEYLRST 196
           V V+Y+G A + G D  YL ++
Sbjct: 183 VKVKYVGPADMTGHDMPYLMAS 204


>gi|239832001|ref|ZP_04680330.1| rare lipoprotein A [Ochrobactrum intermedium LMG 3301]
 gi|239824268|gb|EEQ95836.1| rare lipoprotein A [Ochrobactrum intermedium LMG 3301]
          Length = 427

 Score =  202 bits (514), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 129/194 (66%), Gaps = 2/194 (1%)

Query: 5   SCDCLLKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIV--SGKRVPRGG 62
           S   LL    + V + G +S     +      EYF ES YGV +S R+    GK +PRGG
Sbjct: 26  SSVALLSFMAIAVALAGCASAPQPKSKSKRSKEYFAESKYGVKSSPRVAFAKGKPLPRGG 85

Query: 63  GRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTL 122
           GR   G+PY++ GRWY P++   Y  VG ASWYG+AFHGRLTANGEVY   ++TAAHPT+
Sbjct: 86  GRDQTGQPYKVKGRWYYPKEDKNYVKVGHASWYGEAFHGRLTANGEVYDMAHLTAAHPTM 145

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           PLPSY RVTN+ NG S++VRVNDRGPY  +R+IDLS  AA++L  +  G + V VEY+G 
Sbjct: 146 PLPSYARVTNLANGNSVIVRVNDRGPYEFDRVIDLSQKAAEMLDYQHHGTANVKVEYVGR 205

Query: 183 ALLNGMDQEYLRST 196
           A L+G D  +L ++
Sbjct: 206 APLDGNDDAFLMAS 219


>gi|92117542|ref|YP_577271.1| rare lipoprotein A [Nitrobacter hamburgensis X14]
 gi|91800436|gb|ABE62811.1| rare lipoprotein A [Nitrobacter hamburgensis X14]
          Length = 312

 Score =  202 bits (513), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 112/251 (44%), Positives = 146/251 (58%), Gaps = 25/251 (9%)

Query: 18  VVLGMSSCFFSSTYK--DDKLEYFPESMYGVTASDRIVS-GKRVPRGGGRYFLGKPYQIM 74
           V L ++SC  S  +   D K        YGV++S R+V  G+ VP+GGG Y +GKPY + 
Sbjct: 21  VCLMLASCGSSGKFSRIDPK--------YGVSSSPRVVGFGEPVPKGGGTYRVGKPYTVA 72

Query: 75  GRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNME 134
           GR YVP + T Y A G+ASWYG AFHGRLTANGEV+    ++AAHPTLPLP Y RVTN+ 
Sbjct: 73  GRVYVPEENTHYRAEGLASWYGDAFHGRLTANGEVFDMASLSAAHPTLPLPCYARVTNLS 132

Query: 135 NGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLR 194
           NG SL+VRVNDRGPYH NRLID+SN AA++L  + RGV++V VEY+G A L G D   L 
Sbjct: 133 NGRSLIVRVNDRGPYHGNRLIDVSNKAAELLEFKGRGVARVRVEYVGRAPLEGSDDRQLM 192

Query: 195 STVMVNSATVLPLGCQYREEIVVIPYLLTRSRTVHLN--------------NCDDDSLQK 240
           +T+        P   +       +P L    R +  +              + D DS+  
Sbjct: 193 ATLRTGEPAPSPSTVRIASARPFVPELAPSGRAIRGDVPTPDGRPYALGHTSVDADSINA 252

Query: 241 QREISLRERKK 251
             E+S   R +
Sbjct: 253 TSEMSASSRAR 263


>gi|163843259|ref|YP_001627663.1| rare lipoprotein A [Brucella suis ATCC 23445]
 gi|163673982|gb|ABY38093.1| rare lipoprotein A [Brucella suis ATCC 23445]
          Length = 421

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 100/167 (59%), Positives = 122/167 (73%), Gaps = 3/167 (1%)

Query: 29  STYKDDKLEYFPESMYGVTASDRIVSGKR--VPRGGGRYFLGKPYQIMGRWYVPRQYTAY 86
           S +K  K EYF ES YGV AS R+V GK   +PRGGGR   GKPYQ+ GRWY P++   Y
Sbjct: 46  SKHKRSK-EYFAESKYGVKASPRVVYGKGQPMPRGGGRDQTGKPYQVKGRWYYPKEDKNY 104

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
            AVG ASWYG+AFHGRLTANGEVY   ++TAAHPT+PLPSY RVTN++ G S++VRVNDR
Sbjct: 105 TAVGRASWYGEAFHGRLTANGEVYDMTHLTAAHPTMPLPSYARVTNLDTGSSVIVRVNDR 164

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYL 193
           GPY  +R+IDLS  AA++L  +  G + V VEY+G A L G D  +L
Sbjct: 165 GPYEYDRVIDLSWKAAEMLDYQHHGTANVKVEYVGRAPLEGNDDAFL 211


>gi|23501871|ref|NP_697998.1| rare lipoprotein A family protein [Brucella suis 1330]
 gi|62289914|ref|YP_221707.1| rare lipoprotein A family protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82699841|ref|YP_414415.1| rare lipoprotein A [Brucella melitensis biovar Abortus 2308]
 gi|161618944|ref|YP_001592831.1| rare lipoprotein A [Brucella canis ATCC 23365]
 gi|189024157|ref|YP_001934925.1| Rare lipoprotein A [Brucella abortus S19]
 gi|254689221|ref|ZP_05152475.1| Rare lipoprotein A [Brucella abortus bv. 6 str. 870]
 gi|254693706|ref|ZP_05155534.1| Rare lipoprotein A [Brucella abortus bv. 3 str. Tulya]
 gi|254697356|ref|ZP_05159184.1| Rare lipoprotein A [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701742|ref|ZP_05163570.1| Rare lipoprotein A [Brucella suis bv. 5 str. 513]
 gi|254704284|ref|ZP_05166112.1| Rare lipoprotein A [Brucella suis bv. 3 str. 686]
 gi|254706814|ref|ZP_05168642.1| Rare lipoprotein A [Brucella pinnipedialis M163/99/10]
 gi|254710076|ref|ZP_05171887.1| Rare lipoprotein A [Brucella pinnipedialis B2/94]
 gi|254714077|ref|ZP_05175888.1| Rare lipoprotein A [Brucella ceti M644/93/1]
 gi|254716866|ref|ZP_05178677.1| Rare lipoprotein A [Brucella ceti M13/05/1]
 gi|254730254|ref|ZP_05188832.1| Rare lipoprotein A [Brucella abortus bv. 4 str. 292]
 gi|256031572|ref|ZP_05445186.1| Rare lipoprotein A [Brucella pinnipedialis M292/94/1]
 gi|256061083|ref|ZP_05451238.1| Rare lipoprotein A [Brucella neotomae 5K33]
 gi|256159711|ref|ZP_05457458.1| Rare lipoprotein A [Brucella ceti M490/95/1]
 gi|256254973|ref|ZP_05460509.1| Rare lipoprotein A [Brucella ceti B1/94]
 gi|256257471|ref|ZP_05463007.1| Rare lipoprotein A [Brucella abortus bv. 9 str. C68]
 gi|256369412|ref|YP_003106920.1| rare lipoprotein A family protein [Brucella microti CCM 4915]
 gi|260168703|ref|ZP_05755514.1| rare lipoprotein A family protein [Brucella sp. F5/99]
 gi|297248316|ref|ZP_06932034.1| lipoprotein A [Brucella abortus bv. 5 str. B3196]
 gi|23347809|gb|AAN29913.1| rare lipoprotein A family protein [Brucella suis 1330]
 gi|62196046|gb|AAX74346.1| rare lipoprotein A family protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82615942|emb|CAJ10965.1| Rare lipoprotein A [Brucella melitensis biovar Abortus 2308]
 gi|161335755|gb|ABX62060.1| rare lipoprotein A [Brucella canis ATCC 23365]
 gi|189019729|gb|ACD72451.1| Rare lipoprotein A [Brucella abortus S19]
 gi|255999572|gb|ACU47971.1| rare lipoprotein A family protein [Brucella microti CCM 4915]
 gi|297175485|gb|EFH34832.1| lipoprotein A [Brucella abortus bv. 5 str. B3196]
          Length = 421

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 100/167 (59%), Positives = 122/167 (73%), Gaps = 3/167 (1%)

Query: 29  STYKDDKLEYFPESMYGVTASDRIVSGKR--VPRGGGRYFLGKPYQIMGRWYVPRQYTAY 86
           S +K  K EYF ES YGV AS R+V GK   +PRGGGR   GKPYQ+ GRWY P++   Y
Sbjct: 46  SKHKRSK-EYFAESKYGVKASPRVVYGKGQPMPRGGGRDQTGKPYQVKGRWYYPKEDKNY 104

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
            AVG ASWYG+AFHGRLTANGEVY   ++TAAHPT+PLPSY RVTN++ G S++VRVNDR
Sbjct: 105 TAVGRASWYGEAFHGRLTANGEVYDMTHLTAAHPTMPLPSYARVTNLDTGSSVIVRVNDR 164

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYL 193
           GPY  +R+IDLS  AA++L  +  G + V VEY+G A L G D  +L
Sbjct: 165 GPYEYDRVIDLSWKAAEMLDYQHHGTANVKVEYVGRAPLEGNDDAFL 211


>gi|260545337|ref|ZP_05821078.1| rare lipoprotein A [Brucella abortus NCTC 8038]
 gi|260566469|ref|ZP_05836939.1| rare lipoprotein A [Brucella suis bv. 4 str. 40]
 gi|260754726|ref|ZP_05867074.1| rare lipoprotein A [Brucella abortus bv. 6 str. 870]
 gi|260757949|ref|ZP_05870297.1| rare lipoprotein A [Brucella abortus bv. 4 str. 292]
 gi|260761772|ref|ZP_05874115.1| rare lipoprotein A [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883747|ref|ZP_05895361.1| rare lipoprotein A [Brucella abortus bv. 9 str. C68]
 gi|261213978|ref|ZP_05928259.1| rare lipoprotein A [Brucella abortus bv. 3 str. Tulya]
 gi|261218668|ref|ZP_05932949.1| rare lipoprotein A [Brucella ceti M13/05/1]
 gi|261222158|ref|ZP_05936439.1| rare lipoprotein A [Brucella ceti B1/94]
 gi|261314281|ref|ZP_05953478.1| rare lipoprotein A [Brucella pinnipedialis M163/99/10]
 gi|261317625|ref|ZP_05956822.1| rare lipoprotein A [Brucella pinnipedialis B2/94]
 gi|261321834|ref|ZP_05961031.1| rare lipoprotein A [Brucella ceti M644/93/1]
 gi|261325085|ref|ZP_05964282.1| rare lipoprotein A [Brucella neotomae 5K33]
 gi|261752295|ref|ZP_05996004.1| rare lipoprotein A [Brucella suis bv. 5 str. 513]
 gi|261754952|ref|ZP_05998661.1| rare lipoprotein A [Brucella suis bv. 3 str. 686]
 gi|261758180|ref|ZP_06001889.1| rare lipoprotein A [Brucella sp. F5/99]
 gi|265988660|ref|ZP_06101217.1| rare lipoprotein A [Brucella pinnipedialis M292/94/1]
 gi|265998123|ref|ZP_06110680.1| rare lipoprotein A [Brucella ceti M490/95/1]
 gi|260096744|gb|EEW80619.1| rare lipoprotein A [Brucella abortus NCTC 8038]
 gi|260155987|gb|EEW91067.1| rare lipoprotein A [Brucella suis bv. 4 str. 40]
 gi|260668267|gb|EEX55207.1| rare lipoprotein A [Brucella abortus bv. 4 str. 292]
 gi|260672204|gb|EEX59025.1| rare lipoprotein A [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674834|gb|EEX61655.1| rare lipoprotein A [Brucella abortus bv. 6 str. 870]
 gi|260873275|gb|EEX80344.1| rare lipoprotein A [Brucella abortus bv. 9 str. C68]
 gi|260915585|gb|EEX82446.1| rare lipoprotein A [Brucella abortus bv. 3 str. Tulya]
 gi|260920742|gb|EEX87395.1| rare lipoprotein A [Brucella ceti B1/94]
 gi|260923757|gb|EEX90325.1| rare lipoprotein A [Brucella ceti M13/05/1]
 gi|261294524|gb|EEX98020.1| rare lipoprotein A [Brucella ceti M644/93/1]
 gi|261296848|gb|EEY00345.1| rare lipoprotein A [Brucella pinnipedialis B2/94]
 gi|261301065|gb|EEY04562.1| rare lipoprotein A [Brucella neotomae 5K33]
 gi|261303307|gb|EEY06804.1| rare lipoprotein A [Brucella pinnipedialis M163/99/10]
 gi|261738164|gb|EEY26160.1| rare lipoprotein A [Brucella sp. F5/99]
 gi|261742048|gb|EEY29974.1| rare lipoprotein A [Brucella suis bv. 5 str. 513]
 gi|261744705|gb|EEY32631.1| rare lipoprotein A [Brucella suis bv. 3 str. 686]
 gi|262552591|gb|EEZ08581.1| rare lipoprotein A [Brucella ceti M490/95/1]
 gi|264660857|gb|EEZ31118.1| rare lipoprotein A [Brucella pinnipedialis M292/94/1]
          Length = 419

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 100/167 (59%), Positives = 122/167 (73%), Gaps = 3/167 (1%)

Query: 29  STYKDDKLEYFPESMYGVTASDRIVSGKR--VPRGGGRYFLGKPYQIMGRWYVPRQYTAY 86
           S +K  K EYF ES YGV AS R+V GK   +PRGGGR   GKPYQ+ GRWY P++   Y
Sbjct: 44  SKHKRSK-EYFAESKYGVKASPRVVYGKGQPMPRGGGRDQTGKPYQVKGRWYYPKEDKNY 102

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
            AVG ASWYG+AFHGRLTANGEVY   ++TAAHPT+PLPSY RVTN++ G S++VRVNDR
Sbjct: 103 TAVGRASWYGEAFHGRLTANGEVYDMTHLTAAHPTMPLPSYARVTNLDTGSSVIVRVNDR 162

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYL 193
           GPY  +R+IDLS  AA++L  +  G + V VEY+G A L G D  +L
Sbjct: 163 GPYEYDRVIDLSWKAAEMLDYQHHGTANVKVEYVGRAPLEGNDDAFL 209


>gi|148559736|ref|YP_001258932.1| rare lipoprotein A family protein [Brucella ovis ATCC 25840]
 gi|148370993|gb|ABQ60972.1| rare lipoprotein A family protein [Brucella ovis ATCC 25840]
          Length = 419

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 100/167 (59%), Positives = 122/167 (73%), Gaps = 3/167 (1%)

Query: 29  STYKDDKLEYFPESMYGVTASDRIVSGKR--VPRGGGRYFLGKPYQIMGRWYVPRQYTAY 86
           S +K  K EYF ES YGV AS R+V GK   +PRGGGR   GKPYQ+ GRWY P++   Y
Sbjct: 44  SKHKRSK-EYFAESKYGVKASPRVVYGKGQPMPRGGGRDQTGKPYQVKGRWYYPKEDKNY 102

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
            AVG ASWYG+AFHGRLTANGEVY   ++TAAHPT+PLPSY RVTN++ G S++VRVNDR
Sbjct: 103 TAVGRASWYGEAFHGRLTANGEVYDMTHLTAAHPTMPLPSYARVTNLDTGSSVIVRVNDR 162

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYL 193
           GPY  +R+IDLS  AA++L  +  G + V VEY+G A L G D  +L
Sbjct: 163 GPYEYDRVIDLSWKAAEMLDYQHHGTANVKVEYVGRAPLEGNDDAFL 209


>gi|306843865|ref|ZP_07476460.1| rare lipoprotein A [Brucella sp. BO1]
 gi|306275620|gb|EFM57344.1| rare lipoprotein A [Brucella sp. BO1]
          Length = 421

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 100/167 (59%), Positives = 122/167 (73%), Gaps = 3/167 (1%)

Query: 29  STYKDDKLEYFPESMYGVTASDRIVSGKR--VPRGGGRYFLGKPYQIMGRWYVPRQYTAY 86
           S +K  K EYF ES YGV AS R+V GK   +PRGGGR   GKPYQ+ GRWY P++   Y
Sbjct: 46  SKHKRSK-EYFAESKYGVKASPRVVYGKGQPMPRGGGRDQTGKPYQVKGRWYYPKEDKNY 104

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
            AVG ASWYG+AFHGRLTANGEVY   ++TAAHPT+PLPSY RVTN++ G S++VRVNDR
Sbjct: 105 TAVGRASWYGEAFHGRLTANGEVYDMTHLTAAHPTMPLPSYARVTNLDTGSSVIVRVNDR 164

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYL 193
           GPY  +R+IDLS  AA++L  +  G + V VEY+G A L G D  +L
Sbjct: 165 GPYEYDRVIDLSWKAAEMLDYQRHGTANVKVEYVGRAPLEGNDDAFL 211


>gi|237815416|ref|ZP_04594414.1| rare lipoprotein A [Brucella abortus str. 2308 A]
 gi|237790253|gb|EEP64463.1| rare lipoprotein A [Brucella abortus str. 2308 A]
          Length = 431

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 100/167 (59%), Positives = 122/167 (73%), Gaps = 3/167 (1%)

Query: 29  STYKDDKLEYFPESMYGVTASDRIVSGKR--VPRGGGRYFLGKPYQIMGRWYVPRQYTAY 86
           S +K  K EYF ES YGV AS R+V GK   +PRGGGR   GKPYQ+ GRWY P++   Y
Sbjct: 56  SKHKRSK-EYFAESKYGVKASPRVVYGKGQPMPRGGGRDQTGKPYQVKGRWYYPKEDKNY 114

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
            AVG ASWYG+AFHGRLTANGEVY   ++TAAHPT+PLPSY RVTN++ G S++VRVNDR
Sbjct: 115 TAVGRASWYGEAFHGRLTANGEVYDMTHLTAAHPTMPLPSYARVTNLDTGSSVIVRVNDR 174

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYL 193
           GPY  +R+IDLS  AA++L  +  G + V VEY+G A L G D  +L
Sbjct: 175 GPYEYDRVIDLSWKAAEMLDYQHHGTANVKVEYVGRAPLEGNDDAFL 221


>gi|294852419|ref|ZP_06793092.1| lipoprotein A [Brucella sp. NVSL 07-0026]
 gi|294821008|gb|EFG38007.1| lipoprotein A [Brucella sp. NVSL 07-0026]
          Length = 233

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 123/176 (69%), Gaps = 2/176 (1%)

Query: 37  EYFPESMYGVTASDRIVSGKR--VPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASW 94
           EYF ES YGV AS R+V GK   +PRGGGR   GKPYQ+ GRWY P++   Y AVG ASW
Sbjct: 56  EYFAESKYGVKASPRVVYGKGQPMPRGGGRDQTGKPYQVKGRWYYPKEDKNYTAVGRASW 115

Query: 95  YGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRL 154
           YG+AFHGRLTANGEVY   ++TAAHPT+PLPSY RVTN++ G S++VRVNDRGPY  +R+
Sbjct: 116 YGEAFHGRLTANGEVYDMTHLTAAHPTMPLPSYARVTNLDTGSSVIVRVNDRGPYEYDRV 175

Query: 155 IDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNSATVLPLGCQ 210
           IDLS  AA++L  +  G + V VEY+G A L G D  +L ++     A +     Q
Sbjct: 176 IDLSWKAAEMLDYQHHGTANVKVEYVGRAPLEGNDDAFLLASYRPGGAEIRSASLQ 231


>gi|225627468|ref|ZP_03785505.1| rare lipoprotein A [Brucella ceti str. Cudo]
 gi|225617473|gb|EEH14518.1| rare lipoprotein A [Brucella ceti str. Cudo]
          Length = 431

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 100/167 (59%), Positives = 122/167 (73%), Gaps = 3/167 (1%)

Query: 29  STYKDDKLEYFPESMYGVTASDRIVSGKR--VPRGGGRYFLGKPYQIMGRWYVPRQYTAY 86
           S +K  K EYF ES YGV AS R+V GK   +PRGGGR   GKPYQ+ GRWY P++   Y
Sbjct: 56  SKHKRSK-EYFAESKYGVKASPRVVYGKGQPMPRGGGRDQTGKPYQVKGRWYYPKEDKNY 114

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
            AVG ASWYG+AFHGRLTANGEVY   ++TAAHPT+PLPSY RVTN++ G S++VRVNDR
Sbjct: 115 TAVGRASWYGEAFHGRLTANGEVYDMTHLTAAHPTMPLPSYARVTNLDTGSSVIVRVNDR 174

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYL 193
           GPY  +R+IDLS  AA++L  +  G + V VEY+G A L G D  +L
Sbjct: 175 GPYEYDRVIDLSWKAAEMLDYQHHGTANVKVEYVGRAPLEGNDDAFL 221


>gi|13470656|ref|NP_102225.1| rare lipoprotein A [Mesorhizobium loti MAFF303099]
 gi|14021398|dbj|BAB48011.1| rare lipoprotein A [Mesorhizobium loti MAFF303099]
          Length = 407

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 121/160 (75%), Gaps = 3/160 (1%)

Query: 37  EYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYG 96
           EYF E+ YGV AS R+     + RGGGR  LGKPYQ+ G+WY P++   YA VG+ASWYG
Sbjct: 46  EYFAETEYGVKASPRV---NFMRRGGGRDQLGKPYQVRGKWYYPKEDRHYAKVGLASWYG 102

Query: 97  KAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLID 156
            AFHGRLTANGEVY   ++TAAHPT+PLPSY RVTN+E G S++VRVNDRGPYH  R+ID
Sbjct: 103 DAFHGRLTANGEVYDMTHLTAAHPTMPLPSYARVTNLETGSSVIVRVNDRGPYHEGRIID 162

Query: 157 LSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRST 196
           +S  AA++L  ++ G +KV VEY+G A L+G D +YL ++
Sbjct: 163 VSERAAQMLDYDKVGTAKVKVEYVGRAPLDGNDDQYLMAS 202


>gi|17987274|ref|NP_539908.1| rare lipoprotein A [Brucella melitensis bv. 1 str. 16M]
 gi|17982951|gb|AAL52172.1| rare lipoprotein a [Brucella melitensis bv. 1 str. 16M]
          Length = 391

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 99/181 (54%), Positives = 125/181 (69%), Gaps = 2/181 (1%)

Query: 15  VCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGK--RVPRGGGRYFLGKPYQ 72
           + V + G +S   + +       YF ES YGV AS R+V GK   +PRGGGR   GKPYQ
Sbjct: 1   MAVTLAGCASTPQTKSKHKRSKGYFAESKYGVKASPRVVYGKGQPMPRGGGRDQTGKPYQ 60

Query: 73  IMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTN 132
           + GRWY P++   Y AVG ASWYG+AFHGRLTANGEVY   ++TAAHPT+PLPSY RVTN
Sbjct: 61  VKGRWYYPKEDKNYTAVGRASWYGEAFHGRLTANGEVYDMTHLTAAHPTMPLPSYARVTN 120

Query: 133 MENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEY 192
           ++ G S++VRVNDRGPY  +R+IDLS  AA++L  +  G + V VEY+G A L G D  +
Sbjct: 121 LDTGSSVIVRVNDRGPYEYDRVIDLSWKAAEMLDYQHHGTANVKVEYVGRAPLEGNDDAF 180

Query: 193 L 193
           L
Sbjct: 181 L 181


>gi|39935839|ref|NP_948115.1| rare lipoprotein A [Rhodopseudomonas palustris CGA009]
 gi|39649693|emb|CAE28214.1| rare lipoprotein A [Rhodopseudomonas palustris CGA009]
          Length = 315

 Score =  199 bits (506), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 130/203 (64%), Gaps = 1/203 (0%)

Query: 18  VVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVS-GKRVPRGGGRYFLGKPYQIMGR 76
           VVL   +C   +    +      +  YGV++S R+V+ G+ VP+GGG Y +GKPY + GR
Sbjct: 15  VVLAAGACLVLANCAQNGQFSRIDPKYGVSSSPRVVAFGEPVPKGGGTYRVGKPYVVAGR 74

Query: 77  WYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENG 136
            YVP +   Y A G+ASWYG  FHGRLTANGEV+    ++AAHPTLP+PSY RVTNM NG
Sbjct: 75  TYVPEENPHYRAEGLASWYGDDFHGRLTANGEVFDMASLSAAHPTLPIPSYARVTNMANG 134

Query: 137 ISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRST 196
            SL+VR+NDRGPYH NRLID+SN AA++L  + RG +KV VEY+G A L G D   L +T
Sbjct: 135 RSLIVRINDRGPYHGNRLIDVSNKAAELLEFKHRGTAKVRVEYVGRAPLEGSDDRQLIAT 194

Query: 197 VMVNSATVLPLGCQYREEIVVIP 219
           +        P G +       +P
Sbjct: 195 LRQGEPAPAPTGVRIASAKPFVP 217


>gi|192291487|ref|YP_001992092.1| rare lipoprotein A [Rhodopseudomonas palustris TIE-1]
 gi|192285236|gb|ACF01617.1| rare lipoprotein A [Rhodopseudomonas palustris TIE-1]
          Length = 315

 Score =  199 bits (506), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 130/203 (64%), Gaps = 1/203 (0%)

Query: 18  VVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVS-GKRVPRGGGRYFLGKPYQIMGR 76
           VVL   +C   +    +      +  YGV++S R+V+ G+ VP+GGG Y +GKPY + GR
Sbjct: 15  VVLAAGACLVLANCAQNGQFSRIDPKYGVSSSPRVVAFGEPVPKGGGTYRVGKPYVVAGR 74

Query: 77  WYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENG 136
            YVP +   Y A G+ASWYG  FHGRLTANGEV+    ++AAHPTLP+PSY RVTNM NG
Sbjct: 75  TYVPEENPHYRAEGLASWYGDDFHGRLTANGEVFDMASLSAAHPTLPIPSYARVTNMANG 134

Query: 137 ISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRST 196
            SL+VR+NDRGPYH NRLID+SN AA++L  + RG +KV VEY+G A L G D   L +T
Sbjct: 135 RSLIVRINDRGPYHGNRLIDVSNKAAELLEFKHRGTAKVRVEYVGRAPLEGSDDRQLIAT 194

Query: 197 VMVNSATVLPLGCQYREEIVVIP 219
           +        P G +       +P
Sbjct: 195 LRQGEPAPAPTGVRIASAKPFVP 217


>gi|256044651|ref|ZP_05447555.1| rare lipoprotein A [Brucella melitensis bv. 1 str. Rev.1]
 gi|256113537|ref|ZP_05454363.1| rare lipoprotein A [Brucella melitensis bv. 3 str. Ether]
 gi|260563997|ref|ZP_05834483.1| rare lipoprotein A [Brucella melitensis bv. 1 str. 16M]
 gi|260154013|gb|EEW89105.1| rare lipoprotein A [Brucella melitensis bv. 1 str. 16M]
          Length = 421

 Score =  198 bits (504), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 96/158 (60%), Positives = 117/158 (74%), Gaps = 2/158 (1%)

Query: 38  YFPESMYGVTASDRIVSGKR--VPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWY 95
           YF ES YGV AS R+V GK   +PRGGGR   GKPYQ+ GRWY P++   Y AVG ASWY
Sbjct: 54  YFAESKYGVKASPRVVYGKGQPMPRGGGRDQTGKPYQVKGRWYYPKEDKNYTAVGRASWY 113

Query: 96  GKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLI 155
           G+AFHGRLTANGEVY   ++TAAHPT+PLPSY RVTN++ G S++VRVNDRGPY  +R+I
Sbjct: 114 GEAFHGRLTANGEVYDMTHLTAAHPTMPLPSYARVTNLDTGSSVIVRVNDRGPYEYDRVI 173

Query: 156 DLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYL 193
           DLS  AA++L  +  G + V VEY+G A L G D  +L
Sbjct: 174 DLSWKAAEMLDYQHHGTANVKVEYVGRAPLEGNDDAFL 211


>gi|265991075|ref|ZP_06103632.1| rare lipoprotein A [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994910|ref|ZP_06107467.1| rare lipoprotein A [Brucella melitensis bv. 3 str. Ether]
 gi|262766023|gb|EEZ11812.1| rare lipoprotein A [Brucella melitensis bv. 3 str. Ether]
 gi|263001859|gb|EEZ14434.1| rare lipoprotein A [Brucella melitensis bv. 1 str. Rev.1]
          Length = 419

 Score =  198 bits (503), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 96/158 (60%), Positives = 117/158 (74%), Gaps = 2/158 (1%)

Query: 38  YFPESMYGVTASDRIVSGKR--VPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWY 95
           YF ES YGV AS R+V GK   +PRGGGR   GKPYQ+ GRWY P++   Y AVG ASWY
Sbjct: 52  YFAESKYGVKASPRVVYGKGQPMPRGGGRDQTGKPYQVKGRWYYPKEDKNYTAVGRASWY 111

Query: 96  GKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLI 155
           G+AFHGRLTANGEVY   ++TAAHPT+PLPSY RVTN++ G S++VRVNDRGPY  +R+I
Sbjct: 112 GEAFHGRLTANGEVYDMTHLTAAHPTMPLPSYARVTNLDTGSSVIVRVNDRGPYEYDRVI 171

Query: 156 DLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYL 193
           DLS  AA++L  +  G + V VEY+G A L G D  +L
Sbjct: 172 DLSWKAAEMLDYQHHGTANVKVEYVGRAPLEGNDDAFL 209


>gi|209885252|ref|YP_002289109.1| rare lipoprotein A [Oligotropha carboxidovorans OM5]
 gi|209873448|gb|ACI93244.1| rare lipoprotein A [Oligotropha carboxidovorans OM5]
          Length = 270

 Score =  198 bits (503), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 131/210 (62%), Gaps = 1/210 (0%)

Query: 15  VCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVS-GKRVPRGGGRYFLGKPYQI 73
           VC ++LG   C   +     K     +  YGV++S R+V   + VP+GGG Y +GKPY++
Sbjct: 10  VCQLMLGAGVCLLLANCAPGKFANRFDPKYGVSSSPRVVDFDQPVPKGGGTYRVGKPYKV 69

Query: 74  MGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNM 133
            GR YVP +   Y A G+ASWYG  FHGRLTANGEV+    +TAAHPTLP+PSYVRVTN 
Sbjct: 70  AGRTYVPEENLNYRADGLASWYGDDFHGRLTANGEVFDMTSLTAAHPTLPMPSYVRVTNT 129

Query: 134 ENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYL 193
            NG SL+VRVNDRGPYH NR+ID+S+ AA +L     GV++V VEY+G A L G D   L
Sbjct: 130 ANGKSLIVRVNDRGPYHGNRIIDVSHRAATLLDFRGHGVARVRVEYVGRAPLEGSDDALL 189

Query: 194 RSTVMVNSATVLPLGCQYREEIVVIPYLLT 223
            +T+  N     P   +       +P + T
Sbjct: 190 VATLRTNQPAPAPSSIRIASAAPFVPQMPT 219


>gi|225852495|ref|YP_002732728.1| rare lipoprotein A [Brucella melitensis ATCC 23457]
 gi|225640860|gb|ACO00774.1| rare lipoprotein A [Brucella melitensis ATCC 23457]
 gi|326409011|gb|ADZ66076.1| rare lipoprotein A [Brucella melitensis M28]
 gi|326538721|gb|ADZ86936.1| rare lipoprotein A [Brucella melitensis M5-90]
          Length = 421

 Score =  198 bits (503), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 96/158 (60%), Positives = 117/158 (74%), Gaps = 2/158 (1%)

Query: 38  YFPESMYGVTASDRIVSGKR--VPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWY 95
           YF ES YGV AS R+V GK   +PRGGGR   GKPYQ+ GRWY P++   Y AVG ASWY
Sbjct: 54  YFAESKYGVKASPRVVYGKGQPMPRGGGRDQTGKPYQVKGRWYYPKEDKNYTAVGRASWY 113

Query: 96  GKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLI 155
           G+AFHGRLTANGEVY   ++TAAHPT+PLPSY RVTN++ G S++VRVNDRGPY  +R+I
Sbjct: 114 GEAFHGRLTANGEVYDMTHLTAAHPTMPLPSYARVTNLDTGSSVIVRVNDRGPYEYDRVI 173

Query: 156 DLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYL 193
           DLS  AA++L  +  G + V VEY+G A L G D  +L
Sbjct: 174 DLSWKAAEMLDYQHHGTANVKVEYVGRAPLEGNDDAFL 211


>gi|265999473|ref|ZP_05466546.2| rare lipoprotein A [Brucella melitensis bv. 2 str. 63/9]
 gi|263094157|gb|EEZ18079.1| rare lipoprotein A [Brucella melitensis bv. 2 str. 63/9]
          Length = 419

 Score =  198 bits (503), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 96/158 (60%), Positives = 117/158 (74%), Gaps = 2/158 (1%)

Query: 38  YFPESMYGVTASDRIVSGKR--VPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWY 95
           YF ES YGV AS R+V GK   +PRGGGR   GKPYQ+ GRWY P++   Y AVG ASWY
Sbjct: 52  YFAESKYGVKASPRVVYGKGQPMPRGGGRDQTGKPYQVKGRWYYPKEDKNYTAVGRASWY 111

Query: 96  GKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLI 155
           G+AFHGRLTANGEVY   ++TAAHPT+PLPSY RVTN++ G S++VRVNDRGPY  +R+I
Sbjct: 112 GEAFHGRLTANGEVYDMTHLTAAHPTMPLPSYARVTNLDTGSSVIVRVNDRGPYEYDRVI 171

Query: 156 DLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYL 193
           DLS  AA++L  +  G + V VEY+G A L G D  +L
Sbjct: 172 DLSWKAAEMLDYQHHGTANVKVEYVGRAPLEGNDDAFL 209


>gi|260459468|ref|ZP_05807723.1| rare lipoprotein A [Mesorhizobium opportunistum WSM2075]
 gi|259035022|gb|EEW36278.1| rare lipoprotein A [Mesorhizobium opportunistum WSM2075]
          Length = 373

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 118/160 (73%), Gaps = 3/160 (1%)

Query: 37  EYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYG 96
           EYF E+ YGV AS R    +R   GGGR  LGKPYQ+ G+WY P++   YA VG+ASWYG
Sbjct: 10  EYFAETEYGVKASPRAAFMRR---GGGRDQLGKPYQVRGKWYYPKEDKRYAKVGLASWYG 66

Query: 97  KAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLID 156
            AFHGRLTANGEVY   ++TAAHPT+PLPSY RVTN+E G S++VRVNDRGPYH  R+ID
Sbjct: 67  DAFHGRLTANGEVYDMTHLTAAHPTMPLPSYARVTNIETGSSVIVRVNDRGPYHEGRIID 126

Query: 157 LSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRST 196
           +S  AA++L   + G +KV VEY+G A L G D +YL ++
Sbjct: 127 VSERAAQMLDYAKVGTAKVKVEYVGRAPLEGDDDQYLMAS 166


>gi|85715535|ref|ZP_01046516.1| rare lipoprotein A [Nitrobacter sp. Nb-311A]
 gi|85697730|gb|EAQ35606.1| rare lipoprotein A [Nitrobacter sp. Nb-311A]
          Length = 287

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 100/189 (52%), Positives = 126/189 (66%), Gaps = 1/189 (0%)

Query: 41  ESMYGVTASDRIV-SGKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAF 99
           +  YGV++S R+V SG+ VP+GGG Y +GKPY + GR YVP + T Y A G+ASWYG AF
Sbjct: 15  DPKYGVSSSPRVVASGEPVPKGGGTYRVGKPYTVAGRVYVPEENTKYRAEGLASWYGDAF 74

Query: 100 HGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSN 159
           HGRLTANGEV+    ++AAHPTLPLP YVRVTN+ N  SLVVRVNDRGPYH NRLID+SN
Sbjct: 75  HGRLTANGEVFDMASLSAAHPTLPLPCYVRVTNLGNKKSLVVRVNDRGPYHGNRLIDVSN 134

Query: 160 AAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNSATVLPLGCQYREEIVVIP 219
            AA++L  +  GV+ V VEY+G A L G D   L +T+        P   +       +P
Sbjct: 135 KAAELLEFKRNGVAAVRVEYVGRAPLEGSDDRQLMATLRTGVPAPSPSTVRIASARPFVP 194

Query: 220 YLLTRSRTV 228
            L    R++
Sbjct: 195 ELAPSERSI 203


>gi|75675658|ref|YP_318079.1| rare lipoprotein A [Nitrobacter winogradskyi Nb-255]
 gi|74420528|gb|ABA04727.1| rare lipoprotein A [Nitrobacter winogradskyi Nb-255]
          Length = 279

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 112/240 (46%), Positives = 144/240 (60%), Gaps = 14/240 (5%)

Query: 44  YGVTASDRIV-SGKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGR 102
           YGV++S R+V SG  VP+GGG Y +GKPY + GR YVP++ T Y A G+ASWYG AFHGR
Sbjct: 41  YGVSSSPRVVASGDTVPKGGGTYRIGKPYTVAGRVYVPQENTKYKAEGLASWYGDAFHGR 100

Query: 103 LTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAA 162
           LTANGEV+    ++AAHPTLPLP YVRVTN+ N  SLVVRVNDRGPYH NRLID+SN AA
Sbjct: 101 LTANGEVFDMASLSAAHPTLPLPCYVRVTNLGNSKSLVVRVNDRGPYHGNRLIDVSNKAA 160

Query: 163 KILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNSATVLPLGCQYREEIVVIPYL- 221
           ++L  +  GV+ V VEY+G A L G D   L +T+        P   +       +P L 
Sbjct: 161 ELLEFKRNGVAPVRVEYVGRAPLEGSDDRQLMATLRTGVPAPSPSTVRVASARPFVPELR 220

Query: 222 -----LTRSRTVHLNNCDDDSLQKQREISLRERKKSNLIPLPNGYSPPRKMGKIPIPSRF 276
                 + S  V  +  + D    +RE+S  E   +  +     Y+P  + G    PS F
Sbjct: 221 PSIGETSASSRVSTHRQESDG---RREVSYGEGDVTGRVHPVAAYAPADQSG----PSEF 273


>gi|115524868|ref|YP_781779.1| rare lipoprotein A [Rhodopseudomonas palustris BisA53]
 gi|115518815|gb|ABJ06799.1| rare lipoprotein A [Rhodopseudomonas palustris BisA53]
          Length = 310

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 94/155 (60%), Positives = 118/155 (76%), Gaps = 1/155 (0%)

Query: 44  YGVTASDRIVS-GKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGR 102
           YGV+AS R+V  G+ VP+GGG Y +GKPY + GR YVP +   Y A G+ASWYG  FHGR
Sbjct: 42  YGVSASPRVVEPGEPVPKGGGTYRVGKPYMVAGRMYVPEENVNYRAEGLASWYGDDFHGR 101

Query: 103 LTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAA 162
           LTANGEV+  E +TAAHPTLP+PSY RVTN++NG S++VRVNDRGPYH NRL+D+SN AA
Sbjct: 102 LTANGEVFDMESLTAAHPTLPIPSYARVTNIKNGKSVIVRVNDRGPYHGNRLMDVSNRAA 161

Query: 163 KILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTV 197
           ++L  +  GV+KV VEY+G A L G D   L +T+
Sbjct: 162 ELLEFKHHGVAKVRVEYVGRAPLEGSDDRQLMATL 196


>gi|254469467|ref|ZP_05082872.1| rare lipoprotein A [Pseudovibrio sp. JE062]
 gi|211961302|gb|EEA96497.1| rare lipoprotein A [Pseudovibrio sp. JE062]
          Length = 380

 Score =  196 bits (497), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 126/180 (70%), Gaps = 6/180 (3%)

Query: 15  VCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSG-KRVPRGGGRYFLGKPYQI 73
           V  +  G+++C   +    DK++ F E  YGV AS R+V G K VP+GGGR  +GKPY++
Sbjct: 28  VVALCAGIAACGGGT----DKVK-FSEKKYGVAASPRVVKGSKPVPKGGGRAVVGKPYKV 82

Query: 74  MGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNM 133
            G+WY P++   Y   G ASWYG  FHGR TANGE++    +TAAHPT+PLPSY +VTN+
Sbjct: 83  AGKWYYPKRDDNYKKTGKASWYGPTFHGRKTANGEIFDRNALTAAHPTMPLPSYAKVTNL 142

Query: 134 ENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYL 193
           +NG S+VVRVNDRGP+H NR+IDLS   A +L  +  GV+KV VEY+G A L+G D++ L
Sbjct: 143 QNGKSMVVRVNDRGPFHDNRIIDLSERVAGMLGTKSSGVAKVRVEYVGRAPLHGRDEKKL 202


>gi|307942277|ref|ZP_07657628.1| rare lipoprotein A [Roseibium sp. TrichSKD4]
 gi|307774563|gb|EFO33773.1| rare lipoprotein A [Roseibium sp. TrichSKD4]
          Length = 374

 Score =  195 bits (496), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 98/197 (49%), Positives = 134/197 (68%), Gaps = 4/197 (2%)

Query: 3   RFSCDCLLK--GSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVS-GKRVP 59
           R    CL +  G  V V V+        ST +  K ++ P+  YGV  S ++V+ G+ VP
Sbjct: 24  RTGQKCLFRICGRTVAVAVIAGLVAACGSTPESPKAKFSPKK-YGVKGSPKMVAKGEPVP 82

Query: 60  RGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAH 119
           +GGGRY +GK Y+I G+WY P+    Y  VG+ASWYG  FHGR TANGEV+    +TAAH
Sbjct: 83  KGGGRYVVGKKYKIAGKWYYPKHDPDYKNVGLASWYGPTFHGRKTANGEVFDRYGLTAAH 142

Query: 120 PTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEY 179
            T+PLPSY RVTN++NG S++VRVNDRGP+H NR+IDLS   A +L  ++ GV+KV VEY
Sbjct: 143 TTMPLPSYARVTNVKNGRSMIVRVNDRGPFHGNRIIDLSERVADMLGTKQGGVAKVKVEY 202

Query: 180 LGMALLNGMDQEYLRST 196
           +G A L+G+D++YL ++
Sbjct: 203 VGKARLDGLDEKYLMAS 219


>gi|158423795|ref|YP_001525087.1| rare lipoprotein A [Azorhizobium caulinodans ORS 571]
 gi|158330684|dbj|BAF88169.1| rare lipoprotein A [Azorhizobium caulinodans ORS 571]
          Length = 393

 Score =  194 bits (494), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 104/219 (47%), Positives = 143/219 (65%), Gaps = 16/219 (7%)

Query: 11  KGSV-VCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVS-GKRVPRGGGRYFLG 68
           +G+V V V+ L +++C  +      KL    +  YGV+AS ++V+ G+ VP+GGG Y +G
Sbjct: 69  RGTVGVAVLCLSLAACSSAG-----KLASQIDPKYGVSASPKVVADGQPVPKGGGTYRVG 123

Query: 69  KPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           KPY I GR YVP++   Y A G+ASWYG  FHGRLTANGEV+    I+AAHPTLP+PSYV
Sbjct: 124 KPYVIAGRTYVPQENPDYKAEGVASWYGDDFHGRLTANGEVFDRTSISAAHPTLPMPSYV 183

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGM 188
           RVTN++NG S++VR+NDRGPYH NR+ID+S+  A +L    +GV++V VEY+G A L+G 
Sbjct: 184 RVTNIQNGRSIIVRINDRGPYHQNRVIDVSHRTADLLGFSSKGVARVKVEYVGRAPLDGS 243

Query: 189 DQEYLRST---------VMVNSATVLPLGCQYREEIVVI 218
           D   L +T         V  NSA  +     +  EI  +
Sbjct: 244 DDRKLVATLRDDGYPAQVPANSAVQVASAAPFVPEIAPV 282


>gi|91977183|ref|YP_569842.1| rare lipoprotein A [Rhodopseudomonas palustris BisB5]
 gi|91683639|gb|ABE39941.1| rare lipoprotein A [Rhodopseudomonas palustris BisB5]
          Length = 314

 Score =  194 bits (494), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 96/179 (53%), Positives = 121/179 (67%), Gaps = 1/179 (0%)

Query: 44  YGVTASDRIVS-GKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGR 102
           YGV++S R+V  G+ VP+GGG Y +GKPY + GR YVP + T+Y A G+ASWYG  FHGR
Sbjct: 41  YGVSSSPRVVGPGEPVPKGGGAYRVGKPYMVAGRMYVPEENTSYRAEGLASWYGNDFHGR 100

Query: 103 LTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAA 162
           LTANGEV+    ++AAHPTLP+PSY RVTN+ NG SLVVRVNDRGPYH NRLID+SN AA
Sbjct: 101 LTANGEVFDMASLSAAHPTLPIPSYARVTNLGNGRSLVVRVNDRGPYHGNRLIDVSNRAA 160

Query: 163 KILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNSATVLPLGCQYREEIVVIPYL 221
            +L  +  G ++V VEY+G A L G D   L +T+  N     P   +       +P  
Sbjct: 161 DLLDFKRNGTARVRVEYVGRAPLEGSDDRQLVATLRSNEPAPAPSTVRIASASAFVPQF 219


>gi|27379632|ref|NP_771161.1| rare lipoprotein A [Bradyrhizobium japonicum USDA 110]
 gi|27352784|dbj|BAC49786.1| bll4521 [Bradyrhizobium japonicum USDA 110]
          Length = 376

 Score =  194 bits (494), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 99/187 (52%), Positives = 125/187 (66%), Gaps = 1/187 (0%)

Query: 41  ESMYGVTASDRIVS-GKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAF 99
           +  YGV++S R+V+ G  VP+GGG Y +GKPY + GR YVP +   Y A GMASWYG  F
Sbjct: 104 DPKYGVSSSPRVVALGDPVPKGGGTYRVGKPYVVAGRTYVPEEDVNYRAEGMASWYGDDF 163

Query: 100 HGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSN 159
           HGRLTANGEV+    +TAAHPTLP+PSY RVTN+ NG SL+VRVNDRGPYH NRLID+SN
Sbjct: 164 HGRLTANGEVFDMASLTAAHPTLPMPSYARVTNISNGKSLIVRVNDRGPYHGNRLIDVSN 223

Query: 160 AAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNSATVLPLGCQYREEIVVIP 219
            AA++L  +  GV+KV VEY+G A L G D   L +T+        P   +       +P
Sbjct: 224 KAAELLEFKGNGVAKVRVEYVGRAPLEGSDDRQLMATLRTGIPAPSPSMVRVASARPFVP 283

Query: 220 YLLTRSR 226
            L + +R
Sbjct: 284 ELPSSNR 290


>gi|148255493|ref|YP_001240078.1| hypothetical protein BBta_4106 [Bradyrhizobium sp. BTAi1]
 gi|146407666|gb|ABQ36172.1| hypothetical protein BBta_4106 [Bradyrhizobium sp. BTAi1]
          Length = 283

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 110/236 (46%), Positives = 142/236 (60%), Gaps = 20/236 (8%)

Query: 44  YGVTASDRIVS-GKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGR 102
           YGV++S R+V  G+ VP+GGG Y +GKPY + G+ YVP + T Y A GMASWYG  FHGR
Sbjct: 19  YGVSSSPRVVGFGEPVPKGGGVYRVGKPYTVAGKTYVPEEDTNYRAEGMASWYGDDFHGR 78

Query: 103 LTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAA 162
           LTANGEV+    +TAAHPTLP+PSY RVTN+ NG SL+VRVNDRGPYH+NRLID+SN AA
Sbjct: 79  LTANGEVFDMASLTAAHPTLPMPSYARVTNLANGKSLIVRVNDRGPYHANRLIDVSNKAA 138

Query: 163 KILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTV----------MVNSATVLPL----- 207
            +L  +  GV++V VEY+G A L G D   L +T+          +V  A+  P      
Sbjct: 139 DLLEFKGTGVARVRVEYVGRAPLEGSDDVQLMATLRTGIPAPAPSLVRVASAKPFVPDVG 198

Query: 208 -GCQYREEIVVIPYLLTRSRTVHLNNCDDDSLQKQREISLRERKKSNLIPLPNGYS 262
            G   R E   +P    R  T+   + D  S+    E+S   R +   +  P   S
Sbjct: 199 AGRPIRGE---VPLPEGRPYTLGNGSADLASIAATSEMSASSRTRGRSLDNPRAVS 251


>gi|299133892|ref|ZP_07027086.1| rare lipoprotein A [Afipia sp. 1NLS2]
 gi|298591728|gb|EFI51929.1| rare lipoprotein A [Afipia sp. 1NLS2]
          Length = 296

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 96/182 (52%), Positives = 121/182 (66%), Gaps = 1/182 (0%)

Query: 41  ESMYGVTASDRIVS-GKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAF 99
           +  YGV +S R+V   + VP+GGG Y +GKPYQ+ GR YVP + T Y A G+ASWYG  F
Sbjct: 59  DPKYGVPSSPRVVDFDQPVPKGGGTYRVGKPYQVAGRTYVPEENTHYRAEGLASWYGDDF 118

Query: 100 HGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSN 159
           HGRLTANGEV+    ITAAHPTLP+P YVRVTN  NG SL+VRVNDRGPYH NR+ID+S+
Sbjct: 119 HGRLTANGEVFDMTSITAAHPTLPMPCYVRVTNTANGKSLIVRVNDRGPYHGNRIIDVSH 178

Query: 160 AAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNSATVLPLGCQYREEIVVIP 219
            AA +L  +  GV++V VEY+G A L G D   L +T+  N     P   +       +P
Sbjct: 179 RAATLLGFQGNGVARVRVEYVGRAPLEGSDDAMLVATLRTNEPAPAPSSIRLASAAAFVP 238

Query: 220 YL 221
            +
Sbjct: 239 QM 240


>gi|86749793|ref|YP_486289.1| rare lipoprotein A [Rhodopseudomonas palustris HaA2]
 gi|86572821|gb|ABD07378.1| rare lipoprotein A [Rhodopseudomonas palustris HaA2]
          Length = 314

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 117/164 (71%), Gaps = 1/164 (0%)

Query: 44  YGVTASDRIVS-GKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGR 102
           YGV+ S R+V+ G+ VP+GGG Y +GKPY + GR YVP +   Y A G+ASWYG  FHGR
Sbjct: 41  YGVSTSPRVVAMGEPVPKGGGTYRIGKPYVVGGRTYVPEEDANYRAEGLASWYGDNFHGR 100

Query: 103 LTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAA 162
           LTANGEV+    ++AAHPTLP+PSY RVTN+ NG SLVVRVNDRGPYH NRLID+SN AA
Sbjct: 101 LTANGEVFDMASLSAAHPTLPIPSYARVTNLSNGRSLVVRVNDRGPYHGNRLIDVSNRAA 160

Query: 163 KILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNSATVLP 206
            +L  + +G ++V VEY+G A L G D   L +T+  N     P
Sbjct: 161 DLLEFKHKGTARVRVEYVGRAPLEGSDDRQLVATLRTNEPAPAP 204


>gi|298291752|ref|YP_003693691.1| lipoprotein A [Starkeya novella DSM 506]
 gi|296928263|gb|ADH89072.1| rare lipoprotein A [Starkeya novella DSM 506]
          Length = 357

 Score =  192 bits (488), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 130/189 (68%), Gaps = 6/189 (3%)

Query: 13  SVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVS-GKRVPRGGGRYFLGKPY 71
           + +C + L +++C        +KL    +  YGV+AS R+++ G+ VP+GGG Y +GKPY
Sbjct: 27  AALCGIGLVVANC-----SGGNKLSSRIDPKYGVSASPRVIAFGQPVPKGGGTYRVGKPY 81

Query: 72  QIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVT 131
            + G+ YVP + T Y   G+ASWYG  FHGRLTANGE++    I AAHPTLP+PSYVRVT
Sbjct: 82  VVAGKTYVPAEPTNYRTEGLASWYGDDFHGRLTANGEIFDMHSIAAAHPTLPMPSYVRVT 141

Query: 132 NMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQE 191
           N++NG S+VVRVNDRGPYH NR+ID+S  AA +L  + RG ++V VEY+G A L G D  
Sbjct: 142 NVQNGRSMVVRVNDRGPYHGNRVIDVSQRAADLLGFKGRGTARVRVEYVGRAPLEGSDDV 201

Query: 192 YLRSTVMVN 200
            L ST+  N
Sbjct: 202 QLASTLRTN 210


>gi|146340764|ref|YP_001205812.1| rare lipoprotein A family protein (rlpA) [Bradyrhizobium sp.
           ORS278]
 gi|146193570|emb|CAL77587.1| conserved hypothetical protein; possible RARE lipoprotein A family
           protein (rlpA) [Bradyrhizobium sp. ORS278]
          Length = 283

 Score =  191 bits (486), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 117/158 (74%), Gaps = 1/158 (0%)

Query: 41  ESMYGVTASDRIVS-GKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAF 99
           +  YGV++S R+V  G+ VP+GGG Y +GKPY + G+ YVP +   Y A GMASWYG  F
Sbjct: 16  DPKYGVSSSPRVVGFGEPVPKGGGVYRIGKPYTVAGKTYVPEEDVNYRAEGMASWYGDDF 75

Query: 100 HGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSN 159
           HGRLTANGEV+    +TAAHPTLP+PSY RVTN+ NG SL+VR+NDRGPYH+NRLID+SN
Sbjct: 76  HGRLTANGEVFDMTSLTAAHPTLPMPSYARVTNLANGKSLIVRINDRGPYHANRLIDVSN 135

Query: 160 AAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTV 197
            AA +L  +  GV++V VEY+G A L G D   L +T+
Sbjct: 136 KAADLLEFKGSGVARVRVEYVGRAPLEGSDDTQLIATL 173


>gi|316934066|ref|YP_004109048.1| rare lipoprotein A [Rhodopseudomonas palustris DX-1]
 gi|315601780|gb|ADU44315.1| rare lipoprotein A [Rhodopseudomonas palustris DX-1]
          Length = 307

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 130/210 (61%), Gaps = 11/210 (5%)

Query: 13  SVVCVVVLGMSSCFFSSTYK--DDKLEYFPESMYGVTASDRIVS-GKRVPRGGGRYFLGK 69
           +V     L +++C  + T+   D K        YGV++S R+V+ G+ VP+GGG + +GK
Sbjct: 8   AVAASACLALANCAQNGTFSRVDPK--------YGVSSSPRVVAFGEPVPKGGGTFRVGK 59

Query: 70  PYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           PY + GR YVP     Y A G ASWYG  FHGRLTANGEV+    ++AAHPTLP+PSY R
Sbjct: 60  PYVVAGRTYVPEDNPNYRAEGQASWYGNDFHGRLTANGEVFDMASLSAAHPTLPIPSYAR 119

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN+ NG SL+VR+NDRGPYH NRLID+S  AA++L    +G ++V VEY+G A L G D
Sbjct: 120 VTNLANGRSLIVRINDRGPYHGNRLIDVSKKAAELLEFRHKGTARVRVEYVGRAPLEGSD 179

Query: 190 QEYLRSTVMVNSATVLPLGCQYREEIVVIP 219
              L +T+        P G +       +P
Sbjct: 180 DRQLMATLRQGEPAPAPTGIRIASAKPFVP 209


>gi|254504355|ref|ZP_05116506.1| putative rare lipoprotein A double-psi beta-barrel [Labrenzia
           alexandrii DFL-11]
 gi|222440426|gb|EEE47105.1| putative rare lipoprotein A double-psi beta-barrel [Labrenzia
           alexandrii DFL-11]
          Length = 366

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 119/164 (72%), Gaps = 2/164 (1%)

Query: 34  DKLEYFPESMYGVTASDRIVS-GKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMA 92
           +K ++ P+  YGV  S ++V+ GK VP+GGGRY +GK Y+I G+WY P+    Y  VG++
Sbjct: 58  EKAKFSPKK-YGVKGSPKVVAAGKPVPKGGGRYVVGKKYKIAGKWYYPKHEPNYKNVGLS 116

Query: 93  SWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSN 152
           SWYG  FHGR TANGEV+    +TAAH T+PLPSY RVTN+ NG S++VRVNDRGP+H N
Sbjct: 117 SWYGPTFHGRKTANGEVFDRNALTAAHTTMPLPSYARVTNLNNGRSMIVRVNDRGPFHGN 176

Query: 153 RLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRST 196
           R+IDLS   A +L  +  GV+KV VEY+G A L+G D+ YL ++
Sbjct: 177 RIIDLSERVANMLDTKSAGVAKVKVEYVGRAPLHGQDETYLMAS 220


>gi|118589858|ref|ZP_01547262.1| Rare lipoprotein A [Stappia aggregata IAM 12614]
 gi|118437355|gb|EAV43992.1| Rare lipoprotein A [Stappia aggregata IAM 12614]
          Length = 347

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 89/165 (53%), Positives = 118/165 (71%), Gaps = 2/165 (1%)

Query: 33  DDKLEYFPESMYGVTASDRIVS-GKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGM 91
             K ++ PE  YGV  S R+V+ G+ VP+GGGRY +GK Y+I G+WY P++   Y   G+
Sbjct: 18  QQKSKFSPEK-YGVKGSPRMVAEGQPVPKGGGRYIVGKKYKIAGKWYYPKEDPDYKRTGL 76

Query: 92  ASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHS 151
           ASWYG  FHGR TANGE++    +TAAH T+PLPSY RVTN+ENG S++VRVNDRGP+H 
Sbjct: 77  ASWYGPTFHGRKTANGEIFDRNSLTAAHTTMPLPSYARVTNVENGRSMIVRVNDRGPFHG 136

Query: 152 NRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRST 196
           NR+IDLS  AA +L  +  G+ KV VEY+G A L+G D  +L ++
Sbjct: 137 NRVIDLSERAATMLGTKSAGIGKVKVEYVGRAPLHGQDDAFLMAS 181


>gi|163852804|ref|YP_001640847.1| rare lipoprotein A [Methylobacterium extorquens PA1]
 gi|163664409|gb|ABY31776.1| rare lipoprotein A [Methylobacterium extorquens PA1]
          Length = 474

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 95/191 (49%), Positives = 124/191 (64%), Gaps = 4/191 (2%)

Query: 14  VVCVVVLGMSSCFFSSTYKDDKLEYFPE--SMYGVTASDRIVS-GKRVPRGGGRYFLGKP 70
            VC V L  ++C  +            E  S YGV AS R+ + G  +P+GGGR F GKP
Sbjct: 35  AVCAVALTTANCANNPAKLAGGASSGSEIDSKYGVKASRRLYNEGDVIPKGGGRRFSGKP 94

Query: 71  YQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + G+ YVPR+    Y   G+ASWYG AFHGR+TANGEV+    I AAHPTLPLPSYVR
Sbjct: 95  YVVAGKTYVPREDARGYVREGLASWYGSAFHGRVTANGEVFDRHSIAAAHPTLPLPSYVR 154

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN++NG S+++RVNDRGPYH+NRL+D+S  AA+ L    +G ++V VEY G A + G D
Sbjct: 155 VTNLDNGHSMILRVNDRGPYHANRLMDVSEEAARALEFHRKGTARVRVEYAGKASVAGSD 214

Query: 190 QEYLRSTVMVN 200
              L +T+  +
Sbjct: 215 DRKLLATLRTD 225


>gi|218531630|ref|YP_002422446.1| lipoprotein A [Methylobacterium chloromethanicum CM4]
 gi|218523933|gb|ACK84518.1| rare lipoprotein A [Methylobacterium chloromethanicum CM4]
          Length = 455

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 125/193 (64%), Gaps = 8/193 (4%)

Query: 14  VVCVVVLGMSSCFFSSTY----KDDKLEYFPESMYGVTASDRIVS-GKRVPRGGGRYFLG 68
            VC V L  ++C  +            E  P+  YGV AS R+ + G  +P+GGGR F G
Sbjct: 16  AVCAVALTTANCANNPAKLAGGASSGSEIDPK--YGVKASRRLYNEGDVIPKGGGRRFSG 73

Query: 69  KPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY + G+ YVPR+    Y   G+ASWYG AFHGR+TANGEV+    I AAHPTLPLPSY
Sbjct: 74  KPYVVAGKTYVPREDARGYVREGLASWYGSAFHGRVTANGEVFDRHSIAAAHPTLPLPSY 133

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
           VRVTN++NG S+++RVNDRGPYH+NRL+D+S  AA+ L    +G ++V VEY G A + G
Sbjct: 134 VRVTNLDNGHSMILRVNDRGPYHANRLMDVSEEAARALEFHRKGTARVRVEYAGKASVAG 193

Query: 188 MDQEYLRSTVMVN 200
            D   L +T+  +
Sbjct: 194 SDDRKLLATLRTD 206


>gi|254562569|ref|YP_003069664.1| rare lipoprotein A family protein [Methylobacterium extorquens DM4]
 gi|254269847|emb|CAX25825.1| rare lipoprotein A family protein [Methylobacterium extorquens DM4]
          Length = 474

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 125/193 (64%), Gaps = 8/193 (4%)

Query: 14  VVCVVVLGMSSCFFSSTY----KDDKLEYFPESMYGVTASDRIVS-GKRVPRGGGRYFLG 68
            VC V L  ++C  +            E  P+  YGV AS R+ + G  +P+GGGR F G
Sbjct: 35  AVCAVALTTANCANNPAKLAGGASSGSEIDPK--YGVKASRRLYNEGDVIPKGGGRRFSG 92

Query: 69  KPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY + G+ YVPR+    Y   G+ASWYG AFHGR+TANGEV+    I AAHPTLPLPSY
Sbjct: 93  KPYVVAGKTYVPREDARGYVREGLASWYGSAFHGRVTANGEVFDRHSIAAAHPTLPLPSY 152

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
           VRVTN++NG S+++RVNDRGPYH+NRL+D+S  AA+ L    +G ++V VEY G A + G
Sbjct: 153 VRVTNLDNGHSMILRVNDRGPYHANRLMDVSEEAARALEFHRKGTARVRVEYAGKASVAG 212

Query: 188 MDQEYLRSTVMVN 200
            D   L +T+  +
Sbjct: 213 SDDRKLLATLRTD 225


>gi|240140131|ref|YP_002964608.1| rare lipoprotein A family protein [Methylobacterium extorquens AM1]
 gi|240010105|gb|ACS41331.1| rare lipoprotein A family protein [Methylobacterium extorquens AM1]
          Length = 446

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 125/193 (64%), Gaps = 8/193 (4%)

Query: 14  VVCVVVLGMSSCFFSSTY----KDDKLEYFPESMYGVTASDRIVS-GKRVPRGGGRYFLG 68
            VC V L  ++C  +            E  P+  YGV AS R+ + G  +P+GGGR F G
Sbjct: 12  AVCAVALTTANCANNPAKLAGGASSGSEIDPK--YGVKASRRLYNEGDVIPKGGGRRFSG 69

Query: 69  KPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY + G+ YVPR+    Y   G+ASWYG AFHGR+TANGEV+    I AAHPTLPLPSY
Sbjct: 70  KPYVVAGKTYVPREDARGYVREGLASWYGSAFHGRVTANGEVFDRHSIAAAHPTLPLPSY 129

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
           VRVTN++NG S+++RVNDRGPYH+NRL+D+S  AA+ L    +G ++V VEY G A + G
Sbjct: 130 VRVTNLDNGHSMILRVNDRGPYHANRLMDVSEEAARALEFHRKGTARVRVEYAGKASVAG 189

Query: 188 MDQEYLRSTVMVN 200
            D   L +T+  +
Sbjct: 190 SDDRKLLATLRTD 202


>gi|90424199|ref|YP_532569.1| rare lipoprotein A [Rhodopseudomonas palustris BisB18]
 gi|90106213|gb|ABD88250.1| rare lipoprotein A [Rhodopseudomonas palustris BisB18]
          Length = 312

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 123/186 (66%), Gaps = 1/186 (0%)

Query: 44  YGVTASDRIVS-GKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGR 102
           YGV+AS R+V  G+ VP+GGG Y +GKPY + G+ YVP +  AY   G+ASWYG  FHGR
Sbjct: 42  YGVSASPRVVEPGEPVPKGGGTYRVGKPYVVGGKMYVPEENLAYREEGLASWYGDDFHGR 101

Query: 103 LTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAA 162
           LTANGEV+    ++AAHPTLP+P Y RVTN++NG SL+VRVNDRGPYHSNRL+D+SN AA
Sbjct: 102 LTANGEVFDMASLSAAHPTLPMPCYARVTNLKNGKSLIVRVNDRGPYHSNRLMDVSNRAA 161

Query: 163 KILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNSATVLPLGCQYREEIVVIPYLL 222
           ++L  +  G ++V VEY+  A L G D   L +T+        P   +       +P + 
Sbjct: 162 ELLEFKNHGTARVRVEYVARAPLEGSDDRQLMATLRTGEPAPSPATVRVASARGFVPEMA 221

Query: 223 TRSRTV 228
             +R +
Sbjct: 222 APNRAL 227


>gi|217976732|ref|YP_002360879.1| rare lipoprotein A [Methylocella silvestris BL2]
 gi|217502108|gb|ACK49517.1| rare lipoprotein A [Methylocella silvestris BL2]
          Length = 341

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 115/169 (68%), Gaps = 1/169 (0%)

Query: 37  EYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYG 96
           EYFP S YG  ++  +  G+ VP GGG Y +GKPY I GR Y P +   Y+AVG+ASWYG
Sbjct: 68  EYFPSSKYGPASARVVADGEPVPHGGGAYMVGKPYTIAGRTYYPSEKR-YSAVGLASWYG 126

Query: 97  KAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLID 156
            AFHGR TANGEVY ++ I+AAHPT+PLP Y RVTN+ N  S+VVRVNDRGP+ +NR++D
Sbjct: 127 DAFHGRRTANGEVYDSQAISAAHPTMPLPCYARVTNLRNHRSIVVRVNDRGPFEANRIMD 186

Query: 157 LSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNSATVL 205
           +S   A  L     G +KV VEYL  A L+G D E L +T+ ++    L
Sbjct: 187 VSRRTADALEFRHIGTAKVKVEYLAAASLDGSDDEKLLATLRLDGPASL 235


>gi|304391673|ref|ZP_07373615.1| rare lipoprotein A protein [Ahrensia sp. R2A130]
 gi|303295902|gb|EFL90260.1| rare lipoprotein A protein [Ahrensia sp. R2A130]
          Length = 262

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 91/191 (47%), Positives = 124/191 (64%), Gaps = 6/191 (3%)

Query: 6   CDCLLKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRY 65
           C      S++  +  G    + +   K      F ES YGV AS R+ +   V +GGGR 
Sbjct: 23  CGGTANQSIIKAMPAGAGKPYINDETK------FSESAYGVAASPRVSTSLIVRKGGGRR 76

Query: 66  FLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLP 125
            +GKPY+I G+WYVP++   Y   G ASWYG  FHGRLTANGEVY    ++AAHPT PLP
Sbjct: 77  QVGKPYKIRGKWYVPKEEPGYDRRGQASWYGPNFHGRLTANGEVYDQFALSAAHPTFPLP 136

Query: 126 SYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALL 185
           SY RVTN++NG S+ VRVNDRGPYHS R+IDLS   +++L  +++G+  V V+++G A L
Sbjct: 137 SYARVTNVDNGRSVTVRVNDRGPYHSKRIIDLSAKGSELLGYQKQGIGNVRVQWIGHAPL 196

Query: 186 NGMDQEYLRST 196
           +G+D  YL ++
Sbjct: 197 HGLDAPYLEAS 207


>gi|188582820|ref|YP_001926265.1| rare lipoprotein A [Methylobacterium populi BJ001]
 gi|179346318|gb|ACB81730.1| rare lipoprotein A [Methylobacterium populi BJ001]
          Length = 468

 Score =  185 bits (470), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 127/200 (63%), Gaps = 12/200 (6%)

Query: 14  VVCVVVLGMSSC------FFSSTYKDDKLEYFPESMYGVTASDRIVS-GKRVPRGGGRYF 66
            VC V L  ++C      F       ++++      YGV AS R+ + G  +P+GGGR F
Sbjct: 35  AVCAVALTTANCANNPAKFAGGASSGNEVD----PKYGVKASRRLYNEGDVIPKGGGRRF 90

Query: 67  LGKPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLP 125
            GKPY + G+ YVPR+    Y   G+ASWYG AFHGR+TANGE++    I AAHPTLPLP
Sbjct: 91  SGKPYVVAGKTYVPREDARGYVREGLASWYGSAFHGRVTANGEIFDRHSIAAAHPTLPLP 150

Query: 126 SYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALL 185
           SYVRVTN++NG S+++RVNDRGPYH+ RL+D+S  AA+ L    +G ++V VEY G A +
Sbjct: 151 SYVRVTNLDNGHSMILRVNDRGPYHAGRLMDVSEEAARALEFHRKGTARVRVEYAGKASI 210

Query: 186 NGMDQEYLRSTVMVNSATVL 205
            G D   L +T+  + +  +
Sbjct: 211 AGSDDRKLLATLRTDGSPAV 230


>gi|163760150|ref|ZP_02167233.1| rare lipoprotein A [Hoeflea phototrophica DFL-43]
 gi|162282549|gb|EDQ32837.1| rare lipoprotein A [Hoeflea phototrophica DFL-43]
          Length = 321

 Score =  185 bits (469), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 85/158 (53%), Positives = 113/158 (71%)

Query: 39  FPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKA 98
           F  + YGV AS R+ + KR  +GGGR  +GKPY+I G+WY P++   Y   G+ASWYG  
Sbjct: 41  FAAAEYGVAASPRLTTAKRPKKGGGRSMVGKPYRIRGKWYTPKEEPGYDRAGLASWYGPN 100

Query: 99  FHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLS 158
           FHGRLTANGE+Y   +++AAHPT PLPSY RVTN +NG S+VVRVNDRGP+   R+IDLS
Sbjct: 101 FHGRLTANGEIYDQYHLSAAHPTFPLPSYARVTNKKNGNSVVVRVNDRGPFAHGRIIDLS 160

Query: 159 NAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRST 196
             AA++L ++  GV+ V V+Y+G A + G D  YL ++
Sbjct: 161 KQAAQLLDMKHEGVAAVRVQYIGRAPVEGDDTPYLMAS 198


>gi|182678514|ref|YP_001832660.1| rare lipoprotein A [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182634397|gb|ACB95171.1| rare lipoprotein A [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 383

 Score =  181 bits (460), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 110/161 (68%), Gaps = 1/161 (0%)

Query: 37  EYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYG 96
           EYFP S+YG  +   I  G+ VPRGGG Y +GKPY + G  Y P +      VG+ASWYG
Sbjct: 72  EYFPSSVYGKASPRVIADGQPVPRGGGTYLVGKPYTVAGHTYYPSEKHT-TKVGLASWYG 130

Query: 97  KAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLID 156
            AFHGR TANGE+Y  + +TAA PTLPLPSY RVTN+ N  S+VVRVNDRGP+ S+R++D
Sbjct: 131 DAFHGRRTANGEIYDRDAVTAASPTLPLPSYARVTNLRNHYSMVVRVNDRGPFASDRIMD 190

Query: 157 LSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTV 197
           +S+  A+ L     G +K+ VEYL  A LNG D + L +T+
Sbjct: 191 VSHTVAQALDFHRTGTAKIKVEYLSPASLNGSDDKILLATL 231


>gi|300023250|ref|YP_003755861.1| lipoprotein A [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525071|gb|ADJ23540.1| rare lipoprotein A [Hyphomicrobium denitrificans ATCC 51888]
          Length = 377

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 112/158 (70%), Gaps = 3/158 (1%)

Query: 39  FPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKA 98
           F E  YGV++S R+ + + VP+GGGRY LG PY++ GRWYVP +   Y   G+ASWYG  
Sbjct: 43  FSEDDYGVSSSPRVTASRNVPKGGGRYKLGSPYKVAGRWYVPHENPNYVESGVASWYGDD 102

Query: 99  FHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLS 158
           FHGR TANGEV+    +TAAHPT+PLPSY  VTN++NG  ++VRVNDRGPY  +R+IDLS
Sbjct: 103 FHGRKTANGEVFDAHALTAAHPTMPLPSYALVTNLDNGKRVLVRVNDRGPYVKDRIIDLS 162

Query: 159 NAAAKILRVEERGVSKVHVEYLGMALLNGMD---QEYL 193
            A+AK L     G ++V V+Y G A LNG D   ++YL
Sbjct: 163 YASAKELGYLNHGRARVKVQYAGRAPLNGNDSRERQYL 200


>gi|323136275|ref|ZP_08071357.1| rare lipoprotein A [Methylocystis sp. ATCC 49242]
 gi|322398349|gb|EFY00869.1| rare lipoprotein A [Methylocystis sp. ATCC 49242]
          Length = 344

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 98/216 (45%), Positives = 134/216 (62%), Gaps = 10/216 (4%)

Query: 1   MKRFSCDC-LLKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPES-----MYGVTASDRIVS 54
           MK F+ D   L+GS++ + +  ++ C  SST +  +      S      YGV AS R+++
Sbjct: 14  MKNFAPDIGRLRGSLLILSLGALAGC--SSTTQYPRYASLGGSGAIDPRYGVRASPRVIA 71

Query: 55  -GKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTE 113
            G+ VP+GGG + +GKPY+I GR Y P +   YAA G ASWYG  FHGR TANGE++  +
Sbjct: 72  DGEEVPKGGGSFMVGKPYKIAGRTYYPSE-KPYAATGTASWYGADFHGRRTANGEIFDRQ 130

Query: 114 YITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVS 173
            I+AAHPT+PLPSY RVTN+ N  S+VVRVNDRGPYH  R++D+S   A+ L     G +
Sbjct: 131 SISAAHPTMPLPSYARVTNLNNARSMVVRVNDRGPYHGGRVMDVSQRVAEALDFHRAGTA 190

Query: 174 KVHVEYLGMALLNGMDQEYLRSTVMVNSATVLPLGC 209
           KV VE++G A L G D   L +T+  +    L  G 
Sbjct: 191 KVRVEWIGRADLAGDDDAKLLATLRDDGPATLDSGA 226


>gi|90417677|ref|ZP_01225589.1| rare lipoprotein A family protein, putative [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90337349|gb|EAS51000.1| rare lipoprotein A family protein, putative [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 363

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 115/182 (63%), Gaps = 13/182 (7%)

Query: 39  FPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKA 98
           F    +GV AS RI + KRVP+GGGR  +GKPY++ G+WY P+    Y+  G ASWYG  
Sbjct: 34  FDSRTFGVPASPRITTAKRVPKGGGRSQVGKPYKVRGKWYYPKDDPGYSKSGTASWYGPN 93

Query: 99  FHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLS 158
           FHGRLTANGEVY    ++AAH T PLPSY  VTN+ENG  ++VRVNDRGP+   R IDLS
Sbjct: 94  FHGRLTANGEVYDMHGLSAAHKTFPLPSYAMVTNLENGSRVMVRVNDRGPFAHGREIDLS 153

Query: 159 NAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRS-------------TVMVNSATVL 205
             AAK+L  +  G ++V V+Y+G A L G D + L +             TVMV SA   
Sbjct: 154 AVAAKLLDFQHAGTAEVQVDYIGRAPLEGDDTQMLMASYVPAQGADPYGDTVMVASADDR 213

Query: 206 PL 207
           P+
Sbjct: 214 PI 215


>gi|296445857|ref|ZP_06887809.1| rare lipoprotein A [Methylosinus trichosporium OB3b]
 gi|296256685|gb|EFH03760.1| rare lipoprotein A [Methylosinus trichosporium OB3b]
          Length = 290

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 113/164 (68%), Gaps = 2/164 (1%)

Query: 44  YGVTASDRIVS-GKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGR 102
           YGV  S R+V+ G+ VPRGGG Y +GKPYQI GR Y P +    +++G+ASWYG  FHGR
Sbjct: 46  YGVAPSPRVVADGEPVPRGGGSYMVGKPYQIAGRTYYPSERP-NSSIGLASWYGSDFHGR 104

Query: 103 LTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAA 162
            TANGEV+  E I+AAHPT+PLPSY RVTN+ N  S++VRVNDRGPYH  R++D+S   A
Sbjct: 105 RTANGEVFDRESISAAHPTMPLPSYARVTNLRNHRSMIVRVNDRGPYHGGRVMDVSQRVA 164

Query: 163 KILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNSATVLP 206
           + L     G ++V V+Y+G A L G D E L +T+  +    LP
Sbjct: 165 EALDFHRVGTARVKVDYVGHASLAGSDDETLLATLRDDGPATLP 208


>gi|170747924|ref|YP_001754184.1| rare lipoprotein A [Methylobacterium radiotolerans JCM 2831]
 gi|170654446|gb|ACB23501.1| rare lipoprotein A [Methylobacterium radiotolerans JCM 2831]
          Length = 442

 Score =  176 bits (445), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 123/200 (61%), Gaps = 15/200 (7%)

Query: 14  VVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVS-GKRVPRGGGRYFLGKPYQ 72
            V  V L  ++C  S   K        +  YGV AS R+ + G  +P+GGGR + GKPY 
Sbjct: 18  AVSGVALATANCATSPQQKLAAGNGI-DPKYGVKASPRLYNEGDVIPKGGGRRYTGKPYV 76

Query: 73  IMGRWYVPRQY-TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVT 131
           + G+ YVP++    Y   G+ASWYG AFHGR+TANGEV+    I AAHPTLPLPSY RVT
Sbjct: 77  VAGQTYVPKENPNGYVREGLASWYGAAFHGRMTANGEVFDRHSIAAAHPTLPLPSYARVT 136

Query: 132 NMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQE 191
           N++NG S++VRVNDRGPYH+ R++D+S  AA  L    +G ++V VEY+G A + G D  
Sbjct: 137 NLDNGYSMLVRVNDRGPYHAGRVMDVSEEAADALGFHRKGTARVRVEYVGKASVAGSDDR 196

Query: 192 YL------------RSTVMV 199
            L            RSTVM+
Sbjct: 197 KLLASLRTDGRPAGRSTVMM 216


>gi|114704617|ref|ZP_01437525.1| putative rare lipoprotein a precursor [Fulvimarina pelagi HTCC2506]
 gi|114539402|gb|EAU42522.1| putative rare lipoprotein a precursor [Fulvimarina pelagi HTCC2506]
          Length = 349

 Score =  173 bits (438), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 83/157 (52%), Positives = 106/157 (67%), Gaps = 2/157 (1%)

Query: 39  FPESMYGVTASDRIV--SGKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYG 96
           F E+ YGV AS R+   + + + +GGGR  +GKPY+I G+WY P+    Y A GMASWYG
Sbjct: 33  FDEATYGVPASPRMAESTARNIKKGGGRSQVGKPYKIKGKWYYPKDDPGYVASGMASWYG 92

Query: 97  KAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLID 156
             FHGRLTANGE Y   +++AAH T PLPSY  VTN+ENG  + VRVNDRGP+   R ID
Sbjct: 93  PNFHGRLTANGETYDMHHLSAAHKTFPLPSYAMVTNLENGHRVKVRVNDRGPFAHAREID 152

Query: 157 LSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYL 193
           +S  AA++L  +  G ++V VEYLG A L G D + L
Sbjct: 153 VSKKAAELLDFKRSGTAEVRVEYLGRAPLEGDDSQML 189


>gi|170744321|ref|YP_001772976.1| rare lipoprotein A [Methylobacterium sp. 4-46]
 gi|168198595|gb|ACA20542.1| rare lipoprotein A [Methylobacterium sp. 4-46]
          Length = 394

 Score =  172 bits (437), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 108/162 (66%), Gaps = 2/162 (1%)

Query: 41  ESMYGVTASDRIVS-GKRVPRGGGRYFLGKPYQIMGRWYVPRQYT-AYAAVGMASWYGKA 98
           +  YGV  S R+      +P+GGGR  +GKPY + G  YVPR+    Y   G+ASWYG A
Sbjct: 49  DPKYGVVPSPRLYGENDPIPKGGGRAMVGKPYVVAGHTYVPRENPRGYVREGLASWYGTA 108

Query: 99  FHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLS 158
           FHGR TANGEV+    + AAHPTLPLPSY RVTN+ NG S+VVRVNDRGPYH+ RL+D+S
Sbjct: 109 FHGRQTANGEVFDRFSVAAAHPTLPLPSYARVTNLANGHSMVVRVNDRGPYHAGRLMDVS 168

Query: 159 NAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVN 200
              A+ L    RG ++V VEYLGMA + G D   L +T+  +
Sbjct: 169 ERVAEALEFHRRGTTRVRVEYLGMASVAGSDDRKLMATLRTD 210


>gi|319405646|emb|CBI79269.1| Rare lipoprotein A [Bartonella sp. AR 15-3]
          Length = 281

 Score =  172 bits (437), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 102/151 (67%), Gaps = 2/151 (1%)

Query: 45  GVTASDRIVSGKRVPRGG--GRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGR 102
            V+  +RI+S +   +     R  +GKPYQI G+WY P+    Y  VG ASWYG  FHGR
Sbjct: 54  AVSVPERILSEQNKSKNKVVKRAIIGKPYQIKGKWYYPKADPTYQRVGQASWYGSYFHGR 113

Query: 103 LTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAA 162
           LTANGEVY    +TAAHPT+PLPSY RVTN++NG S++VRVNDRGPY  NR+IDLS  AA
Sbjct: 114 LTANGEVYNMNLLTAAHPTMPLPSYARVTNLKNGSSIIVRVNDRGPYMKNRIIDLSKQAA 173

Query: 163 KILRVEERGVSKVHVEYLGMALLNGMDQEYL 193
            +L    +G + V VEY+  A +N  D EYL
Sbjct: 174 TMLGYLNQGTADVKVEYVSEAPINNYDSEYL 204


>gi|154248243|ref|YP_001419201.1| rare lipoprotein A [Xanthobacter autotrophicus Py2]
 gi|154162328|gb|ABS69544.1| rare lipoprotein A [Xanthobacter autotrophicus Py2]
          Length = 314

 Score =  172 bits (435), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 115/161 (71%), Gaps = 1/161 (0%)

Query: 41  ESMYGVTASDRIVS-GKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAF 99
           + +YGV+AS R+V+ G  VPRGGG Y +GKPY I GR YVP +   Y A G+ASWYGK F
Sbjct: 62  DPLYGVSASPRVVAEGDPVPRGGGGYKVGKPYTIAGRTYVPAENPNYTAEGLASWYGKDF 121

Query: 100 HGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSN 159
           HGR TANGE++    I+AAH TLP+PSYVRVTN+ N  S++VRVN+RGPY  +RLID+S 
Sbjct: 122 HGRKTANGEIFDMGSISAAHKTLPMPSYVRVTNLANKRSIIVRVNNRGPYVGDRLIDVSY 181

Query: 160 AAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVN 200
            AA +L   + GV++V V+Y+G A ++  D   L ST+  +
Sbjct: 182 RAADMLGFAKFGVARVRVDYMGRAPIDEDDDIKLASTLRTD 222


>gi|220926671|ref|YP_002501973.1| rare lipoprotein A [Methylobacterium nodulans ORS 2060]
 gi|219951278|gb|ACL61670.1| rare lipoprotein A [Methylobacterium nodulans ORS 2060]
          Length = 398

 Score =  171 bits (434), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 96/219 (43%), Positives = 129/219 (58%), Gaps = 11/219 (5%)

Query: 5   SCDCLLKGSVVCVVVLGMSSCFFS----STYKDDKLEYFPESMYGVTASDRIVS-GKRVP 59
           S    L+ + V  V L  ++C  +    +T      +  P+  YGV  S R+      +P
Sbjct: 14  SAAGALRLAAVAGVALLTANCAGTPHPTTTAARSGRQIDPK--YGVAPSPRLYGENDPIP 71

Query: 60  RGGGRYFLGKPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAA 118
           +GGGR  +GKPY + G  YVPR+    Y   G+ASWYG AFHGR+TANGEV+    + AA
Sbjct: 72  KGGGRAMVGKPYMVAGHTYVPREDPRGYVREGLASWYGTAFHGRMTANGEVFDRFSVAAA 131

Query: 119 HPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           HPTLPLPSY RVTN+ NG S+VVRVNDRGPYH+ RL+D+S   A+ L    RG ++V VE
Sbjct: 132 HPTLPLPSYARVTNLANGHSMVVRVNDRGPYHAGRLMDVSERVAEALEFHRRGTTRVRVE 191

Query: 179 YLGMALLNGMDQEYLRSTVMVNSATVLPLGCQYREEIVV 217
           YLG A + G D   L +T+  +     P G  +   ++V
Sbjct: 192 YLGKASVAGSDDRKLMATLRTDG---RPAGGPFGANLMV 227


>gi|240850635|ref|YP_002972035.1| rare lipoprotein A [Bartonella grahamii as4aup]
 gi|240267758|gb|ACS51346.1| rare lipoprotein A [Bartonella grahamii as4aup]
          Length = 299

 Score =  171 bits (432), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 91/200 (45%), Positives = 119/200 (59%), Gaps = 13/200 (6%)

Query: 63  GRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTL 122
           GR  +GKPYQI G+WY P+    Y  VG ASWYG  FHGRLTANGE+Y    +TAAHPT+
Sbjct: 75  GRAIVGKPYQIKGKWYYPQNDPTYKRVGEASWYGSDFHGRLTANGEIYDMNLLTAAHPTM 134

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           PLPSY RVTN++NG S++VRVNDRGP+  +R+IDLS  AA IL   +RGV+ V VEY+  
Sbjct: 135 PLPSYARVTNLKNGSSIIVRVNDRGPFMKDRIIDLSKQAAAILGYVDRGVADVKVEYIAE 194

Query: 183 ALLNGMDQEYLRSTVMVNSATVLPLGCQ----YREEIVVIPYLLTRSRTVHLNNCDDDSL 238
           A +   D  YL ++    +A    L  +     RE +     LL   R    N  + + L
Sbjct: 195 APVGYYDGAYLMASYTPGNAASYSLASENVSKKRETV-----LLKDKR----NTGNKEGL 245

Query: 239 QKQREISLRERKKSNLIPLP 258
            K   +   +R K+  + LP
Sbjct: 246 AKAAAVEQEQRNKTVAVKLP 265


>gi|319408561|emb|CBI82214.1| Rare lipoprotein A [Bartonella schoenbuchensis R1]
          Length = 273

 Score =  170 bits (430), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 81/156 (51%), Positives = 103/156 (66%), Gaps = 3/156 (1%)

Query: 62  GGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPT 121
           G R  +GKPYQI G+WY P     Y  VG ASWYG  FHGRLTANGE+Y    +TAAHPT
Sbjct: 55  GSRAVVGKPYQIKGKWYYPEDDPTYKRVGQASWYGSDFHGRLTANGEIYDMNLLTAAHPT 114

Query: 122 LPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           +PLPSY RVTN+ENG S++VRVNDRGP+  +R+IDLS  AA IL    +GV+ + VEY+ 
Sbjct: 115 MPLPSYARVTNLENGSSIIVRVNDRGPFIKDRIIDLSKQAATILGYVNKGVTNIKVEYVS 174

Query: 182 MALLNGMDQEYLRSTVMV---NSATVLPLGCQYREE 214
            A +N  D  YL ++      NS+ +L L     ++
Sbjct: 175 KAPVNDYDSAYLMASYTSRDYNSSMMLALANTLEDK 210


>gi|319407216|emb|CBI80855.1| Rare lipoprotein A [Bartonella sp. 1-1C]
          Length = 245

 Score =  170 bits (430), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 81/154 (52%), Positives = 104/154 (67%), Gaps = 2/154 (1%)

Query: 45  GVTASDRIVSGKRVPRG--GGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGR 102
            ++  +RI++G+   +     R  +GKPYQI G+WY P     Y  VG ASWYG  FHGR
Sbjct: 18  AISVPERILNGQNRLKNKVAKRVVVGKPYQIKGKWYYPEADPTYQRVGQASWYGSYFHGR 77

Query: 103 LTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAA 162
           LTANGEVY    +TAAHPT+PLPSY RVTN++NG S++VRVNDRGPY  NR+IDLS  AA
Sbjct: 78  LTANGEVYNMNLLTAAHPTMPLPSYARVTNLKNGSSIIVRVNDRGPYIKNRIIDLSKQAA 137

Query: 163 KILRVEERGVSKVHVEYLGMALLNGMDQEYLRST 196
            +L    +G + V VEY+  A +N  D EYL ++
Sbjct: 138 AMLGYLNQGTADVKVEYISEAPINNYDSEYLMAS 171


>gi|163868320|ref|YP_001609529.1| rare lipoprotein A [Bartonella tribocorum CIP 105476]
 gi|161017976|emb|CAK01534.1| rare lipoprotein A [Bartonella tribocorum CIP 105476]
          Length = 298

 Score =  169 bits (429), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 89/199 (44%), Positives = 118/199 (59%), Gaps = 12/199 (6%)

Query: 63  GRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTL 122
           GR  +GKPYQI G+WY P     Y  VG ASWYG  FHGRLTANGE+Y    +TAAHPT+
Sbjct: 75  GRAVVGKPYQIKGKWYYPENDPTYKRVGEASWYGSDFHGRLTANGEIYDMNLLTAAHPTM 134

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           PLPSY RVTN++NG SL+VRVNDRGP+  +R+IDLS  AA IL   +RGV+ V VEY+  
Sbjct: 135 PLPSYARVTNLKNGSSLIVRVNDRGPFMKDRIIDLSRQAAAILGYVDRGVADVKVEYISE 194

Query: 183 ALLNGMDQEYLRSTVMVNSATVLPLGCQYREEIVVIPYLLTRSRTVHL---NNCDDDSLQ 239
           A +   D  YL ++    ++    L  +          +L +  TV     N  + + L 
Sbjct: 195 APIGYYDGAYLMASYTPGNSASYSLASE---------NVLKKRETVLFKERNTGNKEELA 245

Query: 240 KQREISLRERKKSNLIPLP 258
           K   +S  +  K+ ++ LP
Sbjct: 246 KTVSVSQEQSDKTVVVKLP 264


>gi|49475608|ref|YP_033649.1| rare lipoprotein A precursor [Bartonella henselae str. Houston-1]
 gi|49238415|emb|CAF27642.1| Rare lipoprotein A precursor [Bartonella henselae str. Houston-1]
          Length = 283

 Score =  169 bits (429), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 87/190 (45%), Positives = 114/190 (60%), Gaps = 4/190 (2%)

Query: 63  GRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTL 122
           GR  +GKPY+I G+WY P+    Y  VG ASWYG  FHGRLTANGE+Y    +TAAHPT+
Sbjct: 75  GRAIVGKPYKIKGKWYYPQHDPTYKRVGQASWYGSDFHGRLTANGEIYDMNLLTAAHPTM 134

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           PLPSY RVTN++NG SL+VRVNDRGP+  +R+IDLS  AA IL  E  GV+ V VEY+  
Sbjct: 135 PLPSYARVTNLKNGSSLIVRVNDRGPFMKDRIIDLSKQAAAILGYENAGVTNVQVEYIAE 194

Query: 183 ALLNGMDQEYLRSTVMVNS----ATVLPLGCQYREEIVVIPYLLTRSRTVHLNNCDDDSL 238
           A +   D  YL ++ +  +    +  L    Q RE I++    +   + +     +   L
Sbjct: 195 APVGHYDGAYLMASYIPGNIGSYSLALADTLQKRENIILEKRNIDSKKQLTKAVVEQKQL 254

Query: 239 QKQREISLRE 248
            K   I L E
Sbjct: 255 SKTVSIKLPE 264


>gi|49474222|ref|YP_032264.1| rare lipoprotein A [Bartonella quintana str. Toulouse]
 gi|49239726|emb|CAF26105.1| Rare lipoprotein A [Bartonella quintana str. Toulouse]
          Length = 287

 Score =  169 bits (428), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 94/134 (70%)

Query: 63  GRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTL 122
            R  +GKPY+I G+WY P+    Y  VG ASWYG  FHGRLTANGE+Y    +TAAHPT+
Sbjct: 75  ARAIIGKPYKIKGKWYYPKNDPTYKRVGQASWYGSDFHGRLTANGEIYDMNLLTAAHPTM 134

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           PLPSY RVTN+ENG S++VRVNDRGP+  +R+IDLS  AA IL  E  GV+ V VEY+  
Sbjct: 135 PLPSYARVTNLENGSSIIVRVNDRGPFIKDRIIDLSKQAAAILDYENAGVTNVKVEYIAE 194

Query: 183 ALLNGMDQEYLRST 196
           A +   D  YL S+
Sbjct: 195 APIGYYDSAYLISS 208


>gi|319404206|emb|CBI77799.1| Rare lipoprotein A [Bartonella rochalimae ATCC BAA-1498]
          Length = 295

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 79/156 (50%), Positives = 104/156 (66%), Gaps = 4/156 (2%)

Query: 45  GVTASDRIVSGKRVPRGGGRY----FLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFH 100
            ++  +RI++G++  +   +      +GKPYQI G+WY P     Y  VG ASWYG  FH
Sbjct: 54  AISVPERILNGQKQNKLKNKVAKGVVIGKPYQIKGKWYYPESDPTYQRVGQASWYGSYFH 113

Query: 101 GRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNA 160
           GR TANGEVY    +TAAHPT+PLPSY RVTN++NG S++VRVNDRGPY  NR+IDLS  
Sbjct: 114 GRPTANGEVYDMNLLTAAHPTMPLPSYARVTNLKNGSSIIVRVNDRGPYMKNRIIDLSKQ 173

Query: 161 AAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRST 196
           AA +L    +G + V VEY+  A +N  D EYL ++
Sbjct: 174 AAIMLGYLNQGTADVKVEYISEAPINNYDSEYLMAS 209


>gi|319898923|ref|YP_004159016.1| Rare lipoprotein A [Bartonella clarridgeiae 73]
 gi|319402887|emb|CBI76438.1| Rare lipoprotein A [Bartonella clarridgeiae 73]
          Length = 239

 Score =  165 bits (417), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 78/133 (58%), Positives = 94/133 (70%)

Query: 64  RYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLP 123
           R  +GKPYQI G+ Y P+    Y  VG ASWYG  FHGRLTANGEVY    +TAAHPTLP
Sbjct: 27  RIIIGKPYQIKGKQYYPKADPTYQRVGQASWYGSYFHGRLTANGEVYNMNLLTAAHPTLP 86

Query: 124 LPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           LPSY RVTN++NG S++VRVNDRGPY  NR+IDLS  AA +L    +G + V VEY+  A
Sbjct: 87  LPSYARVTNLKNGSSIIVRVNDRGPYIKNRIIDLSKQAATMLGYLNQGTADVKVEYVAEA 146

Query: 184 LLNGMDQEYLRST 196
            +N  D EYL ++
Sbjct: 147 PINNYDGEYLMAS 159


>gi|312115141|ref|YP_004012737.1| lipoprotein A [Rhodomicrobium vannielii ATCC 17100]
 gi|311220270|gb|ADP71638.1| rare lipoprotein A [Rhodomicrobium vannielii ATCC 17100]
          Length = 339

 Score =  164 bits (415), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 81/178 (45%), Positives = 107/178 (60%), Gaps = 11/178 (6%)

Query: 14  VVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVS-GKRVPRGGGRYFLGKPYQ 72
           +V  +V  + +C    +  D+            T S R++  G  VP+GGG Y LG PY 
Sbjct: 2   IVTALVASLGACTTQKSPVDETQ----------TLSPRVIKVGDPVPKGGGEYKLGSPYL 51

Query: 73  IMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTN 132
             G+WY P     Y  VG+ASWYG  FHGR TANGE+Y    +TAAHPTLP+P+Y +VTN
Sbjct: 52  ANGKWYTPVNDVHYDQVGLASWYGDFFHGRKTANGEIYDMGALTAAHPTLPMPTYAQVTN 111

Query: 133 MENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQ 190
           ++N  +++VR+NDRGPYH  R+IDLS  AA++L    RG + V V Y   A LNG D 
Sbjct: 112 LDNNRTVIVRINDRGPYHDGRIIDLSRKAAELLGFHGRGTAAVRVRYFAPAPLNGDDH 169


>gi|121602144|ref|YP_989112.1| rare lipoprotein A [Bartonella bacilliformis KC583]
 gi|120614321|gb|ABM44922.1| rare lipoprotein A [Bartonella bacilliformis KC583]
          Length = 281

 Score =  162 bits (410), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 121/193 (62%), Gaps = 11/193 (5%)

Query: 67  LGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
           +GKPY+I G+WY P     Y  VG ASWYG+ FHGRLTANGE+Y    +TAAH TLPLPS
Sbjct: 80  VGKPYKIKGKWYYPEADPNYKRVGQASWYGEYFHGRLTANGEIYDMNLLTAAHTTLPLPS 139

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLN 186
           YVRVTN++N  S++VRVNDRGPY  NR+IDLS  AA +L  ++ G+  V VEY+  A +N
Sbjct: 140 YVRVTNLKNASSIIVRVNDRGPYMKNRIIDLSKQAAIMLGFKDDGIVDVKVEYVSEAPIN 199

Query: 187 GMDQEYLRSTVMV-NSATVLPLGCQYREEIVVIPYLLTRSRTVHLNNCDDDSLQKQREIS 245
             D +YL ++    N  +++ L     EE         +  TV L   + +S +K  ++ 
Sbjct: 200 KYDGDYLMASYKPGNYTSLMMLALADIEE--------KKKDTVSL-ALNGESQKKLTKVV 250

Query: 246 LRERKKSNLIPLP 258
           + + KKS+ I LP
Sbjct: 251 INQ-KKSSWIKLP 262


>gi|218662863|ref|ZP_03518793.1| rare lipoprotein A precursor protein [Rhizobium etli IE4771]
          Length = 121

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 70/115 (60%), Positives = 88/115 (76%)

Query: 40  PESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAF 99
           P    GV AS R+ +G   P+GGGRY +G PY + G+WY P++  +Y+ VG+ASWYG AF
Sbjct: 7   PNPNMGVKASPRVATGNNTPKGGGRYIVGNPYVVKGKWYYPKEDFSYSKVGIASWYGSAF 66

Query: 100 HGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRL 154
           HGRLTANGEVY   +++AAHPT PLPSY RVTN+ENG S++VRVNDRGPYH  R+
Sbjct: 67  HGRLTANGEVYDQMHLSAAHPTFPLPSYARVTNVENGSSIIVRVNDRGPYHEGRI 121


>gi|154253548|ref|YP_001414372.1| rare lipoprotein A [Parvibaculum lavamentivorans DS-1]
 gi|154157498|gb|ABS64715.1| rare lipoprotein A [Parvibaculum lavamentivorans DS-1]
          Length = 339

 Score =  152 bits (385), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 89/127 (70%)

Query: 61  GGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHP 120
           GGG Y +G PYQI G WY P +   Y A G+ASWYG  FHG+ TANGE++    +TAAHP
Sbjct: 49  GGGIYKVGNPYQIAGIWYYPHEDDKYDATGIASWYGPQFHGKQTANGEIFDQNAMTAAHP 108

Query: 121 TLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           TLP+P   RVTN+ENG S++VR+NDRGP+ + R IDLS  AA+ L    +G +KV V+Y+
Sbjct: 109 TLPMPVLARVTNLENGKSIIVRINDRGPFAAGREIDLSKHAAEQLGFMTKGTAKVRVQYV 168

Query: 181 GMALLNG 187
           G A L G
Sbjct: 169 GRAPLEG 175


>gi|294083924|ref|YP_003550681.1| lipoprotein [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292663496|gb|ADE38597.1| Lipoprotein [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 339

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 69/136 (50%), Positives = 95/136 (69%)

Query: 45  GVTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLT 104
           G    D I +G  V +   RY +G PYQ+ G WY P +  AY   G+ SWYG  F G+LT
Sbjct: 52  GKATKDGIGAGAGVVKSAPRYKIGNPYQVAGIWYYPDRDLAYDETGIGSWYGDEFAGKLT 111

Query: 105 ANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKI 164
           ANGE++  E ITAAH TLP+PS VRVTN++NG SLVVR+NDRGP+ + R+IDLS A+A++
Sbjct: 112 ANGEIFDPEKITAAHKTLPMPSVVRVTNLDNGKSLVVRINDRGPFVAGRIIDLSRASARL 171

Query: 165 LRVEERGVSKVHVEYL 180
           +  ++ G+++V V+ L
Sbjct: 172 IGYKDNGLARVRVQVL 187


>gi|197105069|ref|YP_002130446.1| rare lipoprotein A [Phenylobacterium zucineum HLK1]
 gi|196478489|gb|ACG78017.1| rare lipoprotein A [Phenylobacterium zucineum HLK1]
          Length = 369

 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 75/137 (54%), Positives = 95/137 (69%), Gaps = 1/137 (0%)

Query: 54  SGKRVPRG-GGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGT 112
           S  + P G GG Y +GKPYQ+ G WYVPR+   Y   G+ASWYG+AFH + TANGE +  
Sbjct: 74  SAAKAPSGAGGTYKVGKPYQVGGIWYVPREQPDYDKTGIASWYGEAFHLKSTANGERFDM 133

Query: 113 EYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGV 172
             ++AAH TLPLPS V VTN+ENG  L VRVNDRGP+  NR+IDLS  AA+ L  E +G+
Sbjct: 134 NLLSAAHTTLPLPSIVEVTNLENGRRLQVRVNDRGPFVGNRIIDLSREAARELGFERQGI 193

Query: 173 SKVHVEYLGMALLNGMD 189
           ++V V Y+G A L G +
Sbjct: 194 ARVRVRYVGPAPLLGRE 210


>gi|83593040|ref|YP_426792.1| rare lipoprotein A [Rhodospirillum rubrum ATCC 11170]
 gi|83575954|gb|ABC22505.1| Rare lipoprotein A [Rhodospirillum rubrum ATCC 11170]
          Length = 367

 Score =  146 bits (368), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 68/126 (53%), Positives = 89/126 (70%)

Query: 55  GKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEY 114
           G R   G G Y +G+PYQI G+WY P++  +Y+  G ASWYG+ FHG+ TANGE +    
Sbjct: 45  GGRGDSGKGSYKIGEPYQIGGKWYYPKEDYSYSQTGTASWYGQDFHGKRTANGETFDMNR 104

Query: 115 ITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSK 174
           +TAAH TLPLPS VRVTN+ NG S+ VRVNDRGP+   RLID+S A+A+ L  E +G ++
Sbjct: 105 LTAAHTTLPLPSIVRVTNLGNGRSVTVRVNDRGPFVGERLIDMSRASARALGFEAQGTAR 164

Query: 175 VHVEYL 180
           V V+ L
Sbjct: 165 VRVQIL 170


>gi|254293995|ref|YP_003060018.1| lipoprotein A [Hirschia baltica ATCC 49814]
 gi|254042526|gb|ACT59321.1| rare lipoprotein A [Hirschia baltica ATCC 49814]
          Length = 413

 Score =  146 bits (368), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 66/125 (52%), Positives = 88/125 (70%)

Query: 59  PRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAA 118
           P G  +  +G PY+I GRWYVP     Y  VG+ SWYG  FHG+ +A GEV+    +TAA
Sbjct: 154 PAGFAKQKIGAPYEIQGRWYVPFAEPNYDEVGVGSWYGPQFHGKDSAVGEVFDQNALTAA 213

Query: 119 HPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           HPTLP+PS  RVTN+ENG S+VVR+NDRGP+  +R+IDLS  +A +L  ++ G +KV V+
Sbjct: 214 HPTLPIPSLARVTNLENGRSVVVRINDRGPFVDDRIIDLSKQSATVLGYKDNGTAKVRVQ 273

Query: 179 YLGMA 183
           Y+G A
Sbjct: 274 YMGYA 278


>gi|144899827|emb|CAM76691.1| Rare lipoprotein A [Magnetospirillum gryphiswaldense MSR-1]
          Length = 327

 Score =  145 bits (366), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 86/117 (73%)

Query: 65  YFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           Y +GKPYQI G WY P++   Y   G+ASWYG  FHG+LTANGEV+    ++AAH TLP+
Sbjct: 53  YKIGKPYQIKGVWYYPQEDFDYDETGIASWYGPDFHGKLTANGEVFDQNAVSAAHKTLPM 112

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           PS VRVTN+ENG SLVVRVNDRGP+   R+ID+S  +A++L  E +G ++V VE + 
Sbjct: 113 PSVVRVTNLENGRSLVVRVNDRGPFAHGRVIDMSRRSAQLLGFEGQGTARVRVEIMA 169


>gi|163795502|ref|ZP_02189468.1| Rare lipoprotein A [alpha proteobacterium BAL199]
 gi|159179101|gb|EDP63634.1| Rare lipoprotein A [alpha proteobacterium BAL199]
          Length = 332

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 68/118 (57%), Positives = 83/118 (70%)

Query: 63  GRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTL 122
           G Y +G PYQI G WY P++   Y   G+ASWYG  FHGR TANGE +    +TAAH TL
Sbjct: 45  GTYKVGSPYQIGGVWYYPKEDWDYVETGIASWYGPGFHGRSTANGETFDENDVTAAHRTL 104

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           PLPS VRVTN+ NG +LVVRVNDRGP+   R+IDLS  +A++L  E +G +KV VE L
Sbjct: 105 PLPSIVRVTNLTNGRALVVRVNDRGPFAHGRIIDLSRRSAQLLGFERQGTAKVRVEIL 162


>gi|304321772|ref|YP_003855415.1| rare lipoprotein A precursor [Parvularcula bermudensis HTCC2503]
 gi|303300674|gb|ADM10273.1| rare lipoprotein A precursor [Parvularcula bermudensis HTCC2503]
          Length = 428

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 88/120 (73%)

Query: 67  LGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
           +G PY I G  YVP+    Y   G+ASWYG  FHG+LTANGE++  + +TAAH TLPLPS
Sbjct: 50  VGNPYFIKGVRYVPKVDPTYDRTGIASWYGPNFHGKLTANGELFDQDRLTAAHKTLPLPS 109

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLN 186
            V++TN+EN  S+VVR+NDRGPY  +R+IDLS   A++L   E+G+++V VEYLG A L+
Sbjct: 110 LVKITNLENRRSVVVRLNDRGPYADDRIIDLSKKTAEVLGTREKGLARVRVEYLGPASLD 169


>gi|83311551|ref|YP_421815.1| lipoprotein [Magnetospirillum magneticum AMB-1]
 gi|82946392|dbj|BAE51256.1| Lipoprotein [Magnetospirillum magneticum AMB-1]
          Length = 324

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 85/116 (73%)

Query: 65  YFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           Y +GKPYQ+ G WY P++  AY   G+ASWYG  FH +LTANGE +    +TAAH TL +
Sbjct: 50  YKVGKPYQVAGVWYYPQEDFAYDETGIASWYGPNFHAKLTANGETFDQNAVTAAHKTLQM 109

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           PS  RVTN+ENG S++VR+NDRGP+ + R++DLS  +A++L +E RG +KV V+ L
Sbjct: 110 PSVARVTNLENGRSIIVRINDRGPFVNGRILDLSRRSAQLLGMEGRGTAKVRVQIL 165


>gi|190570524|ref|YP_001974882.1| Putative rare lipoprotein A [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|190356796|emb|CAQ54159.1| Putative rare lipoprotein A [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
          Length = 222

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 74/170 (43%), Positives = 98/170 (57%), Gaps = 27/170 (15%)

Query: 11  KGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKP 70
           K + +C++ + MSSC FS+                           R     G Y +G  
Sbjct: 4   KLAFLCLIFVLMSSCSFSN---------------------------RCNHTAGHYKIGNS 36

Query: 71  YQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRV 130
           Y I G  Y P+  + Y  VG+ASWYG   HG +TANGEV+    I+AAH TLPLP +VRV
Sbjct: 37  YTINGITYHPKYCSCYEEVGIASWYGIEDHGTITANGEVFNRHLISAAHKTLPLPCFVRV 96

Query: 131 TNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           TN+ENG  LV+RVNDRGP+   R+IDLS  AA++L + + G++KV VEYL
Sbjct: 97  TNLENGRKLVIRVNDRGPFVEGRIIDLSEKAAQVLGLHKSGLAKVKVEYL 146


>gi|288958655|ref|YP_003448996.1| rare lipoprotein A [Azospirillum sp. B510]
 gi|288910963|dbj|BAI72452.1| rare lipoprotein A [Azospirillum sp. B510]
          Length = 344

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 85/118 (72%)

Query: 63  GRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTL 122
           G Y +GKPYQI G WY P++  +Y   G+ASWYG  FH R TANGE+Y    +TAAH TL
Sbjct: 54  GIYKVGKPYQINGVWYYPKEDFSYDETGIASWYGPGFHERNTANGEIYDQNELTAAHKTL 113

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           P+PS VRVTN++NG S+VVR+NDRGPY + R+ID+S   A++L  +  G +KV V+ L
Sbjct: 114 PMPSLVRVTNLDNGRSIVVRINDRGPYANGRIIDMSRRGAQLLGFDGPGTAKVRVQIL 171


>gi|209964478|ref|YP_002297393.1| rare lipoprotein A [Rhodospirillum centenum SW]
 gi|209957944|gb|ACI98580.1| rare lipoprotein A [Rhodospirillum centenum SW]
          Length = 328

 Score =  139 bits (351), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 82/119 (68%)

Query: 62  GGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPT 121
           GG Y +G PYQI G WY P     Y   G+ASWYG  FH R TANGE Y    +TAAH T
Sbjct: 52  GGTYKVGDPYQINGVWYYPAVDYTYNQTGVASWYGPGFHTRATANGENYNENELTAAHQT 111

Query: 122 LPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           LP+PS VRVTN+ENG S+VVR+NDRGP+   R+ID+S   A++L  E++G +KV V+ L
Sbjct: 112 LPMPSLVRVTNLENGRSIVVRINDRGPFVPGRIIDMSRRGAQLLGFEQQGTAKVRVQIL 170


>gi|254994978|ref|ZP_05277168.1| rare lipoprotein A precursor (rlpA) [Anaplasma marginale str.
           Mississippi]
          Length = 226

 Score =  139 bits (350), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 107/181 (59%), Gaps = 10/181 (5%)

Query: 53  VSGKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGT 112
            S  +    G  Y +G  Y I G  Y P+ Y  Y  +G+ASWYG+ FH +LTANG+V+  
Sbjct: 22  TSATKSGHNGAHYKIGTSYSINGVAYKPQYYDHYEEIGIASWYGEGFHNKLTANGDVFSR 81

Query: 113 EYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGV 172
             +TAAH TLP+PS+V +TN+ENG  ++V+VNDRGP+  NR+IDLS  AA +L   ++G 
Sbjct: 82  FSLTAAHKTLPMPSFVEITNLENGKKVIVKVNDRGPFVENRIIDLSEKAAILLGFRDKGT 141

Query: 173 SKVHVEYLGMALLNGMDQEYLRSTVMVNSATVLPLGCQYREEIVV----IPYLLTRSRTV 228
           +KV V YLG    N + ++      + N A    L  ++R++++     + Y+L  +   
Sbjct: 142 AKVKVLYLGKMSRNILYEQ------LSNKARYAKLEERHRKDLITAKTSVGYILKVTEAA 195

Query: 229 H 229
           H
Sbjct: 196 H 196


>gi|56416777|ref|YP_153851.1| rare lipoprotein A precursor [Anaplasma marginale str. St. Maries]
 gi|222475140|ref|YP_002563556.1| rare lipoprotein A precursor (rlpA) [Anaplasma marginale str.
           Florida]
 gi|255003122|ref|ZP_05278086.1| rare lipoprotein A precursor (rlpA) [Anaplasma marginale str.
           Puerto Rico]
 gi|255004248|ref|ZP_05279049.1| rare lipoprotein A precursor (rlpA) [Anaplasma marginale str.
           Virginia]
 gi|56388009|gb|AAV86596.1| rare lipoprotein A precursor [Anaplasma marginale str. St. Maries]
 gi|222419277|gb|ACM49300.1| rare lipoprotein A precursor (rlpA) [Anaplasma marginale str.
           Florida]
          Length = 231

 Score =  139 bits (350), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 107/180 (59%), Gaps = 10/180 (5%)

Query: 54  SGKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTE 113
           S  +    G  Y +G  Y I G  Y P+ Y  Y  +G+ASWYG+ FH +LTANG+V+   
Sbjct: 28  SATKSGHNGAHYKIGTSYSINGVAYKPQYYDHYEEIGIASWYGEGFHNKLTANGDVFSRF 87

Query: 114 YITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVS 173
            +TAAH TLP+PS+V +TN+ENG  ++V+VNDRGP+  NR+IDLS  AA +L   ++G +
Sbjct: 88  SLTAAHKTLPMPSFVEITNLENGKKVIVKVNDRGPFVENRIIDLSEKAAILLGFRDKGTA 147

Query: 174 KVHVEYLGMALLNGMDQEYLRSTVMVNSATVLPLGCQYREEIVV----IPYLLTRSRTVH 229
           KV V YLG    N + ++      + N A    L  ++R++++     + Y+L  +   H
Sbjct: 148 KVKVLYLGKMSRNILYEQ------LSNKARYAKLEERHRKDLITAKTSVGYILKVTEAAH 201


>gi|254418186|ref|ZP_05031910.1| Rare lipoprotein A-like double-psi beta-barrel [Brevundimonas sp.
           BAL3]
 gi|196184363|gb|EDX79339.1| Rare lipoprotein A-like double-psi beta-barrel [Brevundimonas sp.
           BAL3]
          Length = 270

 Score =  139 bits (349), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 84/119 (70%)

Query: 69  KPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           +PYQ+ GRWY P++   Y  VGMASWYG AF+GR T++GE +    +TAAH TLPLP  V
Sbjct: 49  RPYQVRGRWYTPKEQPDYEEVGMASWYGDAFNGRPTSSGERFDMHQLTAAHKTLPLPGLV 108

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
            VTN+ENG  LVVRVNDRGP+  +R+IDLS  AA+ L +  +GV +V V YLG A   G
Sbjct: 109 EVTNLENGRRLVVRVNDRGPFVDSRIIDLSREAAQELGMLSQGVGRVRVRYLGRAPRQG 167


>gi|46202635|ref|ZP_00208594.1| COG0797: Lipoproteins [Magnetospirillum magnetotacticum MS-1]
          Length = 318

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 59/116 (50%), Positives = 85/116 (73%)

Query: 65  YFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           Y +GKPYQ+ G WY P++  AY   G+ASWYG  FH +LTANGE +    +TAAH TL +
Sbjct: 44  YKVGKPYQVAGIWYYPQEDFAYDETGIASWYGPNFHAKLTANGETFDQNAVTAAHKTLQM 103

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           P+  RVTN+ENG S++VR+NDRGP+ + R++DLS  +A++L +E +G ++V V+ L
Sbjct: 104 PAIARVTNLENGRSIIVRINDRGPFVNGRILDLSRKSAQLLGMEGKGTARVRVQVL 159


>gi|213019281|ref|ZP_03335088.1| putative rare lipoprotein A [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|212995390|gb|EEB56031.1| putative rare lipoprotein A [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 208

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 84/124 (67%)

Query: 57  RVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYIT 116
           R     G Y +G  Y I G  Y P+  + Y  VG+ASWYG   HG +TANGEV+    I+
Sbjct: 9   RCNHTAGHYKIGNSYTINGITYHPKYCSCYEEVGIASWYGIEDHGTITANGEVFNRHLIS 68

Query: 117 AAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVH 176
           AAH TLPLP +VRVTN+ENG  LV+RVNDRGP+   R+IDLS  AA++L + + G++KV 
Sbjct: 69  AAHKTLPLPCFVRVTNLENGRKLVIRVNDRGPFVEGRIIDLSEKAAQVLGLHKSGLAKVK 128

Query: 177 VEYL 180
           VEYL
Sbjct: 129 VEYL 132


>gi|295689514|ref|YP_003593207.1| rare lipoprotein A [Caulobacter segnis ATCC 21756]
 gi|295431417|gb|ADG10589.1| rare lipoprotein A [Caulobacter segnis ATCC 21756]
          Length = 334

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 90/129 (69%), Gaps = 2/129 (1%)

Query: 69  KPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           KPYQI G WY P++   Y  VG  SWYG+ FH R TANGE++  +  +AAH TLPLPS V
Sbjct: 65  KPYQINGVWYYPKEDRDYNVVGTGSWYGEQFHNRRTANGEIFDMDIPSAAHKTLPLPSLV 124

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGM 188
            VTN++NG  ++VRVNDRGP+  +R+IDLS AAA+ L    +GV+KV V+Y+G A  +  
Sbjct: 125 EVTNLDNGRRMIVRVNDRGPFVGDRVIDLSKAAAEELGYRRQGVAKVRVKYIGPAPKSVF 184

Query: 189 D--QEYLRS 195
           D  ++Y R+
Sbjct: 185 DPPRQYARA 193


>gi|302383106|ref|YP_003818929.1| lipoprotein A [Brevundimonas subvibrioides ATCC 15264]
 gi|302193734|gb|ADL01306.1| rare lipoprotein A [Brevundimonas subvibrioides ATCC 15264]
          Length = 278

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 64/115 (55%), Positives = 81/115 (70%)

Query: 69  KPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           +PYQI GRWY P +   Y  VGMASWYG  F+GR T+ GE +    +TAAH TLPLP  V
Sbjct: 57  RPYQIRGRWYRPEEQPGYDQVGMASWYGDQFNGRPTSTGERFDMHALTAAHKTLPLPGLV 116

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
            VTN+ NG ++V+RVNDRGP+  +R+IDLS  AA+ L + +RGV +V V YLG A
Sbjct: 117 EVTNLANGRTIVLRVNDRGPFVDDRIIDLSRGAAEALDMLQRGVGEVRVRYLGRA 171


>gi|58584377|ref|YP_197950.1| lipoprotein [Wolbachia endosymbiont strain TRS of Brugia malayi]
 gi|58418693|gb|AAW70708.1| Lipoprotein [Wolbachia endosymbiont strain TRS of Brugia malayi]
          Length = 222

 Score =  135 bits (341), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 82/124 (66%)

Query: 57  RVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYIT 116
           R     G Y +G  Y I G  Y P+    Y  +G+ASWYG   HG LTANGEV+    I+
Sbjct: 10  RCNDTAGHYKIGNSYTINGIIYHPKHCNHYEEIGVASWYGIEDHGTLTANGEVFNRHLIS 69

Query: 117 AAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVH 176
           AAH TLPLP +V VTN+ENG  LVVRVNDRGP+   R+IDLS  AAKIL + + G++KV 
Sbjct: 70  AAHKTLPLPCFVLVTNLENGKKLVVRVNDRGPFVEGRIIDLSEKAAKILGLHKAGLAKVK 129

Query: 177 VEYL 180
           V+YL
Sbjct: 130 VQYL 133


>gi|146308810|ref|YP_001189275.1| rare lipoprotein A [Pseudomonas mendocina ymp]
 gi|145577011|gb|ABP86543.1| rare lipoprotein A [Pseudomonas mendocina ymp]
          Length = 337

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 67/112 (59%), Positives = 82/112 (73%), Gaps = 1/112 (0%)

Query: 68  GKPYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
             PY + G+ Y P Q    Y AVG ASWYG  FHG+ TANGE Y    +TAAH TLPLPS
Sbjct: 78  ASPYVVFGKQYYPIQDARRYQAVGPASWYGTKFHGQATANGETYDLYGMTAAHKTLPLPS 137

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           YVRVTN+ENG S+++RVNDRGP++S+R+IDLS AAAK L   E+G ++V VE
Sbjct: 138 YVRVTNLENGKSVILRVNDRGPFYSDRIIDLSFAAAKKLDYAEKGTARVKVE 189


>gi|269958812|ref|YP_003328600.1| rare lipoprotein A [Anaplasma centrale str. Israel]
 gi|269848642|gb|ACZ49286.1| rare lipoprotein A [Anaplasma centrale str. Israel]
          Length = 268

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 84/120 (70%)

Query: 62  GGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPT 121
           G  Y +G+ Y + G  Y P+ Y  Y  VG+ASWYG  FH + TANG+++    +TAAH T
Sbjct: 70  GAHYKIGRSYAVNGISYKPQYYDHYEEVGIASWYGGDFHNKPTANGDIFSRFLLTAAHKT 129

Query: 122 LPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           LP+PS+V +TN+ENG  ++V+VNDRGP+  NR+IDLS  AA +L   ++G++KV V YLG
Sbjct: 130 LPMPSFVEITNLENGKKVIVKVNDRGPFVENRIIDLSEKAATLLGFRDKGIAKVKVLYLG 189


>gi|315127073|ref|YP_004069076.1| rare lipoprotein A [Pseudoalteromonas sp. SM9913]
 gi|315015587|gb|ADT68925.1| rare lipoprotein A [Pseudoalteromonas sp. SM9913]
          Length = 225

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 74/192 (38%), Positives = 112/192 (58%), Gaps = 4/192 (2%)

Query: 69  KPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY+++G+ Y P    T Y+  G+ASWYG+ FHG  T+NGE+Y    +TAAH TLPLPS+
Sbjct: 32  RPYEVLGKRYTPMLDETGYSETGIASWYGRKFHGYHTSNGEIYDMFAMTAAHKTLPLPSF 91

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
           VRVTN  NG S++VRVNDRGP+H NR+IDLS AAA  L   + G ++V +E + +A  + 
Sbjct: 92  VRVTNTANGKSIIVRVNDRGPFHDNRIIDLSYAAAYKLGYHKYGTAEVKLEAITLADTHA 151

Query: 188 MDQEYLRSTVMVNSATVLPLGCQYREEIVVIPYLLTRSRT--VHLNNCDDDSLQKQREIS 245
             + Y++       A +  L    RE+  +   ++ +     +HL    D    +Q   +
Sbjct: 152 R-KTYVQVAAGSTLANIEALASTLREQYKLPTNIVEKDAIYRLHLGPIKDAQHAQQVLET 210

Query: 246 LRERKKSNLIPL 257
           L++ +  N   L
Sbjct: 211 LKQNQFQNAFLL 222


>gi|88860566|ref|ZP_01135204.1| putative Rare lipoprotein A [Pseudoalteromonas tunicata D2]
 gi|88817764|gb|EAR27581.1| putative Rare lipoprotein A [Pseudoalteromonas tunicata D2]
          Length = 253

 Score =  133 bits (335), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 82/116 (70%), Gaps = 1/116 (0%)

Query: 69  KPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY I G+ YVP    T Y   G+ASWYG+ FHG  T+NGE+Y    +TAAH TLPLPS+
Sbjct: 57  RPYSIGGKRYVPMLDETGYQETGIASWYGRKFHGHKTSNGEIYDMFSMTAAHKTLPLPSF 116

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VRVTN++NG + +V+VNDRGP+H NRLIDLS AAA  L     G ++V VE + +A
Sbjct: 117 VRVTNLDNGKTAIVKVNDRGPFHDNRLIDLSYAAAHKLDYYRSGTARVKVEAVTVA 172


>gi|332993382|gb|AEF03437.1| rare lipoprotein A [Alteromonas sp. SN2]
          Length = 306

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 62/118 (52%), Positives = 81/118 (68%), Gaps = 1/118 (0%)

Query: 64  RYFLGKPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTL 122
           R F  +PY+++G+ Y P      +  VG ASWYG+ FHG LT+NGE Y    ++AAH TL
Sbjct: 53  RMFNSRPYKVLGKHYTPLTSGKGFEEVGYASWYGQKFHGHLTSNGETYNMFAMSAAHKTL 112

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           PLPSYVRVTN++N    +VRVNDRGP+H NR+IDLS AAA  L    +G +KV +E +
Sbjct: 113 PLPSYVRVTNLDNDKQAIVRVNDRGPFHDNRIIDLSYAAAVKLGYHNKGTAKVKIEVI 170


>gi|116052038|ref|YP_789119.1| RlpA family lipoprotein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|313109440|ref|ZP_07795400.1| putative lipoprotein, rlpA family [Pseudomonas aeruginosa 39016]
 gi|115587259|gb|ABJ13274.1| possible lipoprotein, rlpA family [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|310881902|gb|EFQ40496.1| putative lipoprotein, rlpA family [Pseudomonas aeruginosa 39016]
          Length = 341

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 66/112 (58%), Positives = 81/112 (72%), Gaps = 1/112 (0%)

Query: 68  GKPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
             PY ++G+ Y P     AY  VG ASWYG  FHG+ TANGE Y    +TAAH TLPLPS
Sbjct: 79  ANPYTVLGKTYYPMNDARAYRMVGTASWYGTKFHGQATANGETYDLYGMTAAHKTLPLPS 138

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           YVRVTN++NG S++VRVNDRGP++S+R+IDLS AAAK L   E G ++V VE
Sbjct: 139 YVRVTNLDNGKSVIVRVNDRGPFYSDRVIDLSFAAAKKLGYAETGTARVKVE 190


>gi|152989135|ref|YP_001346495.1| putative lipoprotein [Pseudomonas aeruginosa PA7]
 gi|150964293|gb|ABR86318.1| lipoprotein, putative [Pseudomonas aeruginosa PA7]
          Length = 342

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 66/112 (58%), Positives = 81/112 (72%), Gaps = 1/112 (0%)

Query: 68  GKPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
             PY ++G+ Y P     AY  VG ASWYG  FHG+ TANGE Y    +TAAH TLPLPS
Sbjct: 79  ANPYTVLGKTYYPMNDARAYRMVGTASWYGTKFHGQATANGETYDLYGMTAAHKTLPLPS 138

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           YVRVTN++NG S++VRVNDRGP++S+R+IDLS AAAK L   E G ++V VE
Sbjct: 139 YVRVTNLDNGKSVIVRVNDRGPFYSDRVIDLSFAAAKKLGYAESGTARVKVE 190


>gi|94501221|ref|ZP_01307743.1| Lipoprotein [Oceanobacter sp. RED65]
 gi|94426648|gb|EAT11634.1| Lipoprotein [Oceanobacter sp. RED65]
          Length = 252

 Score =  132 bits (332), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 72/158 (45%), Positives = 100/158 (63%), Gaps = 7/158 (4%)

Query: 51  RIVSGKRVPRGGGRYFLGKPYQIMGR-WYVPRQYTAYAAVGMASWYGKAFHGRLTANGEV 109
           + VS    PRG         Y++ G+ +YV +    Y+A G+ASWYG+ FHG  T+NGEV
Sbjct: 47  QAVSEPLSPRGNA-----DQYEVWGKTYYVDKYIKDYSAEGIASWYGQKFHGYETSNGEV 101

Query: 110 YGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEE 169
           +     +AAH +LPLPS+V+VTN+ENG SL+VRVNDRGP+H +RLIDLS AAA  L  ++
Sbjct: 102 FDVYQFSAAHKSLPLPSFVQVTNLENGKSLIVRVNDRGPFHDDRLIDLSYAAAVRLGFDK 161

Query: 170 RGVSKVHVEYLGMALLNGMDQEYLRSTVMVNSATVLPL 207
           RG +KV V+ +   LL   D ++L+   +      L L
Sbjct: 162 RGTAKVKVDLVAPPLLPE-DYQHLQVAALSKKDRALDL 198


>gi|91776846|ref|YP_546602.1| rare lipoprotein A [Methylobacillus flagellatus KT]
 gi|91710833|gb|ABE50761.1| rare lipoprotein A [Methylobacillus flagellatus KT]
          Length = 310

 Score =  132 bits (332), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 82/113 (72%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY  +GR Y P  ++T Y   G+ASWYGK +HG+ T++GEVY    +T AH  LPLPSY
Sbjct: 78  RPYTALGRRYTPLTEHTPYKQRGIASWYGKRYHGQKTSSGEVYDMYAMTGAHTILPLPSY 137

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VRVTN ENG S++VR+NDRGP+H NRLIDLS AAA  LR+ E+G   V VE L
Sbjct: 138 VRVTNPENGRSVIVRINDRGPFHDNRLIDLSYAAAYKLRLVEKGSGIVEVEAL 190


>gi|15599195|ref|NP_252689.1| hypothetical protein PA4000 [Pseudomonas aeruginosa PAO1]
 gi|107103515|ref|ZP_01367433.1| hypothetical protein PaerPA_01004585 [Pseudomonas aeruginosa PACS2]
 gi|218889719|ref|YP_002438583.1| putative lipoprotein, rlpA family [Pseudomonas aeruginosa LESB58]
 gi|254242684|ref|ZP_04936006.1| hypothetical protein PA2G_03447 [Pseudomonas aeruginosa 2192]
 gi|20139856|sp|Q9X6V6|RLPA_PSEAE RecName: Full=RlpA-like lipoprotein; Flags: Precursor
 gi|4887206|gb|AAD32233.1|AF147448_4 rare lipoprotein A [Pseudomonas aeruginosa PAO1]
 gi|9950192|gb|AAG07387.1|AE004817_11 hypothetical protein PA4000 [Pseudomonas aeruginosa PAO1]
 gi|126196062|gb|EAZ60125.1| hypothetical protein PA2G_03447 [Pseudomonas aeruginosa 2192]
 gi|218769942|emb|CAW25703.1| possible lipoprotein, rlpA family [Pseudomonas aeruginosa LESB58]
          Length = 342

 Score =  132 bits (332), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 66/112 (58%), Positives = 81/112 (72%), Gaps = 1/112 (0%)

Query: 68  GKPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
             PY ++G+ Y P     AY  VG ASWYG  FHG+ TANGE Y    +TAAH TLPLPS
Sbjct: 79  ANPYTVLGKTYYPMNDARAYRMVGTASWYGTKFHGQATANGETYDLYGMTAAHKTLPLPS 138

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           YVRVTN++NG S++VRVNDRGP++S+R+IDLS AAAK L   E G ++V VE
Sbjct: 139 YVRVTNLDNGKSVIVRVNDRGPFYSDRVIDLSFAAAKKLGYAETGTARVKVE 190


>gi|239996932|ref|ZP_04717456.1| rare lipoprotein A [Alteromonas macleodii ATCC 27126]
          Length = 340

 Score =  132 bits (332), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 62/118 (52%), Positives = 81/118 (68%), Gaps = 1/118 (0%)

Query: 64  RYFLGKPYQIMGRWYVPRQY-TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTL 122
           R F  +PY+++G+ Y P      Y  VG ASWYG+ FHG LT+NGE Y    ++AAH TL
Sbjct: 85  RMFNSRPYKVLGKHYTPMDSGKGYEEVGYASWYGQKFHGHLTSNGETYNMFAMSAAHKTL 144

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           PLPSYVRVTN+EN    +VRVNDRGP+H +R+IDLS AAA  L    +G ++V +E +
Sbjct: 145 PLPSYVRVTNLENNKQAIVRVNDRGPFHDDRIIDLSYAAAVKLGYHSKGTARVKLEVI 202


>gi|296387447|ref|ZP_06876946.1| RlpA family lipoprotein [Pseudomonas aeruginosa PAb1]
          Length = 219

 Score =  132 bits (331), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 81/110 (73%), Gaps = 1/110 (0%)

Query: 70  PYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY ++G+ Y P     AY  VG ASWYG  FHG+ TANGE Y    +TAAH TLPLPSYV
Sbjct: 81  PYTVLGKTYYPMNDARAYRMVGTASWYGTKFHGQATANGETYDLYGMTAAHKTLPLPSYV 140

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           RVTN++NG S++VRVNDRGP++S+R+IDLS AAAK L   E G ++V VE
Sbjct: 141 RVTNLDNGKSVIVRVNDRGPFYSDRVIDLSFAAAKKLGYAETGTARVKVE 190


>gi|16126068|ref|NP_420632.1| rare lipoprotein A [Caulobacter crescentus CB15]
 gi|13423262|gb|AAK23800.1| rare lipoprotein A [Caulobacter crescentus CB15]
          Length = 312

 Score =  132 bits (331), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 83/121 (68%)

Query: 69  KPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           KPYQI G WY P +   Y  VG+ SWYG+ FH R T+NGE++     +AAH TLPLPS V
Sbjct: 48  KPYQIKGIWYYPHEDRNYNVVGIGSWYGEQFHNRKTSNGEIFDMNLPSAAHKTLPLPSLV 107

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGM 188
            VTN++NG  +++RVNDRGP+  +R+IDLS AAA  L    +GV++V V+Y+G A    +
Sbjct: 108 EVTNLDNGRKMILRVNDRGPFVGDRIIDLSKAAADELGYRRQGVARVRVKYVGPAPRRAL 167

Query: 189 D 189
           +
Sbjct: 168 E 168


>gi|330505014|ref|YP_004381883.1| rare lipoprotein A [Pseudomonas mendocina NK-01]
 gi|328919300|gb|AEB60131.1| rare lipoprotein A [Pseudomonas mendocina NK-01]
          Length = 337

 Score =  132 bits (331), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 66/112 (58%), Positives = 81/112 (72%), Gaps = 1/112 (0%)

Query: 68  GKPYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
             PY + G+ Y P Q    Y AVG ASWYG  FHG+ TANGE Y    +TAAH TLPLPS
Sbjct: 78  ASPYVVFGKQYYPIQDARRYQAVGPASWYGTKFHGQATANGETYDLYGMTAAHKTLPLPS 137

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           YVRVTN+ENG  +++RVNDRGP++S+R+IDLS AAAK L   E+G ++V VE
Sbjct: 138 YVRVTNLENGKVVILRVNDRGPFYSDRIIDLSFAAAKKLGYAEKGTARVKVE 189


>gi|114570006|ref|YP_756686.1| rare lipoprotein A [Maricaulis maris MCS10]
 gi|114340468|gb|ABI65748.1| rare lipoprotein A [Maricaulis maris MCS10]
          Length = 322

 Score =  131 bits (330), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 90/150 (60%)

Query: 38  YFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGK 97
           + P S     AS  + +   +        +G+ Y + GR Y P++   Y   G+ASWYG 
Sbjct: 42  WAPASTRSTRASGAVNASGLIASSSDHQKVGRAYTVAGRTYRPQRNDGYDETGIASWYGP 101

Query: 98  AFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDL 157
            FHGR TANGE +    +TAAH TLP+PS V VTN+ENG S++VR+NDRGP+  NRLIDL
Sbjct: 102 NFHGRPTANGETFDQHAMTAAHTTLPIPSIVEVTNLENGRSVIVRLNDRGPFVDNRLIDL 161

Query: 158 SNAAAKILRVEERGVSKVHVEYLGMALLNG 187
           S AAA  L     G++ V V YLG A  +G
Sbjct: 162 SRAAATELDYIGSGLAHVRVRYLGPAHEDG 191


>gi|221234838|ref|YP_002517274.1| lipoprotein [Caulobacter crescentus NA1000]
 gi|220964010|gb|ACL95366.1| lipoprotein [Caulobacter crescentus NA1000]
          Length = 329

 Score =  131 bits (330), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 83/121 (68%)

Query: 69  KPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           KPYQI G WY P +   Y  VG+ SWYG+ FH R T+NGE++     +AAH TLPLPS V
Sbjct: 65  KPYQIKGIWYYPHEDRNYNVVGIGSWYGEQFHNRKTSNGEIFDMNLPSAAHKTLPLPSLV 124

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGM 188
            VTN++NG  +++RVNDRGP+  +R+IDLS AAA  L    +GV++V V+Y+G A    +
Sbjct: 125 EVTNLDNGRKMILRVNDRGPFVGDRIIDLSKAAADELGYRRQGVARVRVKYVGPAPRRAL 184

Query: 189 D 189
           +
Sbjct: 185 E 185


>gi|58696981|ref|ZP_00372464.1| RlpA-like protein [Wolbachia endosymbiont of Drosophila simulans]
 gi|58698886|ref|ZP_00373753.1| RlpA-like protein [Wolbachia endosymbiont of Drosophila ananassae]
 gi|225630074|ref|YP_002726865.1| rare lipoprotein A, putative [Wolbachia sp. wRi]
 gi|58534595|gb|EAL58727.1| RlpA-like protein [Wolbachia endosymbiont of Drosophila ananassae]
 gi|58536773|gb|EAL60017.1| RlpA-like protein [Wolbachia endosymbiont of Drosophila simulans]
 gi|225592055|gb|ACN95074.1| rare lipoprotein A, putative [Wolbachia sp. wRi]
          Length = 224

 Score =  131 bits (330), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 94/168 (55%), Gaps = 27/168 (16%)

Query: 13  SVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQ 72
           + +C++ + MSSC FS+ +               TA              G Y +G  Y 
Sbjct: 6   AFLCLIFVLMSSCSFSNRF-------------NCTA--------------GHYKIGSSYT 38

Query: 73  IMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTN 132
           I G  Y P+    Y  +G+ASWYG   HG LTANGE +    I+AAH TLPLP +V VTN
Sbjct: 39  INGITYYPKNCKHYEEIGIASWYGIEDHGTLTANGEAFNRHLISAAHKTLPLPCFVLVTN 98

Query: 133 MENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +ENG  LV RVNDRGP+   R+IDLS  AA++L   + G++KV V+YL
Sbjct: 99  LENGRKLVTRVNDRGPFIEGRIIDLSEKAAQVLGFHKSGLAKVKVQYL 146


>gi|167646662|ref|YP_001684325.1| rare lipoprotein A [Caulobacter sp. K31]
 gi|167349092|gb|ABZ71827.1| rare lipoprotein A [Caulobacter sp. K31]
          Length = 318

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 79/122 (64%)

Query: 69  KPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           KPYQI G WY P+    Y   G+ SWYG+ FH R TANGEV+  +  +AAH TLPLPS V
Sbjct: 63  KPYQIRGIWYYPKAEPDYDEQGIGSWYGEQFHNRRTANGEVFDMDLPSAAHKTLPLPSIV 122

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGM 188
            +TN++NG  L VRVNDRGP+   R+IDLS AAA+ L     GV+ V V Y+G A     
Sbjct: 123 EITNLDNGRKLKVRVNDRGPFVDGRIIDLSKAAAEQLGYGRAGVAHVRVRYIGPAGKTPF 182

Query: 189 DQ 190
           DQ
Sbjct: 183 DQ 184


>gi|42520364|ref|NP_966279.1| rare lipoprotein A, putative [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|99035084|ref|ZP_01314873.1| hypothetical protein Wendoof_01000290 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
 gi|42410102|gb|AAS14213.1| rare lipoprotein A, putative [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 224

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 70/168 (41%), Positives = 94/168 (55%), Gaps = 27/168 (16%)

Query: 13  SVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQ 72
           + +C++ + +SSC FS+ +               TA              G Y +G  Y 
Sbjct: 6   TFLCLIFVLISSCSFSNRF-------------NCTA--------------GHYKIGSSYT 38

Query: 73  IMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTN 132
           I G  Y P+    Y  +G+ASWYG   HG LTANGE +    I+AAH TLPLP +V VTN
Sbjct: 39  INGITYYPKNCKHYEEIGIASWYGIEDHGTLTANGEAFNRHLISAAHKTLPLPCFVLVTN 98

Query: 133 MENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +ENG  LV RVNDRGP+   R+IDLS  AA++L   + G++KV V+YL
Sbjct: 99  LENGRKLVTRVNDRGPFIEGRIIDLSEKAAQVLGFHKSGLAKVKVQYL 146


>gi|77461188|ref|YP_350695.1| rare lipoprotein A [Pseudomonas fluorescens Pf0-1]
 gi|77385191|gb|ABA76704.1| putative lipoprotein [Pseudomonas fluorescens Pf0-1]
          Length = 335

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 83/114 (72%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P Q +  Y A G ASWYG  FHG+ TANGEVY    ++AAH TLPL
Sbjct: 77  YKANPYTVLGKTYFPLQESKTYVASGTASWYGTKFHGQNTANGEVYDLYGMSAAHKTLPL 136

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           PSYVRVTN++N  S+++RVNDRGP++S+R+IDLS AAAK L   E G ++V VE
Sbjct: 137 PSYVRVTNLDNNKSVILRVNDRGPFYSDRIIDLSYAAAKKLGYAEIGTARVKVE 190


>gi|261378517|ref|ZP_05983090.1| RlpA family protein [Neisseria cinerea ATCC 14685]
 gi|269145067|gb|EEZ71485.1| RlpA family protein [Neisseria cinerea ATCC 14685]
          Length = 239

 Score =  130 bits (326), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 63/138 (45%), Positives = 86/138 (62%), Gaps = 6/138 (4%)

Query: 44  YGVTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGR 102
           +   ++D +V  +++     R      Y++ G+ Y P  Q  A+   G ASWYG  FHGR
Sbjct: 20  FQTASADAVVKAEKLHASANR-----SYKVAGKRYTPINQVAAFTQTGNASWYGGRFHGR 74

Query: 103 LTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAA 162
            T+ GE Y     TAAH TLP+PSYVRVTN  NG S+VVR+NDRGP+HSNR+ID+S AAA
Sbjct: 75  KTSGGERYDMNAFTAAHKTLPIPSYVRVTNTRNGKSVVVRINDRGPFHSNRIIDVSKAAA 134

Query: 163 KILRVEERGVSKVHVEYL 180
           + L    +G + V +E +
Sbjct: 135 QQLGFVSQGTAHVKIEQI 152


>gi|119470844|ref|ZP_01613455.1| putative Rare lipoprotein A [Alteromonadales bacterium TW-7]
 gi|119446071|gb|EAW27350.1| putative Rare lipoprotein A [Alteromonadales bacterium TW-7]
          Length = 225

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 61/116 (52%), Positives = 83/116 (71%), Gaps = 1/116 (0%)

Query: 69  KPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY+++G+ Y P    T Y   G+ASWYG+ FHG  T+NGE+Y    +TAAH TLPLPS+
Sbjct: 32  RPYEVLGKRYTPMLDETGYKEEGIASWYGRKFHGYHTSNGEIYDMFAMTAAHKTLPLPSF 91

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VRVTN +NG S++VRVNDRGP+H +R+IDLS AAA  L     G +KV +E + ++
Sbjct: 92  VRVTNTQNGKSVIVRVNDRGPFHDDRIIDLSYAAAYKLGYYTHGTAKVKLEAIKLS 147


>gi|225677416|ref|ZP_03788383.1| rare lipoprotein A, putative [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225590560|gb|EEH11820.1| rare lipoprotein A, putative [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 224

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 78/119 (65%)

Query: 62  GGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPT 121
            G Y +G  Y I G  Y P+    Y  +G+ASWYG   HG LTANGE +    I+AAH T
Sbjct: 28  AGHYKIGSSYTINGITYYPKNCKHYEEIGIASWYGIEDHGTLTANGEAFNRHLISAAHKT 87

Query: 122 LPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           LPLP +V VTN+ENG  LV RVNDRGP+   R+IDLS  AA++L   + G++KV V+YL
Sbjct: 88  LPLPCFVLVTNLENGRKLVTRVNDRGPFIEGRIIDLSEKAAQVLGFHKSGLAKVKVQYL 146


>gi|226939035|ref|YP_002794106.1| RlpA [Laribacter hongkongensis HLHK9]
 gi|226713959|gb|ACO73097.1| RlpA [Laribacter hongkongensis HLHK9]
          Length = 308

 Score =  129 bits (323), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 64/111 (57%), Positives = 79/111 (71%), Gaps = 1/111 (0%)

Query: 69  KPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY +MG  Y P  +  AY A G ASWYG  FHGR TA+GE Y    +TAAHPTLP+PS+
Sbjct: 83  RPYSVMGVSYTPEVERKAYRARGKASWYGNKFHGRRTASGERYDMNELTAAHPTLPIPSF 142

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
            RVTN++NG S++VR+NDRGP+H  RLIDLS AAA  L   +RG + V VE
Sbjct: 143 ARVTNVKNGKSVIVRINDRGPFHKGRLIDLSYAAAHELGYVKRGSTDVVVE 193


>gi|157803859|ref|YP_001492408.1| rare lipoprotein A precursor [Rickettsia canadensis str. McKiel]
 gi|157785122|gb|ABV73623.1| rare lipoprotein A precursor [Rickettsia canadensis str. McKiel]
          Length = 228

 Score =  129 bits (323), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 99/172 (57%), Gaps = 15/172 (8%)

Query: 14  VVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRG---GGRYFLGKP 70
           ++ +   G+S C   +T K  +L Y  +  Y   + D        P      G Y +GK 
Sbjct: 11  ILLIFCFGLSGC---NTSKQKQLLYSHKYSYKELSKDD-------PHNLTYKGYYKVGKN 60

Query: 71  YQIMGRWYVPRQYTAYAAVGMASWYG--KAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           Y+I G+ Y P    ++  +G ASWYG    FHGR TANG+ +    +TAAH TLPLP  V
Sbjct: 61  YKIKGKTYKPHNPKSFTEIGYASWYGGRNGFHGRQTANGDRFNRNILTAAHKTLPLPCLV 120

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +VTN  N  S+++ VNDRGP+  NR+ID+S  AA+IL  + +G++KV +EYL
Sbjct: 121 KVTNKANNKSVILMVNDRGPFKKNRIIDVSQKAAEILAFKNQGITKVKIEYL 172


>gi|70732754|ref|YP_262517.1| RlpA family lipoprotein [Pseudomonas fluorescens Pf-5]
 gi|68347053|gb|AAY94659.1| lipoprotein, rlpA family [Pseudomonas fluorescens Pf-5]
          Length = 332

 Score =  129 bits (323), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 83/114 (72%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P Q +  Y A G ASWYG  FHG+ TANGEVY    ++AAH TLPL
Sbjct: 77  YKANPYTVLGKTYFPIQESKNYVASGTASWYGTKFHGQNTANGEVYDLYGMSAAHKTLPL 136

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           PSYV+VTN++N  S+++RVNDRGP++S+R+IDLS AAAK L   E G ++V VE
Sbjct: 137 PSYVKVTNLDNNRSVILRVNDRGPFYSDRIIDLSYAAAKKLGYAETGTARVKVE 190


>gi|261379648|ref|ZP_05984221.1| RlpA family protein [Neisseria subflava NJ9703]
 gi|284798133|gb|EFC53480.1| RlpA family protein [Neisseria subflava NJ9703]
          Length = 239

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 81/113 (71%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           + Y++ G+ Y P  + ++++  G ASWYG  FHGR T++GE Y    ++AAH TLP+PSY
Sbjct: 41  RSYKVAGKRYTPLTKVSSFSQTGKASWYGNQFHGRKTSSGERYNMNALSAAHKTLPIPSY 100

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            RVTNM+NG S++VRVNDRGP+H NR+ID+S AAA+ L    +G + V VE +
Sbjct: 101 ARVTNMQNGKSVIVRVNDRGPFHGNRVIDVSKAAAQQLGFINQGTANVKVEQI 153


>gi|323142852|ref|ZP_08077564.1| sporulation and cell division repeat protein [Succinatimonas hippei
           YIT 12066]
 gi|322417394|gb|EFY08016.1| sporulation and cell division repeat protein [Succinatimonas hippei
           YIT 12066]
          Length = 307

 Score =  128 bits (322), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 91/148 (61%), Gaps = 12/148 (8%)

Query: 60  RGGGRYF--LGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITA 117
           RGG + +  LGK Y++   W       +Y  +G ASWYG  FHG  T+NGE Y  +  +A
Sbjct: 76  RGGNKNYTVLGKSYKV---W---NDVKSYEEIGTASWYGPGFHGNKTSNGETYNQKGFSA 129

Query: 118 AHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           AH  LPLPSY++VTN+ N  S++VRVNDRGP+H NR+IDLS +AA+ L +  +G  KV +
Sbjct: 130 AHKNLPLPSYLKVTNLNNAKSVIVRVNDRGPFHGNRIIDLSESAARYLDIVRKGTGKVRI 189

Query: 178 EYLGMA----LLNGMDQEYLRSTVMVNS 201
           E + ++    +LN     Y+    + NS
Sbjct: 190 ELVKVSPDGTILNSSQSSYIAQNTVENS 217


>gi|332532442|ref|ZP_08408320.1| rare lipoprotein A precursor [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332038085|gb|EGI74532.1| rare lipoprotein A precursor [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 254

 Score =  128 bits (322), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 74/192 (38%), Positives = 107/192 (55%), Gaps = 4/192 (2%)

Query: 69  KPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY ++G+ Y P    T Y+  G+ASWYG+ FHG  T+NGE Y    +TAAH TLPLPS+
Sbjct: 61  RPYTVLGKSYSPMLDETGYSEEGIASWYGRKFHGYHTSNGETYDMFAMTAAHKTLPLPSF 120

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
           V+VTN  NG S++VRVNDRGP+H +R+IDLS AAA  L     G +KV +E + +A    
Sbjct: 121 VKVTNTANGKSVIVRVNDRGPFHDDRIIDLSYAAAYKLGYYTHGTAKVKLEAVTLAGATA 180

Query: 188 MDQEYLRSTVMVNSATVLPLGCQYREEIVVIPYLLTRSRT--VHLNNCDDDSLQKQREIS 245
             Q Y++       A +  L    RE+  +   ++ +     +HL   +D     +    
Sbjct: 181 R-QTYIQVAAGSTLANIEALASTLREQYKLPTNIVQKDDIYRLHLGPIEDTPHANEVLKK 239

Query: 246 LRERKKSNLIPL 257
           L+E +  N   L
Sbjct: 240 LKENQFQNAFLL 251


>gi|221134238|ref|ZP_03560543.1| rare lipoprotein A [Glaciecola sp. HTCC2999]
          Length = 285

 Score =  128 bits (322), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 101/181 (55%), Gaps = 10/181 (5%)

Query: 1   MKRFSCDCLLKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPR 60
           MK +   CL    + CV+V+  +S   SS     K++  P  +        I+  K  P 
Sbjct: 1   MKAYQSLCLF---ITCVLVMSCASS--SSNRYSMKVDSAPIILIP-DHEPSIIIPKHEPY 54

Query: 61  GGGRYFLGKPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAH 119
              R    +PY I G  Y P          G+ASWYG+ FHG LT+NGEV+     TAAH
Sbjct: 55  ---RLANMRPYTINGTDYQPVLSGKGIVQTGIASWYGQKFHGHLTSNGEVFDMYEFTAAH 111

Query: 120 PTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEY 179
            TLPLPSYVRVTN +NG  L+VRVNDRGP+HSNR+IDLS AAAK L     G + V +E 
Sbjct: 112 TTLPLPSYVRVTNTDNGKQLIVRVNDRGPFHSNRIIDLSFAAAKELDYLTTGTAPVKIEV 171

Query: 180 L 180
           +
Sbjct: 172 I 172


>gi|329889615|ref|ZP_08267958.1| rare lipoprotein A family protein [Brevundimonas diminuta ATCC
           11568]
 gi|328844916|gb|EGF94480.1| rare lipoprotein A family protein [Brevundimonas diminuta ATCC
           11568]
          Length = 295

 Score =  128 bits (322), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 75/179 (41%), Positives = 97/179 (54%), Gaps = 16/179 (8%)

Query: 9   LLKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLG 68
           LLKG+++      +++C       D      P     VT    IVSG             
Sbjct: 5   LLKGAMIAAAFSTLAACASLGGKGD-----APIGAPVVTDPAPIVSGTM----------- 48

Query: 69  KPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           +PYQI GRWY P++   Y  VG ASWYG   HGR T+ GE +    +TAAH TLPLPS V
Sbjct: 49  RPYQIRGRWYHPKEQPNYDEVGQASWYGSYHHGRSTSTGERFDMNGLTAAHKTLPLPSLV 108

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
            VTN  NG  +++RVNDRGP+   R+IDLS  AA+ L + ++GV  V V Y+G A   G
Sbjct: 109 EVTNRANGRRVILRVNDRGPFVDGRIIDLSRGAAEELGLLQQGVGDVRVRYVGPAPRQG 167


>gi|330987603|gb|EGH85706.1| rare lipoprotein A [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 342

 Score =  128 bits (321), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 82/114 (71%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P    T Y A G ASWYG  FHG+ TANGEVY    ++AAH TLPL
Sbjct: 81  YKANPYTVLGKTYFPMSDSTRYVASGTASWYGTKFHGQNTANGEVYDLYGMSAAHKTLPL 140

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           PSYV+VTN++N  ++++RVNDRGP++S+R+IDLS AAAK L   E G ++V VE
Sbjct: 141 PSYVKVTNLDNNRTVILRVNDRGPFYSDRIIDLSYAAAKKLGYAETGTARVKVE 194


>gi|241760664|ref|ZP_04758756.1| rare lipoprotein A [Neisseria flavescens SK114]
 gi|241318845|gb|EER55371.1| rare lipoprotein A [Neisseria flavescens SK114]
          Length = 239

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 81/113 (71%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           + Y++ G+ Y P  + ++++  G ASWYG  FHGR T++GE Y    ++AAH TLP+PSY
Sbjct: 41  RSYKVAGKRYTPLTKVSSFSQTGKASWYGNQFHGRKTSSGERYNMNALSAAHKTLPIPSY 100

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            RVTNM+NG S++VRVNDRGP+H NR+ID+S AAA+ L    +G + V VE +
Sbjct: 101 ARVTNMQNGKSVIVRVNDRGPFHGNRVIDVSKAAAQQLGFINQGSANVKVEQI 153


>gi|260767235|ref|ZP_05876176.1| rare lipoprotein A precursor [Vibrio furnissii CIP 102972]
 gi|260617743|gb|EEX42921.1| rare lipoprotein A precursor [Vibrio furnissii CIP 102972]
 gi|315180860|gb|ADT87774.1| rare lipoprotein A, hypothetical [Vibrio furnissii NCTC 11218]
          Length = 262

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/119 (54%), Positives = 82/119 (68%), Gaps = 3/119 (2%)

Query: 65  YFLG--KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPT 121
           Y LG  K Y + G+ Y + +  T +   G ASWYGK FHG LT+NGE+Y    +TAAH T
Sbjct: 53  YSLGGNKDYTLRGQNYQIVKNTTDFKERGQASWYGKKFHGHLTSNGEIYDMYSMTAAHKT 112

Query: 122 LPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           LPLPSYV+VTN++NG S VVRVNDRGP+H  R+IDLS AAA  L V + G + V +E +
Sbjct: 113 LPLPSYVKVTNLDNGKSTVVRVNDRGPFHDGRIIDLSYAAAYKLGVVQTGTANVEIEAI 171


>gi|330811927|ref|YP_004356389.1| hypothetical protein PSEBR_a4961 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327380035|gb|AEA71385.1| conserved hypothetical protein; putative lipoprotein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 341

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 82/114 (71%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P   +  Y A G ASWYG  FHG+ TANGEVY    ++AAH TLPL
Sbjct: 82  YKANPYTVLGKTYFPLSDSKRYVASGTASWYGTKFHGQNTANGEVYDLYGMSAAHKTLPL 141

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           PSYVRVTN++N  S+++RVNDRGP++S+R+IDLS AAAK L   E G ++V VE
Sbjct: 142 PSYVRVTNLDNNKSVILRVNDRGPFYSDRIIDLSYAAAKKLGYAEIGTARVKVE 195


>gi|261364324|ref|ZP_05977207.1| RlpA family protein [Neisseria mucosa ATCC 25996]
 gi|288567582|gb|EFC89142.1| RlpA family protein [Neisseria mucosa ATCC 25996]
          Length = 241

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/134 (45%), Positives = 87/134 (64%), Gaps = 6/134 (4%)

Query: 48  ASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTAN 106
           ++D IV  +++     R      Y++ G+ Y P  + + ++  G ASWYG  FHGR T++
Sbjct: 26  SADSIVRAEKLSSSANR-----SYKVAGKRYTPMTKVSNFSQTGNASWYGSQFHGRKTSS 80

Query: 107 GEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILR 166
           GE Y    +TAAH TLP+PSY RVTN +NG S++VRVNDRGP+H NR+ID+S AAA+ L 
Sbjct: 81  GERYNMNALTAAHKTLPIPSYARVTNTKNGKSVIVRVNDRGPFHGNRVIDVSKAAAQQLG 140

Query: 167 VEERGVSKVHVEYL 180
              +G + V VE +
Sbjct: 141 FINQGTAHVKVEQI 154


>gi|312963237|ref|ZP_07777721.1| lipoprotein A [Pseudomonas fluorescens WH6]
 gi|311282503|gb|EFQ61100.1| lipoprotein A [Pseudomonas fluorescens WH6]
          Length = 332

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 82/114 (71%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P Q +  Y   G ASWYG  FHG+ TANGEVY    ++AAH TLPL
Sbjct: 78  YKANPYTVLGKTYFPLQDSKTYVQSGTASWYGTKFHGQNTANGEVYDLYGMSAAHKTLPL 137

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           PSYVRVTN++N  ++++RVNDRGP++S+R+IDLS AAAK L   E G ++V VE
Sbjct: 138 PSYVRVTNLDNNRTVILRVNDRGPFYSDRIIDLSYAAAKKLGYAETGTARVKVE 191


>gi|229592799|ref|YP_002874918.1| putative lipoprotein [Pseudomonas fluorescens SBW25]
 gi|229364665|emb|CAY52596.1| putative lipoprotein [Pseudomonas fluorescens SBW25]
          Length = 334

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 82/114 (71%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P Q +  Y   G ASWYG  FHG+ TANGEVY    ++AAH TLPL
Sbjct: 80  YKANPYTVLGKSYFPLQDSKTYVQSGTASWYGTKFHGQNTANGEVYDLYGMSAAHKTLPL 139

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           PSYVRVTN++N  ++++RVNDRGP++S+R+IDLS AAAK L   E G ++V VE
Sbjct: 140 PSYVRVTNLDNNRTVILRVNDRGPFYSDRIIDLSYAAAKKLGYAETGTARVKVE 193


>gi|261400497|ref|ZP_05986622.1| RlpA family protein [Neisseria lactamica ATCC 23970]
 gi|269209757|gb|EEZ76212.1| RlpA family protein [Neisseria lactamica ATCC 23970]
 gi|309379778|emb|CBX21554.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 238

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 85/134 (63%), Gaps = 6/134 (4%)

Query: 48  ASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTAN 106
           ++D +V  +++     R      Y++ G+ Y P  Q   +   G ASWYG  FHGR T+ 
Sbjct: 24  SADAVVKAEKLHASANR-----SYKVAGKRYTPINQVAEFTQTGNASWYGGRFHGRKTSG 78

Query: 107 GEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILR 166
           GE Y     TAAH TLP+PSYVRVTN +NG S++VRVNDRGP+HSNR+ID+S AAA+ L 
Sbjct: 79  GERYDMNAFTAAHKTLPIPSYVRVTNTKNGKSVIVRVNDRGPFHSNRIIDVSKAAAQKLG 138

Query: 167 VEERGVSKVHVEYL 180
              +G + V +E +
Sbjct: 139 FVSQGTAHVKIEQI 152


>gi|127513866|ref|YP_001095063.1| rare lipoprotein A [Shewanella loihica PV-4]
 gi|126639161|gb|ABO24804.1| rare lipoprotein A [Shewanella loihica PV-4]
          Length = 265

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 82/122 (67%), Gaps = 5/122 (4%)

Query: 60  RGGGRYFLGKPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAA 118
           RGG R    K Y ++G+ Y V      Y   G+ASWYG  FHG LT+NGE Y    ++AA
Sbjct: 59  RGGNR----KEYTVLGKTYRVLDTGKGYQKTGIASWYGAKFHGHLTSNGETYDMYSMSAA 114

Query: 119 HPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           H TLPLPSYV+VTN+ N  S+VVRVNDRGP+H NR+IDLS AAA  L + + G +KV +E
Sbjct: 115 HKTLPLPSYVKVTNLANDKSVVVRVNDRGPFHDNRIIDLSYAAAHRLDMLKTGTAKVQLE 174

Query: 179 YL 180
            +
Sbjct: 175 VI 176


>gi|104783764|ref|YP_610262.1| lipoprotein, rare lipoprotein A family lipoprotein [Pseudomonas
           entomophila L48]
 gi|95112751|emb|CAK17479.1| putative lipoprotein, rare lipoprotein A family [Pseudomonas
           entomophila L48]
          Length = 332

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 83/114 (72%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY +MG+ Y P Q + +Y A G ASWYG  FHG+ TANGE+Y    ++AAH TLPL
Sbjct: 77  YKANPYTVMGKTYYPMQDSRSYRAEGTASWYGTKFHGQNTANGELYDLYGMSAAHKTLPL 136

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           P+YVRVTN+ NG ++++RVNDRGP++S+R+IDLS AAAK L   E G + V VE
Sbjct: 137 PAYVRVTNLANGRTVILRVNDRGPFYSDRIIDLSYAAAKKLGYAEIGTAHVRVE 190


>gi|331005792|ref|ZP_08329151.1| Rare lipoprotein A precursor [gamma proteobacterium IMCC1989]
 gi|330420429|gb|EGG94736.1| Rare lipoprotein A precursor [gamma proteobacterium IMCC1989]
          Length = 339

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 79/110 (71%), Gaps = 3/110 (2%)

Query: 70  PYQIMGRWY--VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           PY ++G+ Y  +P +   Y   G ASWYG  FHGR TANGEVY    +TAAH TLP+PSY
Sbjct: 65  PYTVLGKTYTLLP-ESEGYKEQGGASWYGTKFHGRRTANGEVYDMWGMTAAHKTLPIPSY 123

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           VRVTNMENG S++V VNDRGP+HS R+IDLS AAA  L   ++GV+ V V
Sbjct: 124 VRVTNMENGRSVIVLVNDRGPFHSERIIDLSYAAAVKLGFADQGVADVEV 173


>gi|319638739|ref|ZP_07993498.1| RlpA-like protein [Neisseria mucosa C102]
 gi|317399980|gb|EFV80642.1| RlpA-like protein [Neisseria mucosa C102]
          Length = 239

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 80/113 (70%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           + Y++ G+ Y    Q ++++  G ASWYG  FHGR T++GE Y    ++AAH TLP+PSY
Sbjct: 41  RSYKVAGKRYTSLTQVSSFSQTGKASWYGNQFHGRKTSSGERYNMNALSAAHKTLPIPSY 100

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            RVTNM+NG S++VRVNDRGP+H NR+ID+S AAA+ L    +G + V VE +
Sbjct: 101 ARVTNMQNGKSVIVRVNDRGPFHGNRVIDVSRAAAQQLGFINQGTANVKVEQI 153


>gi|325145260|gb|EGC67539.1| RlpA family protein [Neisseria meningitidis M01-240013]
          Length = 239

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/134 (45%), Positives = 85/134 (63%), Gaps = 6/134 (4%)

Query: 48  ASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTAN 106
           ++D +V  +++     R      Y++ G+ Y P+ Q   +   G ASWYG  FHGR T+ 
Sbjct: 24  SADAVVKAEKLHASANR-----SYKVAGKRYTPKNQVAEFTQTGNASWYGGRFHGRKTSG 78

Query: 107 GEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILR 166
           GE Y     TAAH TLP+PSYVRVTN +NG S++VRVNDRGP+H NR+ID+S AAA+ L 
Sbjct: 79  GERYDMNAFTAAHKTLPIPSYVRVTNTKNGKSVIVRVNDRGPFHGNRIIDVSKAAAQKLG 138

Query: 167 VEERGVSKVHVEYL 180
              +G + V +E +
Sbjct: 139 FVSQGTAHVKIEQI 152


>gi|313669262|ref|YP_004049546.1| periplasmic protein [Neisseria lactamica ST-640]
 gi|313006724|emb|CBN88194.1| putative periplasmic protein [Neisseria lactamica 020-06]
          Length = 238

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 77/113 (68%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           + Y++ G+ Y P  Q   +   G ASWYG  FHGR T+ GE Y     TAAH TLP+PSY
Sbjct: 40  RSYKVAGKRYTPINQVAEFTQTGNASWYGGRFHGRKTSGGERYDMNAFTAAHKTLPIPSY 99

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VRVTN +NG S++VRVNDRGP+HSNR+ID+S AAA+ L    +G + V +E +
Sbjct: 100 VRVTNTKNGKSVIVRVNDRGPFHSNRIIDVSKAAAQKLGFVSQGTAHVKIEQI 152


>gi|157376620|ref|YP_001475220.1| rare lipoprotein A [Shewanella sediminis HAW-EB3]
 gi|157318994|gb|ABV38092.1| rare lipoprotein A [Shewanella sediminis HAW-EB3]
          Length = 265

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 81/124 (65%), Gaps = 9/124 (7%)

Query: 60  RGGGR---YFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYIT 116
           RGG +     LGK YQ+M           Y A G+ASWYG  FHG LT+NGE Y    ++
Sbjct: 59  RGGNKKNYTVLGKGYQVMDSG------KGYQATGIASWYGSKFHGHLTSNGETYDMYSMS 112

Query: 117 AAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVH 176
           AAH TLPLPSYV+VTN++N   ++VRVNDRGP+H  R+IDLS AAA  L V + G +KV 
Sbjct: 113 AAHKTLPLPSYVKVTNLDNSKQVIVRVNDRGPFHEGRIIDLSYAAAHRLDVLKTGTAKVE 172

Query: 177 VEYL 180
           +E +
Sbjct: 173 IEVI 176


>gi|83648480|ref|YP_436915.1| lipoprotein [Hahella chejuensis KCTC 2396]
 gi|83636523|gb|ABC32490.1| Lipoprotein [Hahella chejuensis KCTC 2396]
          Length = 299

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 69/144 (47%), Positives = 89/144 (61%), Gaps = 5/144 (3%)

Query: 60  RGGGRYFLGKPYQIMGR-WYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAA 118
           RGG +     PY + G+ +YV      Y   G+ASWYG  FHG  T+NGE Y     TAA
Sbjct: 66  RGGNK----SPYSVWGKTYYVMNSSDGYVEEGVASWYGTKFHGYKTSNGETYNMYDYTAA 121

Query: 119 HPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           H +LPLP+YVRVTN+ENG S++VRVNDRGP+H  RLIDLS AAAK L  +++G ++V VE
Sbjct: 122 HKSLPLPTYVRVTNLENGRSVIVRVNDRGPFHGGRLIDLSYAAAKKLGYDKKGTARVRVE 181

Query: 179 YLGMALLNGMDQEYLRSTVMVNSA 202
            +  A           S  +V +A
Sbjct: 182 VVTEATTPAQVAHAATSKPVVTAA 205


>gi|148553406|ref|YP_001260988.1| rare lipoprotein A [Sphingomonas wittichii RW1]
 gi|148498596|gb|ABQ66850.1| rare lipoprotein A [Sphingomonas wittichii RW1]
          Length = 303

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 75/105 (71%)

Query: 67  LGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
           +GKPYQ+ G WY P     Y  VG+ASWYG  FHG  TANGE +  + + AAH TLPLPS
Sbjct: 47  VGKPYQVAGVWYYPSDEAGYDEVGLASWYGAQFHGGQTANGEQFDMDRVGAAHKTLPLPS 106

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERG 171
           YV VT ++ G ++VVR+NDRGP+ +NR+IDLS  +A++L +E  G
Sbjct: 107 YVEVTALDTGRTIVVRINDRGPFVTNRIIDLSRRSAQLLGIERAG 151


>gi|170719803|ref|YP_001747491.1| rare lipoprotein A [Pseudomonas putida W619]
 gi|169757806|gb|ACA71122.1| rare lipoprotein A [Pseudomonas putida W619]
          Length = 332

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 82/114 (71%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P Q +  Y A G ASWYG  FHG+ TANGE+Y    ++AAH TLPL
Sbjct: 77  YKANPYTVLGKTYYPMQDSRNYRAEGTASWYGTKFHGQNTANGELYDLYGMSAAHKTLPL 136

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           P+YVRVTN+ NG S+++RVNDRGP++S+R+IDLS AAAK L   E G + V VE
Sbjct: 137 PAYVRVTNLANGRSVILRVNDRGPFYSDRIIDLSYAAAKKLGYAESGTAHVRVE 190


>gi|237798411|ref|ZP_04586872.1| rare lipoprotein A [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331021263|gb|EGI01320.1| rare lipoprotein A [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 342

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/114 (53%), Positives = 82/114 (71%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P   +  Y A G ASWYG  FHG+ TANGEVY    ++AAH TLPL
Sbjct: 81  YKANPYTVLGKTYFPMSDSKRYVATGTASWYGTKFHGQNTANGEVYDLYGMSAAHKTLPL 140

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           PSYV+VTN++N  ++++RVNDRGP++S+R+IDLS AAAK L   E G ++V VE
Sbjct: 141 PSYVKVTNLDNNRTVILRVNDRGPFYSDRIIDLSYAAAKKLGYAETGTARVKVE 194


>gi|90416210|ref|ZP_01224142.1| lipoprotein, rare lipoprotein A family protein [marine gamma
           proteobacterium HTCC2207]
 gi|90331935|gb|EAS47149.1| lipoprotein, rare lipoprotein A family protein [marine gamma
           proteobacterium HTCC2207]
          Length = 289

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 78/113 (69%), Gaps = 3/113 (2%)

Query: 70  PYQIMGR--WYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           PY++ G+  W +P     Y   G+ASWYG  FHGRLT+NGE+Y    +TAAH TLP+P Y
Sbjct: 65  PYEVFGKTYWVLPSS-NGYKETGIASWYGTKFHGRLTSNGEIYNMYGMTAAHKTLPIPCY 123

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            RVTN+ENG S+VVR+NDRGP+H  RLIDLS  AA  L   ++G + V +E +
Sbjct: 124 ARVTNVENGSSVVVRINDRGPFHGARLIDLSYVAAMKLGYADKGTANVLIEVI 176


>gi|325205351|gb|ADZ00804.1| RlpA family protein [Neisseria meningitidis M04-240196]
          Length = 239

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/134 (45%), Positives = 85/134 (63%), Gaps = 6/134 (4%)

Query: 48  ASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTAN 106
           ++D +V  +++     R      Y++ G+ Y P+ Q   +   G ASWYG  FHGR T+ 
Sbjct: 24  SADAVVKAEKLHASANR-----SYKVAGKRYTPKNQVAEFTQTGNASWYGGRFHGRKTSG 78

Query: 107 GEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILR 166
           GE Y     TAAH TLP+PSYVRVTN +NG S++VRVNDRGP+H NR+ID+S AAA+ L 
Sbjct: 79  GERYDMNAFTAAHKTLPIPSYVRVTNTKNGKSVIVRVNDRGPFHGNRIIDVSKAAAQKLG 138

Query: 167 VEERGVSKVHVEYL 180
              +G + V +E +
Sbjct: 139 FVSQGTAHVKIEQI 152


>gi|237809571|ref|YP_002894011.1| rare lipoprotein A [Tolumonas auensis DSM 9187]
 gi|237501832|gb|ACQ94425.1| rare lipoprotein A [Tolumonas auensis DSM 9187]
          Length = 218

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 82/114 (71%), Gaps = 1/114 (0%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y+I G++Y + +    Y A G+ASWYG  FHGRLTANGEVY    I+AAH +LPLPS++ 
Sbjct: 96  YEIDGKYYPIWKDIKEYTAEGLASWYGPGFHGRLTANGEVYDQYAISAAHQSLPLPSFIH 155

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VTN++NG +LVVRVNDRGP+  +RL+DLS  AA  L + E GV +V +E +  A
Sbjct: 156 VTNLDNGRTLVVRVNDRGPFVGDRLLDLSYGAAARLGIVEDGVVRVKIELINAA 209


>gi|330963467|gb|EGH63727.1| rare lipoprotein A [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 342

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/114 (53%), Positives = 82/114 (71%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P   +  Y A G ASWYG  FHG+ TANGEVY    ++AAH TLPL
Sbjct: 81  YKANPYTVLGKTYFPMSDSKRYVASGTASWYGTKFHGQNTANGEVYDLYGMSAAHKTLPL 140

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           PSYV+VTN++N  ++++RVNDRGP++S+R+IDLS AAAK L   E G ++V VE
Sbjct: 141 PSYVKVTNLDNNRTVILRVNDRGPFYSDRIIDLSYAAAKKLGYAESGTARVKVE 194


>gi|121634137|ref|YP_974382.1| putative periplasmic protein [Neisseria meningitidis FAM18]
 gi|161870796|ref|YP_001599969.1| RlpA-like protein precursor [Neisseria meningitidis 053442]
 gi|120865843|emb|CAM09575.1| putative periplasmic protein [Neisseria meningitidis FAM18]
 gi|161596349|gb|ABX74009.1| RlpA-like protein precursor [Neisseria meningitidis 053442]
 gi|261391798|emb|CAX49253.1| putative RlpA-like protein [Neisseria meningitidis 8013]
 gi|325131589|gb|EGC54296.1| RlpA family protein [Neisseria meningitidis M6190]
          Length = 239

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/134 (45%), Positives = 85/134 (63%), Gaps = 6/134 (4%)

Query: 48  ASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTAN 106
           ++D +V  +++     R      Y++ G+ Y P+ Q   +   G ASWYG  FHGR T+ 
Sbjct: 24  SADAVVKAEKLHASANR-----SYKVAGKRYTPKNQVAEFTQTGNASWYGGRFHGRKTSG 78

Query: 107 GEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILR 166
           GE Y     TAAH TLP+PSYVRVTN +NG S++VRVNDRGP+H NR+ID+S AAA+ L 
Sbjct: 79  GERYDMNAFTAAHKTLPIPSYVRVTNTKNGKSVIVRVNDRGPFHGNRIIDVSKAAAQKLG 138

Query: 167 VEERGVSKVHVEYL 180
              +G + V +E +
Sbjct: 139 FVSQGTAHVKIEQI 152


>gi|330873584|gb|EGH07733.1| rare lipoprotein A [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
          Length = 342

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/114 (53%), Positives = 82/114 (71%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P   +  Y A G ASWYG  FHG+ TANGEVY    ++AAH TLPL
Sbjct: 81  YKANPYTVLGKTYFPMSDSKRYVASGTASWYGTKFHGQNTANGEVYDLYGMSAAHKTLPL 140

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           PSYV+VTN++N  ++++RVNDRGP++S+R+IDLS AAAK L   E G ++V VE
Sbjct: 141 PSYVKVTNLDNNRTVILRVNDRGPFYSDRIIDLSYAAAKKLGYAESGTARVKVE 194


>gi|325139156|gb|EGC61702.1| RlpA family protein [Neisseria meningitidis ES14902]
 gi|325203382|gb|ADY98835.1| RlpA family protein [Neisseria meningitidis M01-240355]
          Length = 239

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/134 (45%), Positives = 85/134 (63%), Gaps = 6/134 (4%)

Query: 48  ASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTAN 106
           ++D +V  +++     R      Y++ G+ Y P+ Q   +   G ASWYG  FHGR T+ 
Sbjct: 24  SADAVVKAEKLHASANR-----SYKVAGKRYTPKNQVAEFTQTGNASWYGGRFHGRKTSG 78

Query: 107 GEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILR 166
           GE Y     TAAH TLP+PSYVRVTN +NG S++VRVNDRGP+H NR+ID+S AAA+ L 
Sbjct: 79  GERYDMNAFTAAHKTLPIPSYVRVTNTKNGKSVIVRVNDRGPFHGNRIIDVSKAAAQKLG 138

Query: 167 VEERGVSKVHVEYL 180
              +G + V +E +
Sbjct: 139 FVSQGTAHVKIEQI 152


>gi|15676191|ref|NP_273323.1| hypothetical protein NMB0267 [Neisseria meningitidis MC58]
 gi|20139761|sp|Q9K1A0|RLPA_NEIMB RecName: Full=RlpA-like protein; Flags: Precursor
 gi|7225491|gb|AAF40721.1| conserved hypothetical protein [Neisseria meningitidis MC58]
 gi|316985196|gb|EFV64148.1| rare lipoA family protein [Neisseria meningitidis H44/76]
 gi|325135070|gb|EGC57698.1| RlpA family protein [Neisseria meningitidis M13399]
 gi|325141103|gb|EGC63606.1| RlpA family protein [Neisseria meningitidis CU385]
 gi|325199470|gb|ADY94925.1| RlpA family protein [Neisseria meningitidis H44/76]
          Length = 239

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/134 (45%), Positives = 85/134 (63%), Gaps = 6/134 (4%)

Query: 48  ASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTAN 106
           ++D +V  +++     R      Y++ G+ Y P+ Q   +   G ASWYG  FHGR T+ 
Sbjct: 24  SADAVVKAEKLHASANR-----SYKVAGKRYTPKNQVAEFTQTGNASWYGGRFHGRKTSG 78

Query: 107 GEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILR 166
           GE Y     TAAH TLP+PSYVRVTN +NG S++VRVNDRGP+H NR+ID+S AAA+ L 
Sbjct: 79  GERYDMNAFTAAHKTLPIPSYVRVTNTKNGKSVIVRVNDRGPFHGNRIIDVSKAAAQKLG 138

Query: 167 VEERGVSKVHVEYL 180
              +G + V +E +
Sbjct: 139 FVNQGTAHVKIEQI 152


>gi|325143106|gb|EGC65453.1| RlpA family protein [Neisseria meningitidis 961-5945]
 gi|325197551|gb|ADY93007.1| RlpA family protein [Neisseria meningitidis G2136]
          Length = 239

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/134 (45%), Positives = 85/134 (63%), Gaps = 6/134 (4%)

Query: 48  ASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTAN 106
           ++D +V  +++     R      Y++ G+ Y P+ Q   +   G ASWYG  FHGR T+ 
Sbjct: 24  SADAVVKAEKLHASANR-----SYKVAGKRYTPKNQVAEFTQTGNASWYGGRFHGRKTSG 78

Query: 107 GEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILR 166
           GE Y     TAAH TLP+PSYVRVTN +NG S++VRVNDRGP+H NR+ID+S AAA+ L 
Sbjct: 79  GERYDMNAFTAAHKTLPIPSYVRVTNTKNGKSVIVRVNDRGPFHGNRIIDVSKAAAQKLG 138

Query: 167 VEERGVSKVHVEYL 180
              +G + V +E +
Sbjct: 139 FVSQGTAHVKIEQI 152


>gi|254805690|ref|YP_003083911.1| rare lipoprotein A family protein [Neisseria meningitidis alpha14]
 gi|254669232|emb|CBA08076.1| rare lipoprotein A family protein [Neisseria meningitidis alpha14]
          Length = 239

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/134 (45%), Positives = 85/134 (63%), Gaps = 6/134 (4%)

Query: 48  ASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTAN 106
           ++D +V  +++     R      Y++ G+ Y P+ Q   +   G ASWYG  FHGR T+ 
Sbjct: 24  SADAVVKAEKLHASANR-----SYKVAGKRYTPKNQVAEFTQTGNASWYGGRFHGRKTSG 78

Query: 107 GEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILR 166
           GE Y     TAAH TLP+PSYVRVTN +NG S++VRVNDRGP+H NR+ID+S AAA+ L 
Sbjct: 79  GERYDMNAFTAAHKTLPIPSYVRVTNTKNGKSVIVRVNDRGPFHGNRIIDVSKAAAQKLG 138

Query: 167 VEERGVSKVHVEYL 180
              +G + V +E +
Sbjct: 139 FVNQGTAHVKIEQI 152


>gi|71736614|ref|YP_276520.1| RlpA family lipoprotein [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|257482225|ref|ZP_05636266.1| RlpA family lipoprotein [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|289625779|ref|ZP_06458733.1| RlpA family lipoprotein [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289648435|ref|ZP_06479778.1| RlpA family lipoprotein [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|298488988|ref|ZP_07007011.1| Rare lipoprotein A precursor [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|71557167|gb|AAZ36378.1| lipoprotein, rlpA family [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|298156486|gb|EFH97583.1| Rare lipoprotein A precursor [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|330867175|gb|EGH01884.1| rare lipoprotein A [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330871063|gb|EGH05772.1| rare lipoprotein A [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330873697|gb|EGH07846.1| rare lipoprotein A [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330887944|gb|EGH20605.1| rare lipoprotein A [Pseudomonas syringae pv. mori str. 301020]
 gi|331011312|gb|EGH91368.1| rare lipoprotein A [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 342

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/114 (53%), Positives = 82/114 (71%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P   +  Y A G ASWYG  FHG+ TANGEVY    ++AAH TLPL
Sbjct: 81  YKANPYTVLGKTYFPMSDSKRYVASGTASWYGTKFHGQNTANGEVYDLYGMSAAHKTLPL 140

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           PSYV+VTN++N  ++++RVNDRGP++S+R+IDLS AAAK L   E G ++V VE
Sbjct: 141 PSYVKVTNLDNNRTVILRVNDRGPFYSDRIIDLSYAAAKKLGYAETGTARVKVE 194


>gi|326794761|ref|YP_004312581.1| lipoprotein A [Marinomonas mediterranea MMB-1]
 gi|326545525|gb|ADZ90745.1| rare lipoprotein A [Marinomonas mediterranea MMB-1]
          Length = 305

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 85/122 (69%), Gaps = 5/122 (4%)

Query: 60  RGGGRYFLGKPYQIMGR-WYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAA 118
           RGG +     PY + G+ +YV      Y+A G ASWYGK FHG  T+NGE Y     +AA
Sbjct: 73  RGGNK----SPYVVWGKQYYVMSSAEGYSAQGTASWYGKKFHGHKTSNGETYDMYAFSAA 128

Query: 119 HPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           H +LPLP+Y++VTN++NG S++VRVNDRGP+H +RLIDLS AAA  L   ++G+++V VE
Sbjct: 129 HKSLPLPTYLKVTNIDNGRSVIVRVNDRGPFHGDRLIDLSYAAAVRLDYHKKGLARVKVE 188

Query: 179 YL 180
            +
Sbjct: 189 AI 190


>gi|218768950|ref|YP_002343462.1| putative periplasmic protein [Neisseria meningitidis Z2491]
 gi|20139752|sp|Q9JSM7|RLPA_NEIMA RecName: Full=RlpA-like protein; Flags: Precursor
 gi|121052958|emb|CAM09312.1| putative periplasmic protein [Neisseria meningitidis Z2491]
 gi|319411248|emb|CBY91655.1| putative RlpA-like protein [Neisseria meningitidis WUE 2594]
          Length = 239

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 86/138 (62%), Gaps = 6/138 (4%)

Query: 44  YGVTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGR 102
           +   ++D +V  +++     R      Y++ G+ Y P+ Q   +   G ASWYG  FHGR
Sbjct: 20  FQTASADAVVRAEKLHASANR-----SYKVAGKRYTPKNQVAEFTQTGNASWYGGRFHGR 74

Query: 103 LTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAA 162
            T+ GE Y     TAAH TLP+PSYVRVTN +NG S++VRVNDRGP+H NR+ID+S AAA
Sbjct: 75  KTSGGERYDMNAFTAAHKTLPIPSYVRVTNTKNGKSVIVRVNDRGPFHGNRIIDVSKAAA 134

Query: 163 KILRVEERGVSKVHVEYL 180
           + L    +G + V +E +
Sbjct: 135 QKLGFVNQGTAHVKIEQI 152


>gi|254671570|emb|CBA09219.1| putative lipoprotein [Neisseria meningitidis alpha153]
 gi|325128976|gb|EGC51827.1| RlpA family protein [Neisseria meningitidis N1568]
 gi|325137092|gb|EGC59688.1| RlpA family protein [Neisseria meningitidis M0579]
 gi|325202906|gb|ADY98360.1| RlpA family protein [Neisseria meningitidis M01-240149]
 gi|325207295|gb|ADZ02747.1| RlpA family protein [Neisseria meningitidis NZ-05/33]
          Length = 239

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/134 (45%), Positives = 85/134 (63%), Gaps = 6/134 (4%)

Query: 48  ASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTAN 106
           ++D +V  +++     R      Y++ G+ Y P+ Q   +   G ASWYG  FHGR T+ 
Sbjct: 24  SADAVVKAEKLHASANR-----SYKVAGKRYTPKNQVAEFTQTGNASWYGGRFHGRKTSG 78

Query: 107 GEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILR 166
           GE Y     TAAH TLP+PSYVRVTN +NG S++VRVNDRGP+H NR+ID+S AAA+ L 
Sbjct: 79  GERYDMNAFTAAHKTLPIPSYVRVTNTKNGKSVIVRVNDRGPFHGNRIIDVSKAAAQKLG 138

Query: 167 VEERGVSKVHVEYL 180
              +G + V +E +
Sbjct: 139 FVNQGTAHVKIEQI 152


>gi|254483520|ref|ZP_05096747.1| putative rare lipoprotein A double-psi beta-barrel protein [marine
           gamma proteobacterium HTCC2148]
 gi|214036241|gb|EEB76921.1| putative rare lipoprotein A double-psi beta-barrel protein [marine
           gamma proteobacterium HTCC2148]
          Length = 278

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 64/115 (55%), Positives = 78/115 (67%), Gaps = 1/115 (0%)

Query: 70  PYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY + G  Y V + Y  Y   G ASWYG  FHG  T+NGE++ T   +AAH TLP+PSY 
Sbjct: 77  PYSVNGVNYEVLKDYRNYREQGTASWYGSKFHGHETSNGEIFDTYGASAAHKTLPIPSYA 136

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           RVTN++NG S+VVRVNDRGP+H NRLIDLS  AA  L   E+G + V VE L +A
Sbjct: 137 RVTNLDNGRSVVVRVNDRGPFHGNRLIDLSYGAAVKLGYMEKGTASVEVEVLNIA 191


>gi|296313718|ref|ZP_06863659.1| RlpA family protein [Neisseria polysaccharea ATCC 43768]
 gi|296839641|gb|EFH23579.1| RlpA family protein [Neisseria polysaccharea ATCC 43768]
          Length = 239

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/134 (45%), Positives = 85/134 (63%), Gaps = 6/134 (4%)

Query: 48  ASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTAN 106
           ++D +V  +++     R      Y++ G+ Y P  Q   +   G ASWYG  FHGR T+ 
Sbjct: 24  SADAVVKAEKLHASANR-----SYKVAGKRYTPINQVAEFTQTGNASWYGGRFHGRKTSG 78

Query: 107 GEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILR 166
           G+ Y     TAAH TLP+PSYVRVTN +NG S+VVR+NDRGP+HSNR+ID+S AAA+ L 
Sbjct: 79  GDRYDMNAFTAAHKTLPIPSYVRVTNTKNGKSVVVRINDRGPFHSNRIIDVSKAAAQQLG 138

Query: 167 VEERGVSKVHVEYL 180
              +G + V +E +
Sbjct: 139 FVSQGTAHVKIEQI 152


>gi|308388486|gb|ADO30806.1| putative periplasmic protein [Neisseria meningitidis alpha710]
 gi|325130993|gb|EGC53720.1| RlpA family protein [Neisseria meningitidis OX99.30304]
          Length = 239

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/134 (45%), Positives = 85/134 (63%), Gaps = 6/134 (4%)

Query: 48  ASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTAN 106
           ++D +V  +++     R      Y++ G+ Y P+ Q   +   G ASWYG  FHGR T+ 
Sbjct: 24  SADAVVKAEKLHASANR-----SYKVAGKRYTPKNQVAEFTQTGNASWYGGRFHGRKTSG 78

Query: 107 GEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILR 166
           GE Y     TAAH TLP+PSYVRVTN +NG S++VRVNDRGP+H NR+ID+S AAA+ L 
Sbjct: 79  GERYDMNAFTAAHKTLPIPSYVRVTNTKNGKSVIVRVNDRGPFHGNRIIDVSKAAAQKLG 138

Query: 167 VEERGVSKVHVEYL 180
              +G + V +E +
Sbjct: 139 FVNQGTAHVKIEQI 152


>gi|254448506|ref|ZP_05061966.1| rare lipoprotein A [gamma proteobacterium HTCC5015]
 gi|198261889|gb|EDY86174.1| rare lipoprotein A [gamma proteobacterium HTCC5015]
          Length = 256

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 104/185 (56%), Gaps = 30/185 (16%)

Query: 8   CLLKGSVVCVVVLGMSSCFFSST--------YKDDKLEYFPESMYGVTASDRIVSGKRVP 59
            +L+ ++  ++VLG+++C   S+        Y   +    P S YG  AS          
Sbjct: 2   TILRWTLPALLVLGLAACGGDSSTRPAEYSNYSGPECTLGPRSKYGNPAS---------- 51

Query: 60  RGGGRYFLGKPYQIMG-RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAA 118
                      Y++MG R+YV      +   G+ASWYG  FHG+ T++GEVY    +TAA
Sbjct: 52  -----------YEVMGKRYYVRPTACGFKQRGIASWYGPGFHGKRTSSGEVYDMHGMTAA 100

Query: 119 HPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           H TLPLP+ V+VTN++ G SLVVRVNDRGP+H  R+IDLS AAA+ L V + G   V +E
Sbjct: 101 HKTLPLPAKVKVTNLDTGESLVVRVNDRGPFHEGRIIDLSKAAAQRLGVIKHGTVPVEIE 160

Query: 179 YLGMA 183
            +G A
Sbjct: 161 TVGTA 165


>gi|254674130|emb|CBA09914.1| putative lipoprotein [Neisseria meningitidis alpha275]
          Length = 239

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/134 (45%), Positives = 85/134 (63%), Gaps = 6/134 (4%)

Query: 48  ASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTAN 106
           ++D +V  +++     R      Y++ G+ Y P+ Q   +   G ASWYG  FHGR T+ 
Sbjct: 24  SADAVVKAEKLHASANR-----SYKVAGKRYTPKNQVAEFTQTGNASWYGGRFHGRKTSG 78

Query: 107 GEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILR 166
           GE Y     TAAH TLP+PSYVRVTN +NG S++VRVNDRGP+H NR+ID+S AAA+ L 
Sbjct: 79  GERYDMNAFTAAHKTLPIPSYVRVTNTKNGKSVIVRVNDRGPFHGNRIIDVSKAAAQKLG 138

Query: 167 VEERGVSKVHVEYL 180
              +G + V +E +
Sbjct: 139 FVSQGTAHVKIEQI 152


>gi|134035022|sp|Q4ULW1|RLPA_RICFE RecName: Full=RlpA-like lipoprotein; Flags: Precursor
          Length = 228

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 58/121 (47%), Positives = 80/121 (66%), Gaps = 3/121 (2%)

Query: 63  GRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYG---KAFHGRLTANGEVYGTEYITAAH 119
           G Y +GK Y+I G+ Y P    ++   G ASWYG     FHG+ TANG+ +    +TAAH
Sbjct: 50  GHYKVGKNYKIKGKTYKPHSTKSFTETGYASWYGGRKDGFHGKKTANGDRFNRNLLTAAH 109

Query: 120 PTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEY 179
            TLPLP  V+VTN  N  S+++ VNDRGP+  NR+ID+S  AA+IL  + +G++KV +EY
Sbjct: 110 KTLPLPCLVKVTNKANNKSVILMVNDRGPFKKNRIIDVSQKAAEILAFKNQGITKVKIEY 169

Query: 180 L 180
           L
Sbjct: 170 L 170


>gi|67459003|ref|YP_246627.1| rare lipoprotein A precursor [Rickettsia felis URRWXCal2]
 gi|67004536|gb|AAY61462.1| Rare lipoprotein A precursor [Rickettsia felis URRWXCal2]
          Length = 230

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 58/121 (47%), Positives = 80/121 (66%), Gaps = 3/121 (2%)

Query: 63  GRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYG---KAFHGRLTANGEVYGTEYITAAH 119
           G Y +GK Y+I G+ Y P    ++   G ASWYG     FHG+ TANG+ +    +TAAH
Sbjct: 52  GHYKVGKNYKIKGKTYKPHSTKSFTETGYASWYGGRKDGFHGKKTANGDRFNRNLLTAAH 111

Query: 120 PTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEY 179
            TLPLP  V+VTN  N  S+++ VNDRGP+  NR+ID+S  AA+IL  + +G++KV +EY
Sbjct: 112 KTLPLPCLVKVTNKANNKSVILMVNDRGPFKKNRIIDVSQKAAEILAFKNQGITKVKIEY 171

Query: 180 L 180
           L
Sbjct: 172 L 172


>gi|66047589|ref|YP_237430.1| rare lipoprotein A [Pseudomonas syringae pv. syringae B728a]
 gi|63258296|gb|AAY39392.1| Rare lipoprotein A [Pseudomonas syringae pv. syringae B728a]
          Length = 342

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 61/114 (53%), Positives = 81/114 (71%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P      Y A G ASWYG  FHG+ TANGEVY    ++AAH TLPL
Sbjct: 81  YKANPYTVLGKTYFPMSDAKRYVASGTASWYGTKFHGQNTANGEVYDLYGMSAAHKTLPL 140

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           PSYV+VTN++N  ++++RVNDRGP++S+R+IDLS AAAK L   E G ++V VE
Sbjct: 141 PSYVKVTNLDNNRTVILRVNDRGPFYSDRIIDLSYAAAKKLGYAESGTARVKVE 194


>gi|330959964|gb|EGH60224.1| rare lipoprotein A [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 343

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 61/114 (53%), Positives = 82/114 (71%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P   +  Y A G ASWYG  FHG+ TANGEVY    ++AAH TLPL
Sbjct: 82  YKANPYTVLGKTYFPMSDSKRYVASGTASWYGTKFHGQNTANGEVYDLYGMSAAHKTLPL 141

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           PSYV+VTN++N  ++++RVNDRGP++S+R+IDLS AAAK L   E G ++V VE
Sbjct: 142 PSYVKVTNLDNNRTVILRVNDRGPFYSDRIIDLSYAAAKKLGYAETGTARVKVE 195


>gi|289675747|ref|ZP_06496637.1| rare lipoprotein A [Pseudomonas syringae pv. syringae FF5]
 gi|330976832|gb|EGH76864.1| rare lipoprotein A [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 342

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 61/114 (53%), Positives = 81/114 (71%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P      Y A G ASWYG  FHG+ TANGEVY    ++AAH TLPL
Sbjct: 81  YKANPYTVLGKTYFPMSDAKRYVASGTASWYGTKFHGQNTANGEVYDLYGMSAAHKTLPL 140

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           PSYV+VTN++N  ++++RVNDRGP++S+R+IDLS AAAK L   E G ++V VE
Sbjct: 141 PSYVKVTNLDNNRTVILRVNDRGPFYSDRIIDLSYAAAKKLGYAETGTARVKVE 194


>gi|225023965|ref|ZP_03713157.1| hypothetical protein EIKCOROL_00832 [Eikenella corrodens ATCC
           23834]
 gi|224942990|gb|EEG24199.1| hypothetical protein EIKCOROL_00832 [Eikenella corrodens ATCC
           23834]
          Length = 268

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 61/116 (52%), Positives = 80/116 (68%), Gaps = 7/116 (6%)

Query: 69  KPYQIMGRWYVP----RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           + YQ+ G  Y P    RQ+T     G ASWYG+ FHGRLTA+GE Y    +TAAH TLP+
Sbjct: 66  RSYQVRGVRYTPMTNVRQFTQ---TGRASWYGRQFHGRLTASGERYDMNLMTAAHKTLPI 122

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           PSY RVTN+ NG S+VVR+NDRGP+HS+R+ID+S +AA+ L     G + V +E +
Sbjct: 123 PSYARVTNLSNGKSVVVRINDRGPFHSSRVIDVSQSAARQLGFINAGTANVRIEQI 178


>gi|330953022|gb|EGH53282.1| rare lipoprotein A [Pseudomonas syringae Cit 7]
          Length = 342

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 61/114 (53%), Positives = 81/114 (71%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P      Y A G ASWYG  FHG+ TANGEVY    ++AAH TLPL
Sbjct: 81  YKANPYTVLGKTYFPMSDAKRYVASGTASWYGTKFHGQNTANGEVYDLYGMSAAHKTLPL 140

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           PSYV+VTN++N  ++++RVNDRGP++S+R+IDLS AAAK L   E G ++V VE
Sbjct: 141 PSYVKVTNLDNNRAVILRVNDRGPFYSDRIIDLSYAAAKKLGYAETGTARVKVE 194


>gi|320322701|gb|EFW78794.1| RlpA family lipoprotein [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320330514|gb|EFW86493.1| RlpA family lipoprotein [Pseudomonas syringae pv. glycinea str.
           race 4]
          Length = 281

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 66/141 (46%), Positives = 92/141 (65%), Gaps = 3/141 (2%)

Query: 66  FLGKPYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P   +  Y A G ASWYG  FHG+ TANGEVY    ++AAH TLPL
Sbjct: 81  YKANPYTVLGKTYFPMSDSKRYVASGTASWYGTKFHGQNTANGEVYDLYGMSAAHKTLPL 140

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMAL 184
           PSYV+VTN++N  ++++RVNDRGP++S+R+IDLS AAAK L   E G ++V VE  G+  
Sbjct: 141 PSYVKVTNLDNNRTVILRVNDRGPFYSDRIIDLSYAAAKKLGYAETGTARVKVE--GIDP 198

Query: 185 LNGMDQEYLRSTVMVNSATVL 205
                Q    + +M+N   V+
Sbjct: 199 QEWWAQRGRPAPLMLNQPQVM 219


>gi|225077351|ref|ZP_03720550.1| hypothetical protein NEIFLAOT_02411 [Neisseria flavescens
           NRL30031/H210]
 gi|224951343|gb|EEG32552.1| hypothetical protein NEIFLAOT_02411 [Neisseria flavescens
           NRL30031/H210]
          Length = 239

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 56/113 (49%), Positives = 80/113 (70%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           + Y++ G+ Y P  + ++++  G ASWYG  FHGR T++GE Y    ++AAH TLP+PSY
Sbjct: 41  RSYKVAGKRYTPLTKVSSFSQTGKASWYGSQFHGRKTSSGERYNMNALSAAHKTLPIPSY 100

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            RVTNM+NG S++VRVNDRGP+H  R+ID+S AAA+ L    +G + V VE +
Sbjct: 101 ARVTNMQNGKSVIVRVNDRGPFHGKRVIDVSKAAAQQLGFINQGTANVKVEQI 153


>gi|28871937|ref|NP_794556.1| lipoprotein, rlpA family [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213968043|ref|ZP_03396189.1| lipoprotein, rlpA family [Pseudomonas syringae pv. tomato T1]
 gi|301383640|ref|ZP_07232058.1| lipoprotein, rlpA family [Pseudomonas syringae pv. tomato Max13]
 gi|302063163|ref|ZP_07254704.1| lipoprotein, rlpA family [Pseudomonas syringae pv. tomato K40]
 gi|302131281|ref|ZP_07257271.1| lipoprotein, rlpA family [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|28855190|gb|AAO58251.1| lipoprotein, rlpA family [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213927386|gb|EEB60935.1| lipoprotein, rlpA family [Pseudomonas syringae pv. tomato T1]
          Length = 342

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 61/114 (53%), Positives = 82/114 (71%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P   +  Y A G ASWYG  FHG+ TANGEVY    ++AAH TLPL
Sbjct: 81  YKANPYTVLGKTYFPMSDSRRYVASGTASWYGTKFHGQNTANGEVYDLYGMSAAHKTLPL 140

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           PSYV+VTN++N  ++++RVNDRGP++S+R+IDLS AAAK L   E G ++V VE
Sbjct: 141 PSYVKVTNLDNNRTVILRVNDRGPFYSDRIIDLSYAAAKKLGYAESGTARVKVE 194


>gi|27363758|ref|NP_759286.1| Rare lipoprotein A [Vibrio vulnificus CMCP6]
 gi|27359874|gb|AAO08813.1| Rare lipoprotein A precursor [Vibrio vulnificus CMCP6]
          Length = 264

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 71/152 (46%), Positives = 92/152 (60%), Gaps = 9/152 (5%)

Query: 40  PESMYGV---TASDRIVSGKRVPRGGGRY---FLG--KPYQIMGRWY-VPRQYTAYAAVG 90
           PE  Y +    A D+ +S + +     RY    LG  K Y + G+ Y + R    +   G
Sbjct: 24  PEGRYSLESDVAPDQPISVEHIEDAHPRYEPYSLGGNKDYTLRGQDYKIVRDVKGFKESG 83

Query: 91  MASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYH 150
           +ASWYGK F G LT+NGE+Y    +TAAH TLPLPSYV+VTN +NG S +VRVNDRGP+H
Sbjct: 84  IASWYGKKFQGHLTSNGEIYDMYSMTAAHKTLPLPSYVKVTNKDNGKSTIVRVNDRGPFH 143

Query: 151 SNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
             R+IDLS AAA  L V + G + V +E L  
Sbjct: 144 EGRIIDLSYAAAYKLDVLKTGTANVEIEVLNF 175


>gi|59711353|ref|YP_204129.1| minor lipoprotein [Vibrio fischeri ES114]
 gi|59479454|gb|AAW85241.1| minor lipoprotein [Vibrio fischeri ES114]
          Length = 269

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 91/142 (64%), Gaps = 6/142 (4%)

Query: 48  ASDRIVSGKRVPRGGGRY-----FLGKPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHG 101
           A D  +S + +     RY     +  K Y ++G+ Y + ++   +   G++SWYGK FHG
Sbjct: 39  APDMPISVEHIEDAHPRYEPKSLYGNKDYTLLGKDYPIVKEPKGFTQEGISSWYGKKFHG 98

Query: 102 RLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAA 161
             T+NGEVY    ++AAH TLPLPSYV+VTN +NG + +VRVNDRGP+H  R+IDLS AA
Sbjct: 99  HKTSNGEVYDMYSMSAAHKTLPLPSYVKVTNKDNGKTAIVRVNDRGPFHEGRIIDLSFAA 158

Query: 162 AKILRVEERGVSKVHVEYLGMA 183
           A  L V + G + V +EY+ +A
Sbjct: 159 AAKLDVLKTGTANVKIEYISVA 180


>gi|37679088|ref|NP_933697.1| putative rare lipoprotein A [Vibrio vulnificus YJ016]
 gi|320157160|ref|YP_004189539.1| rare lipoprotein A [Vibrio vulnificus MO6-24/O]
 gi|37197830|dbj|BAC93668.1| putative rare lipoprotein A [Vibrio vulnificus YJ016]
 gi|319932472|gb|ADV87336.1| rare lipoprotein A precursor [Vibrio vulnificus MO6-24/O]
          Length = 264

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 71/152 (46%), Positives = 92/152 (60%), Gaps = 9/152 (5%)

Query: 40  PESMYGV---TASDRIVSGKRVPRGGGRY---FLG--KPYQIMGRWY-VPRQYTAYAAVG 90
           PE  Y +    A D+ +S + +     RY    LG  K Y + G+ Y + R    +   G
Sbjct: 24  PEGRYSLESDVAPDQPISVEHIEDAHPRYEPYSLGGNKDYTLRGQDYKIVRDVKGFKESG 83

Query: 91  MASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYH 150
           +ASWYGK F G LT+NGE+Y    +TAAH TLPLPSYV+VTN +NG S +VRVNDRGP+H
Sbjct: 84  IASWYGKKFQGHLTSNGEIYDMYSMTAAHKTLPLPSYVKVTNKDNGKSTIVRVNDRGPFH 143

Query: 151 SNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
             R+IDLS AAA  L V + G + V +E L  
Sbjct: 144 EGRIIDLSYAAAYKLDVLKTGTANVEIEVLNF 175


>gi|167035846|ref|YP_001671077.1| rare lipoprotein A [Pseudomonas putida GB-1]
 gi|166862334|gb|ABZ00742.1| rare lipoprotein A [Pseudomonas putida GB-1]
          Length = 333

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 82/114 (71%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P Q +  Y A G ASWYG  FHG+ TANGE+Y    ++AAH TLPL
Sbjct: 77  YKANPYTVLGKTYYPMQDSRNYRAEGTASWYGTKFHGQNTANGELYDLYGMSAAHKTLPL 136

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           P+YVRVTN+ NG S+++RVNDRGP++S+R+IDLS AAAK L   E G + V VE
Sbjct: 137 PAYVRVTNLANGRSVILRVNDRGPFYSDRIIDLSYAAAKKLGYAEIGTAHVRVE 190


>gi|331014740|gb|EGH94796.1| rare lipoprotein A [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 342

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 61/114 (53%), Positives = 82/114 (71%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P   +  Y A G ASWYG  FHG+ TANGEVY    ++AAH TLPL
Sbjct: 81  YKANPYTVLGKTYFPMSDSRRYVASGTASWYGTKFHGQNTANGEVYDLYGMSAAHKTLPL 140

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           PSYV+VTN++N  ++++RVNDRGP++S+R+IDLS AAAK L   E G ++V VE
Sbjct: 141 PSYVKVTNLDNNRTVILRVNDRGPFYSDRIIDLSYAAAKKLGYAESGTARVKVE 194


>gi|192359125|ref|YP_001981300.1| Six5 [Cellvibrio japonicus Ueda107]
 gi|190685290|gb|ACE82968.1| Six5 [Cellvibrio japonicus Ueda107]
          Length = 293

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 85/124 (68%), Gaps = 3/124 (2%)

Query: 58  VPRGGGRYFLGK--PYQIMGR-WYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEY 114
           VPR   R   G   PY ++G+ +Y+    TAY   G ASWYGK F+G  T+NGE+Y    
Sbjct: 67  VPRHEQRTRAGNKNPYTVLGKTYYLMEDETAYRERGHASWYGKKFNGYHTSNGELYDMYA 126

Query: 115 ITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSK 174
           +TAAH TLP+PSYVRVTN++NG S+VVRVNDRGP+H  R+IDLS AAA+ + + + G   
Sbjct: 127 MTAAHKTLPIPSYVRVTNLQNGKSVVVRVNDRGPFHDGRIIDLSYAAAQRIGIHKTGTGY 186

Query: 175 VHVE 178
           V VE
Sbjct: 187 VEVE 190


>gi|302185160|ref|ZP_07261833.1| rare lipoprotein A [Pseudomonas syringae pv. syringae 642]
          Length = 342

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 61/114 (53%), Positives = 82/114 (71%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P   +  Y A G ASWYG  FHG+ TANGEVY    ++AAH TLPL
Sbjct: 81  YKANPYTVLGKTYFPMSDSRRYVASGTASWYGTKFHGQNTANGEVYDLYGMSAAHKTLPL 140

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           PSYV+VTN++N  ++++RVNDRGP++S+R+IDLS AAAK L   E G ++V VE
Sbjct: 141 PSYVKVTNLDNNRTVILRVNDRGPFYSDRIIDLSYAAAKKLGYAETGTARVKVE 194


>gi|304389094|ref|ZP_07371138.1| RlpA family protein [Neisseria meningitidis ATCC 13091]
 gi|304336967|gb|EFM03157.1| RlpA family protein [Neisseria meningitidis ATCC 13091]
          Length = 239

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 61/134 (45%), Positives = 85/134 (63%), Gaps = 6/134 (4%)

Query: 48  ASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTAN 106
           ++D +V  +++     R      Y++ G+ Y P+ Q   +   G ASWYG  FHGR T+ 
Sbjct: 24  SADAVVKAEKLHASANR-----SYKVAGKRYTPKNQVAEFTQTGNASWYGGRFHGRKTSG 78

Query: 107 GEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILR 166
           GE Y     TAAH TLP+PSYVRVTN +NG S++VRVNDRGP+H NR+ID+S AAA+ L 
Sbjct: 79  GERYDMNAFTAAHKTLPIPSYVRVTNTKNGKSVIVRVNDRGPFHGNRIIDVSKAAAQKLG 138

Query: 167 VEERGVSKVHVEYL 180
              +G + V +E +
Sbjct: 139 FVGQGTAHVKIEQI 152


>gi|254000239|ref|YP_003052302.1| rare lipoprotein A [Methylovorus sp. SIP3-4]
 gi|253986918|gb|ACT51775.1| rare lipoprotein A [Methylovorus sp. SIP3-4]
          Length = 323

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 62/113 (54%), Positives = 82/113 (72%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY  +G  Y P  +Y  Y   G+ASWYG+ +HG+ T++GE+Y    +T AH TLPLPSY
Sbjct: 83  RPYIALGVSYKPMTEYQPYKQRGIASWYGRRYHGQKTSSGEIYDMYGMTGAHTTLPLPSY 142

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VRVTN ENG S++VR+NDRGP+HS+RLIDLS AAA  LR+ ++G   V VE +
Sbjct: 143 VRVTNPENGRSVIVRINDRGPFHSDRLIDLSYAAAYKLRLSQKGSGLVEVEAI 195


>gi|313202206|ref|YP_004040864.1| rare lipoprotein a [Methylovorus sp. MP688]
 gi|312441522|gb|ADQ85628.1| rare lipoprotein A [Methylovorus sp. MP688]
          Length = 323

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 62/113 (54%), Positives = 82/113 (72%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY  +G  Y P  +Y  Y   G+ASWYG+ +HG+ T++GE+Y    +T AH TLPLPSY
Sbjct: 83  RPYIALGVSYKPMTEYQPYKQRGIASWYGRRYHGQKTSSGEIYDMYGMTGAHTTLPLPSY 142

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VRVTN ENG S++VR+NDRGP+HS+RLIDLS AAA  LR+ ++G   V VE +
Sbjct: 143 VRVTNPENGRSVIVRINDRGPFHSDRLIDLSYAAAYKLRLSQKGSGLVEVEAI 195


>gi|212636661|ref|YP_002313186.1| Rare lipoprotein A [Shewanella piezotolerans WP3]
 gi|212558145|gb|ACJ30599.1| Rare lipoprotein A [Shewanella piezotolerans WP3]
          Length = 262

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 84/127 (66%), Gaps = 9/127 (7%)

Query: 60  RGGGR---YFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYIT 116
           RGG R     LGK YQ+M           Y A G+ASWYG  FHG LT+NGE Y    ++
Sbjct: 56  RGGNRKNYTVLGKSYQVMDSG------EGYQAKGIASWYGSKFHGHLTSNGETYDMYSMS 109

Query: 117 AAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVH 176
           AAH +LPLPSYV+VTN++N  +++VRVNDRGP+H +RLIDLS AAA  L + + G + V 
Sbjct: 110 AAHKSLPLPSYVKVTNLKNDKTVIVRVNDRGPFHEDRLIDLSYAAAHRLDMLKTGTANVS 169

Query: 177 VEYLGMA 183
           +E + +A
Sbjct: 170 LEVIYIA 176


>gi|313500783|gb|ADR62149.1| Rare lipoprotein A family [Pseudomonas putida BIRD-1]
          Length = 333

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 82/114 (71%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P Q +  Y A G ASWYG  FHG+ TANGE+Y    ++AAH TLPL
Sbjct: 77  YKANPYTVLGKTYYPMQDSRNYRAEGTASWYGTKFHGQNTANGELYDLYGMSAAHKTLPL 136

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           P+YVRVTN+ NG S+++RVNDRGP++S+R+IDLS AAAK L   E G + V VE
Sbjct: 137 PAYVRVTNLANGRSVILRVNDRGPFYSDRIIDLSYAAAKKLGYAEIGTAHVRVE 190


>gi|330969437|gb|EGH69503.1| rare lipoprotein A [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 319

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 61/114 (53%), Positives = 81/114 (71%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P      Y A G ASWYG  FHG+ TANGEVY    ++AAH TLPL
Sbjct: 58  YKANPYTVLGKTYFPMSDAKRYVASGTASWYGTKFHGQNTANGEVYDLYGMSAAHKTLPL 117

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           PSYV+VTN++N  ++++RVNDRGP++S+R+IDLS AAAK L   E G ++V VE
Sbjct: 118 PSYVKVTNLDNNRTVILRVNDRGPFYSDRIIDLSYAAAKKLGYAETGTARVKVE 171


>gi|325267125|ref|ZP_08133793.1| RlpA family protein [Kingella denitrificans ATCC 33394]
 gi|324981363|gb|EGC17007.1| RlpA family protein [Kingella denitrificans ATCC 33394]
          Length = 245

 Score =  125 bits (315), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 76/111 (68%), Gaps = 1/111 (0%)

Query: 71  YQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G  Y PR+    +   G ASWYG  FHGR T+NGE Y    +TAAHPTLP+PSY R
Sbjct: 37  YKVAGVRYQPRKNVEGFTQTGRASWYGVPFHGRRTSNGERYDMNKLTAAHPTLPIPSYAR 96

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VTN+ NG ++VVR+NDRGP+H NR++DLS AAA+ L     G + V VE L
Sbjct: 97  VTNLANGRTVVVRINDRGPFHGNRVMDLSRAAAQQLGFVNAGTANVRVEAL 147


>gi|77359969|ref|YP_339544.1| rare lipoprotein A [Pseudoalteromonas haloplanktis TAC125]
 gi|76874880|emb|CAI86101.1| putative Rare lipoprotein A [Pseudoalteromonas haloplanktis TAC125]
          Length = 225

 Score =  125 bits (315), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 60/112 (53%), Positives = 78/112 (69%), Gaps = 1/112 (0%)

Query: 68  GKPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
            +PY ++G+ Y P    T YA  G+ASWYG+ FHG  T+NGE+Y    +TAAH TLPLPS
Sbjct: 31  SRPYTVLGKSYTPMLDETGYAEEGIASWYGRKFHGYHTSNGEIYDMFAMTAAHKTLPLPS 90

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           +V+VTN  N  S++VRVNDRGP+H +R+IDLS AAA  L     G +KV +E
Sbjct: 91  FVKVTNTSNNKSVIVRVNDRGPFHEDRVIDLSYAAAYKLGYYTHGTAKVKLE 142


>gi|26991484|ref|NP_746909.1| rare lipoprotein A family [Pseudomonas putida KT2440]
 gi|24986563|gb|AAN70373.1|AE016679_5 lipoprotein, rare lipoprotein A family [Pseudomonas putida KT2440]
          Length = 333

 Score =  125 bits (315), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 82/114 (71%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P Q +  Y A G ASWYG  FHG+ TANGE+Y    ++AAH TLPL
Sbjct: 77  YKANPYTVLGKTYYPMQDSRNYRAEGTASWYGTKFHGQNTANGELYDLYGMSAAHKTLPL 136

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           P+YVRVTN+ NG S+++RVNDRGP++S+R+IDLS AAAK L   E G + V VE
Sbjct: 137 PAYVRVTNLANGRSVILRVNDRGPFYSDRIIDLSYAAAKKLGYAEIGTAHVRVE 190


>gi|325276743|ref|ZP_08142458.1| rare lipoprotein A [Pseudomonas sp. TJI-51]
 gi|324098126|gb|EGB96257.1| rare lipoprotein A [Pseudomonas sp. TJI-51]
          Length = 333

 Score =  125 bits (314), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 82/114 (71%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P Q +  Y A G ASWYG  FHG+ TANGE+Y    ++AAH TLPL
Sbjct: 78  YKANPYTVLGKTYYPMQDSRNYRAEGTASWYGTKFHGQNTANGELYDLYGMSAAHKTLPL 137

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           P+YVRVTN+ NG S+++RVNDRGP++S+R+IDLS AAAK L   E G + V VE
Sbjct: 138 PAYVRVTNLANGRSVILRVNDRGPFYSDRIIDLSYAAAKKLGYAEIGTAHVRVE 191


>gi|163803894|ref|ZP_02197735.1| hypothetical protein 1103602000570_AND4_19851 [Vibrio sp. AND4]
 gi|159172308|gb|EDP57195.1| hypothetical protein AND4_19851 [Vibrio sp. AND4]
          Length = 267

 Score =  125 bits (314), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 99/180 (55%), Gaps = 23/180 (12%)

Query: 13  SVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGV---TASDRIVSGKRVPRGGGRYFLGK 69
           S+VC  V+ ++ C  +   K       PE  Y +    A D  +S + +     +Y   +
Sbjct: 8   SLVCSAVI-LAGCSSTDQKK-------PEGRYELESDVAPDNPLSVEHIEEANPKY---E 56

Query: 70  PYQIMGR---------WYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHP 120
           PY + G          + + R    +   G ASWYGK F G LT+NGE+Y    +TAAH 
Sbjct: 57  PYSLGGNSDYNLRGSDYKIVRDANGFTEKGRASWYGKKFQGHLTSNGEIYDMYSMTAAHK 116

Query: 121 TLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           TLPLPSYVRVTN +NG S VVRVNDRGP+H  R+IDLS AAA  L V + G + V +E +
Sbjct: 117 TLPLPSYVRVTNTDNGKSTVVRVNDRGPFHDGRIIDLSYAAAHKLDVVKTGTANVEIEVI 176


>gi|157964470|ref|YP_001499294.1| rare lipoprotein A precursor [Rickettsia massiliae MTU5]
 gi|157844246|gb|ABV84747.1| Rare lipoprotein A precursor [Rickettsia massiliae MTU5]
          Length = 326

 Score =  125 bits (314), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 80/121 (66%), Gaps = 3/121 (2%)

Query: 63  GRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYG---KAFHGRLTANGEVYGTEYITAAH 119
           G Y +GK Y+I G+ Y P    ++   G ASWYG     FHG+ TANG+ +    +TAAH
Sbjct: 148 GHYKVGKNYKIKGKTYKPHNPKSFTETGYASWYGGRKDGFHGKKTANGDRFNRNLLTAAH 207

Query: 120 PTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEY 179
            TLPLP  V+VTN  N  ++++ VNDRGP+  NR+ID+S  AA+IL  + +G++KV +EY
Sbjct: 208 KTLPLPCLVKVTNKANNKAVILMVNDRGPFKKNRIIDVSQKAAEILAFKNQGITKVQIEY 267

Query: 180 L 180
           L
Sbjct: 268 L 268


>gi|167625149|ref|YP_001675443.1| rare lipoprotein A [Shewanella halifaxensis HAW-EB4]
 gi|167355171|gb|ABZ77784.1| rare lipoprotein A [Shewanella halifaxensis HAW-EB4]
          Length = 260

 Score =  125 bits (314), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 108/195 (55%), Gaps = 23/195 (11%)

Query: 14  VVCVVVLGMSSCFFSSTYK--DDKLEYFPESMYGVT-ASDRIVSGKRVPRGGGR---YFL 67
            + V+   +++C     Y+  DDK    P S   VT   D     +   RGG +     L
Sbjct: 8   AILVLTATLAACSSGGRYELDDDKA---PTSAPDVTKVEDAHPKYEPYSRGGNKKNYTVL 64

Query: 68  GKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           GK YQ+M           YA  G+ASWYG  FHG LT+NGE Y    ++AAH TLPLPSY
Sbjct: 65  GKSYQVMDTG------EGYAEKGIASWYGAKFHGHLTSNGETYDMYSMSAAHKTLPLPSY 118

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL------- 180
           V+VTN++N  +++VRVNDRGP+H +R+IDLS AAA  L + + G + V +E +       
Sbjct: 119 VKVTNLKNDKTVIVRVNDRGPFHEDRIIDLSYAAAHRLDMLKTGTANVSLEVIYIADPES 178

Query: 181 -GMALLNGMDQEYLR 194
             +A L G +  Y++
Sbjct: 179 TALAELKGTELHYIQ 193


>gi|237746683|ref|ZP_04577163.1| rare lipoprotein A [Oxalobacter formigenes HOxBLS]
 gi|229378034|gb|EEO28125.1| rare lipoprotein A [Oxalobacter formigenes HOxBLS]
          Length = 334

 Score =  125 bits (314), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 63/113 (55%), Positives = 79/113 (69%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY + G+ YVP  Q + Y   G+ SWYGK FHG+ T++GE Y    +TAAHPTLP+PSY
Sbjct: 88  KPYVVFGQSYVPMTQMSEYRKRGIGSWYGKKFHGQKTSSGEPYDMFKMTAAHPTLPIPSY 147

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            RVT++E G  ++VRVNDRGP+ SNRLIDLS  AA  L   E+G  +V VE L
Sbjct: 148 ARVTSLETGKQVIVRVNDRGPFLSNRLIDLSYTAAYKLGYLEKGSGQVEVELL 200


>gi|332307129|ref|YP_004434980.1| rare lipoprotein A [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332174458|gb|AEE23712.1| rare lipoprotein A [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 318

 Score =  125 bits (314), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 78/111 (70%), Gaps = 1/111 (0%)

Query: 71  YQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y ++G+ Y P +    Y+A G ASWYG+ FHG LT+NGE Y    +TAAH TLPLPSYV+
Sbjct: 64  YSVLGKHYTPLKTGKGYSATGGASWYGQKFHGHLTSNGETYDMYAMTAAHKTLPLPSYVK 123

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VTN++N    +VRVNDRGP+H NR+IDLS AAA  L +   G ++V +E +
Sbjct: 124 VTNLKNAREAIVRVNDRGPFHDNRIIDLSYAAAMKLGMLSTGTTEVKLEVI 174


>gi|330895585|gb|EGH27893.1| rare lipoprotein A [Pseudomonas syringae pv. japonica str.
           M301072PT]
          Length = 219

 Score =  125 bits (313), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 61/114 (53%), Positives = 81/114 (71%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P      Y A G ASWYG  FHG+ TANGEVY    ++AAH TLPL
Sbjct: 81  YKANPYTVLGKTYFPMSDAKRYVASGTASWYGTKFHGQNTANGEVYDLYGMSAAHKTLPL 140

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           PSYV+VTN++N  ++++RVNDRGP++S+R+IDLS AAAK L   E G ++V VE
Sbjct: 141 PSYVKVTNLDNNRTVILRVNDRGPFYSDRIIDLSYAAAKKLGYAETGTARVKVE 194


>gi|30250005|ref|NP_842075.1| putative rare lipoprotein A [Nitrosomonas europaea ATCC 19718]
 gi|30139112|emb|CAD85976.1| putative rare lipoprotein A [Nitrosomonas europaea ATCC 19718]
          Length = 306

 Score =  125 bits (313), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 63/113 (55%), Positives = 79/113 (69%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY  +G+ Y P      Y A G ASWYGK +HG+ TA+GE+Y    +TAAHPTLP+PSY
Sbjct: 86  RPYVALGKTYTPMTALKPYKARGHASWYGKRYHGKRTASGEIYDMYSMTAAHPTLPIPSY 145

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VRVTN++NG S VVR+NDRGP+  NRLIDLS  AA  L V   G ++V VE +
Sbjct: 146 VRVTNLQNGNSAVVRINDRGPFLENRLIDLSYVAAYKLGVLANGSARVEVESI 198


>gi|89092034|ref|ZP_01164989.1| rare lipoprotein A [Oceanospirillum sp. MED92]
 gi|89083769|gb|EAR62986.1| rare lipoprotein A [Oceanospirillum sp. MED92]
          Length = 276

 Score =  125 bits (313), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 107/176 (60%), Gaps = 8/176 (4%)

Query: 9   LLKGSVVCV--VVLGMSSCFFSSTYKDDKLEYFPESMYGVT-ASDRIVSGKRVPRGGGRY 65
           L K  V+C+  V++G SS   ++     + +  P+    V+   D +   +   RGG + 
Sbjct: 2   LRKLVVLCISLVIVGCSSTSTNNGRYSMRHDKAPDQPVDVSHVKDAVPKVEPKSRGGNK- 60

Query: 66  FLGKPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
               PY ++G+ Y +      Y  VG ASWYGK FHG  T+NGEVY    ++AAH +LP+
Sbjct: 61  ---SPYTVLGKQYHIMNSAAGYREVGTASWYGKKFHGHKTSNGEVYDMYKMSAAHKSLPI 117

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           P+Y++VTN++N   ++VRVNDRGP+H NRLIDLS AAA  L + ++G ++V +E +
Sbjct: 118 PTYLKVTNLDNNRQVIVRVNDRGPFHGNRLIDLSYAAASKLDMLKKGTARVRLEAI 173


>gi|157828412|ref|YP_001494654.1| rare lipoprotein A precursor [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|157800893|gb|ABV76146.1| rare lipoprotein A precursor [Rickettsia rickettsii str. 'Sheila
           Smith']
          Length = 320

 Score =  125 bits (313), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 80/121 (66%), Gaps = 3/121 (2%)

Query: 63  GRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYG---KAFHGRLTANGEVYGTEYITAAH 119
           G Y +GK Y+I G+ Y P    ++   G ASWYG     FHG+ TANG+ +    +TAAH
Sbjct: 142 GHYKVGKNYKIQGKTYKPHNPKSFTETGYASWYGGLKDGFHGKKTANGDRFNRNLLTAAH 201

Query: 120 PTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEY 179
            TLPLP  V+VTN  N  ++++ VNDRGP+  NR+ID+S  AA+IL  + +G++KV +EY
Sbjct: 202 KTLPLPCLVKVTNKANNKAVILMVNDRGPFKKNRIIDVSQKAAEILAFKNQGITKVKIEY 261

Query: 180 L 180
           L
Sbjct: 262 L 262


>gi|165933123|ref|YP_001649912.1| lipoprotein [Rickettsia rickettsii str. Iowa]
 gi|165908210|gb|ABY72506.1| lipoprotein [Rickettsia rickettsii str. Iowa]
          Length = 307

 Score =  125 bits (313), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 80/121 (66%), Gaps = 3/121 (2%)

Query: 63  GRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYG---KAFHGRLTANGEVYGTEYITAAH 119
           G Y +GK Y+I G+ Y P    ++   G ASWYG     FHG+ TANG+ +    +TAAH
Sbjct: 129 GHYKVGKNYKIQGKTYKPHNPKSFTETGYASWYGGLKDGFHGKKTANGDRFNRNLLTAAH 188

Query: 120 PTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEY 179
            TLPLP  V+VTN  N  ++++ VNDRGP+  NR+ID+S  AA+IL  + +G++KV +EY
Sbjct: 189 KTLPLPCLVKVTNKANNKAVILMVNDRGPFKKNRIIDVSQKAAEILAFKNQGITKVKIEY 248

Query: 180 L 180
           L
Sbjct: 249 L 249


>gi|262394993|ref|YP_003286847.1| rare lipoprotein A [Vibrio sp. Ex25]
 gi|262338587|gb|ACY52382.1| rare lipoprotein A precursor [Vibrio sp. Ex25]
          Length = 267

 Score =  125 bits (313), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 80/121 (66%), Gaps = 3/121 (2%)

Query: 65  YFLG--KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPT 121
           Y LG  K Y + G+ Y + R    +   G ASWYGK F G LT+NGE+Y    +TAAH T
Sbjct: 58  YSLGGNKDYHLRGKDYKIVRDAKGFKEKGRASWYGKKFQGHLTSNGEIYDMYSMTAAHKT 117

Query: 122 LPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           LPLPSYV+VTN +NG + VVRVNDRGP+H  R+IDLS AAA  L V + G + V +E + 
Sbjct: 118 LPLPSYVKVTNTDNGKTTVVRVNDRGPFHDGRIIDLSYAAAHKLDVIKTGTANVEIEVIS 177

Query: 182 M 182
           +
Sbjct: 178 I 178


>gi|226942989|ref|YP_002798062.1| Rare lipoprotein, RlpA family [Azotobacter vinelandii DJ]
 gi|226717916|gb|ACO77087.1| Rare lipoprotein, RlpA family [Azotobacter vinelandii DJ]
          Length = 325

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 79/112 (70%), Gaps = 1/112 (0%)

Query: 68  GKPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
             PY ++G+ Y P      Y A G ASWYG  FHG+ TANGE+Y    ++AAH TLPLPS
Sbjct: 73  ANPYTVLGKTYYPMNDGRRYKATGTASWYGTKFHGQATANGELYDLYGMSAAHKTLPLPS 132

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           YVRVTN++N  S+++RVNDRGP++S R+IDLS AAAK L   E G ++V VE
Sbjct: 133 YVRVTNLDNQKSVILRVNDRGPFYSERIIDLSFAAAKKLGYAETGTARVSVE 184


>gi|260774872|ref|ZP_05883773.1| rare lipoprotein A precursor [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609127|gb|EEX35285.1| rare lipoprotein A precursor [Vibrio coralliilyticus ATCC BAA-450]
          Length = 260

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 73/183 (39%), Positives = 99/183 (54%), Gaps = 24/183 (13%)

Query: 10  LKGSVVCVVVLGMSSCFFSSTYK-DDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLG 68
           L G++  V +L   S   S  Y  DD +           A D  +S   +     +Y   
Sbjct: 7   LLGTLCAVTILAGCSSAPSKRYTIDDDI-----------APDAPISVDHIEDANPQY--- 52

Query: 69  KPYQIMG---------RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAH 119
           +PY + G         R+ + R+   +   G ASWYGK FHG LT+NGEVY    +TAAH
Sbjct: 53  EPYSLGGNSDYTLRGQRYQIIREPKGFTQEGQASWYGKKFHGHLTSNGEVYDMYSMTAAH 112

Query: 120 PTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEY 179
            TLP+PSYV+VTN +NG + +VRVNDRGP+H  R+IDLS AAA  L V   G + V +E 
Sbjct: 113 KTLPIPSYVKVTNQDNGKTAIVRVNDRGPFHEGRIIDLSFAAATKLDVVRTGTANVSIEV 172

Query: 180 LGM 182
           + +
Sbjct: 173 ISV 175


>gi|256821558|ref|YP_003145521.1| rare lipoprotein A [Kangiella koreensis DSM 16069]
 gi|256795097|gb|ACV25753.1| rare lipoprotein A [Kangiella koreensis DSM 16069]
          Length = 300

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 62/117 (52%), Positives = 83/117 (70%), Gaps = 3/117 (2%)

Query: 67  LGKP--YQIMGR-WYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLP 123
           LG P  Y++ G  ++V      Y  VG+ASWYG+ FHGR T++GEVY     TAAH TLP
Sbjct: 76  LGNPPYYEVDGVVYHVKDSGDGYKDVGVASWYGQKFHGRRTSSGEVYDMYQFTAAHKTLP 135

Query: 124 LPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           LPSY RVTN++NG S++V++NDRGP+  NR+IDLS AA+K L  + +G ++V VE L
Sbjct: 136 LPSYARVTNLDNGQSVIVKINDRGPFKKNRIIDLSYAASKKLGYQAQGTARVEVEVL 192


>gi|238650924|ref|YP_002916780.1| rare lipoprotein A precursor [Rickettsia peacockii str. Rustic]
 gi|238625022|gb|ACR47728.1| rare lipoprotein A precursor [Rickettsia peacockii str. Rustic]
          Length = 320

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 80/121 (66%), Gaps = 3/121 (2%)

Query: 63  GRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYG---KAFHGRLTANGEVYGTEYITAAH 119
           G Y +GK Y+I G+ Y P    ++   G ASWYG     FHG+ TANG+ +    +TAAH
Sbjct: 142 GHYKVGKNYKIKGKTYKPHNPKSFTETGYASWYGGLKDGFHGKKTANGDRFNRNLLTAAH 201

Query: 120 PTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEY 179
            TLPLP  V+VTN  N  ++++ VNDRGP+  NR+ID+S  AA+IL  + +G++KV +EY
Sbjct: 202 KTLPLPCLVKVTNKANNKAVILMVNDRGPFKKNRIIDVSQKAAEILAFKNQGITKVKIEY 261

Query: 180 L 180
           L
Sbjct: 262 L 262


>gi|157962969|ref|YP_001503003.1| rare lipoprotein A [Shewanella pealeana ATCC 700345]
 gi|157847969|gb|ABV88468.1| rare lipoprotein A [Shewanella pealeana ATCC 700345]
          Length = 260

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 91/146 (62%), Gaps = 17/146 (11%)

Query: 60  RGGGR---YFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYIT 116
           RGG +     LGK YQ+M           YA  G+ASWYG  FHG LT+NGE Y    ++
Sbjct: 54  RGGNKKNYTVLGKSYQVMDTG------EGYADKGIASWYGAKFHGHLTSNGETYDMYSMS 107

Query: 117 AAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVH 176
           AAH TLPLPSYV+VTN++N  +++VRVNDRGP+H++R+IDLS AAA  L + + G + V 
Sbjct: 108 AAHKTLPLPSYVKVTNLKNNKTVIVRVNDRGPFHADRIIDLSYAAAHRLDMLKTGTANVS 167

Query: 177 VEYL--------GMALLNGMDQEYLR 194
           +E +         +A L G +  Y++
Sbjct: 168 LEVIYIADPESSALAELKGTELHYIQ 193


>gi|269965476|ref|ZP_06179595.1| putative rare lipoprotein A [Vibrio alginolyticus 40B]
 gi|269829955|gb|EEZ84185.1| putative rare lipoprotein A [Vibrio alginolyticus 40B]
          Length = 267

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 80/121 (66%), Gaps = 3/121 (2%)

Query: 65  YFLG--KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPT 121
           Y LG  K Y + G+ Y + R    +   G ASWYGK F G LT+NGE+Y    +TAAH T
Sbjct: 58  YSLGGNKDYHLRGKDYKIVRNAKGFKEKGRASWYGKKFQGHLTSNGEIYDMYSMTAAHKT 117

Query: 122 LPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           LPLPSYV+VTN +NG + VVRVNDRGP+H  R+IDLS AAA  L V + G + V +E + 
Sbjct: 118 LPLPSYVKVTNTDNGKTTVVRVNDRGPFHDGRIIDLSYAAAHKLDVIKTGTANVEIEVIS 177

Query: 182 M 182
           +
Sbjct: 178 I 178


>gi|197334896|ref|YP_002155508.1| lipoprotein [Vibrio fischeri MJ11]
 gi|197316386|gb|ACH65833.1| lipoprotein [Vibrio fischeri MJ11]
          Length = 269

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 63/141 (44%), Positives = 90/141 (63%), Gaps = 6/141 (4%)

Query: 48  ASDRIVSGKRVPRGGGRY-----FLGKPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHG 101
           A D  +S + +     RY     +  K Y ++G+ Y + ++   +   G++SWYGK FHG
Sbjct: 39  APDMPISVEHIEDAHPRYEPKSLYGNKDYTLLGKDYPIVKEPKGFTQEGISSWYGKKFHG 98

Query: 102 RLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAA 161
             T+NGEVY    ++AAH TLPLPSYV+VTN +NG + +VRVNDRGP+H  R+IDLS AA
Sbjct: 99  HKTSNGEVYDMYSMSAAHKTLPLPSYVKVTNKDNGKTAIVRVNDRGPFHEGRIIDLSFAA 158

Query: 162 AKILRVEERGVSKVHVEYLGM 182
           A  L V + G + V +EY+ +
Sbjct: 159 AAKLDVLKTGTANVKIEYISV 179


>gi|254427808|ref|ZP_05041515.1| Rare lipoprotein A-like double-psi beta-barrel [Alcanivorax sp.
           DG881]
 gi|196193977|gb|EDX88936.1| Rare lipoprotein A-like double-psi beta-barrel [Alcanivorax sp.
           DG881]
          Length = 310

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 65/126 (51%), Positives = 84/126 (66%), Gaps = 3/126 (2%)

Query: 56  KRVPRGGGRYFLGKPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEY 114
           K+ PR   RY   + Y + G+ Y V  Q   Y A G ASWYG+ FHG  T++GE +    
Sbjct: 65  KKEPRS--RYGNPESYSVWGKTYQVLPQADGYVAEGKASWYGQKFHGHRTSSGESFDMYQ 122

Query: 115 ITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSK 174
            TAAH +LPLP+Y RVTN++NG SLVVRVNDRGP+H +R+IDLS AAA  L +E+ G  +
Sbjct: 123 FTAAHRSLPLPTYARVTNLDNGKSLVVRVNDRGPFHEDRIIDLSWAAAVRLGIEQAGTGR 182

Query: 175 VHVEYL 180
           V VE +
Sbjct: 183 VRVEAI 188


>gi|149192611|ref|ZP_01870764.1| putative rare lipoprotein A [Vibrio shilonii AK1]
 gi|148833553|gb|EDL50637.1| putative rare lipoprotein A [Vibrio shilonii AK1]
          Length = 266

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 79/116 (68%), Gaps = 3/116 (2%)

Query: 65  YFLG--KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPT 121
           Y LG  K Y + G  Y V +  T +   G ASWYGK FHG LT+NGEVY    ++AAH T
Sbjct: 61  YSLGGNKNYTLRGNSYKVIKDPTGFKERGQASWYGKKFHGHLTSNGEVYDMYSMSAAHKT 120

Query: 122 LPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           LPLPSYV+VTN++NG   +VRVNDRGP+H  R+IDLS AAAK L V + G + V +
Sbjct: 121 LPLPSYVKVTNLDNGKETIVRVNDRGPFHEGRIIDLSYAAAKKLDVIKTGTANVEI 176


>gi|91228813|ref|ZP_01262720.1| putative rare lipoprotein A [Vibrio alginolyticus 12G01]
 gi|91187618|gb|EAS73943.1| putative rare lipoprotein A [Vibrio alginolyticus 12G01]
          Length = 267

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 80/121 (66%), Gaps = 3/121 (2%)

Query: 65  YFLG--KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPT 121
           Y LG  K Y + G+ Y + R    +   G ASWYGK F G LT+NGE+Y    +TAAH T
Sbjct: 58  YSLGGNKDYHLRGKDYKIVRNAKGFKEKGRASWYGKKFQGHLTSNGEIYDMYSMTAAHKT 117

Query: 122 LPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           LPLPSYV+VTN +NG + +VRVNDRGP+H  R+IDLS AAA  L V + G + V +E + 
Sbjct: 118 LPLPSYVKVTNTDNGKTTIVRVNDRGPFHDGRIIDLSYAAAHKLDVIKTGTANVEIEVIS 177

Query: 182 M 182
           +
Sbjct: 178 I 178


>gi|149925904|ref|ZP_01914167.1| rare lipoprotein A [Limnobacter sp. MED105]
 gi|149825192|gb|EDM84403.1| rare lipoprotein A [Limnobacter sp. MED105]
          Length = 332

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/114 (53%), Positives = 80/114 (70%), Gaps = 2/114 (1%)

Query: 69  KPYQIMGRWYVPRQY--TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
           +PY +MG+ + P+      Y+  G ASWYGK FHG  TANGE+Y    +TAAHPTLPLPS
Sbjct: 99  RPYTVMGQSFTPQTSLEEPYSQKGRASWYGKKFHGAKTANGEIYDMHQMTAAHPTLPLPS 158

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           Y +VTN+ NG S++VRVNDRGP+   R+IDLS AAA  L   ++G ++V VE +
Sbjct: 159 YAKVTNLANGKSVIVRVNDRGPFLRGRIIDLSYAAAYQLDYIKQGSAEVLVEKM 212


>gi|254784816|ref|YP_003072244.1| lipoprotein A [Teredinibacter turnerae T7901]
 gi|237686936|gb|ACR14200.1| rare lipoprotein A [Teredinibacter turnerae T7901]
          Length = 289

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 79/112 (70%), Gaps = 1/112 (0%)

Query: 70  PYQIMGR-WYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY + G+ ++V    T Y   GMASWYG  FHG  T+NGE+Y    +TAAH TLP+PSYV
Sbjct: 63  PYTVNGKTYWVATNPTGYREEGMASWYGLKFHGHKTSNGEIYDMYGMTAAHKTLPIPSYV 122

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RVTN +NG  ++VRVNDRGP+H  R+IDL+ AAAK L + + G  +V VEY+
Sbjct: 123 RVTNKDNGRVVIVRVNDRGPFHDGRVIDLTYAAAKKLDIVDSGTGRVVVEYI 174


>gi|157825664|ref|YP_001493384.1| rare lipoprotein A precursor [Rickettsia akari str. Hartford]
 gi|157799622|gb|ABV74876.1| Rare lipoprotein A precursor [Rickettsia akari str. Hartford]
          Length = 232

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 58/121 (47%), Positives = 80/121 (66%), Gaps = 3/121 (2%)

Query: 63  GRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYG---KAFHGRLTANGEVYGTEYITAAH 119
           G Y +G  Y+I G+ Y P    ++  +G ASWYG     FHG+ TANG+ +    +TAAH
Sbjct: 52  GHYKVGTNYKINGKTYKPHSPKSFTEIGYASWYGGRKDGFHGKKTANGDRFNRNLLTAAH 111

Query: 120 PTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEY 179
            TLPLP  V+VTN  N  S+++ VNDRGP+  NR+ID+S  AA+IL  + +G++KV VEY
Sbjct: 112 KTLPLPCLVKVTNKANNKSVILMVNDRGPFKKNRIIDVSQKAAEILAFKNQGITKVKVEY 171

Query: 180 L 180
           L
Sbjct: 172 L 172


>gi|15892460|ref|NP_360174.1| rare lipoprotein A precursor [Rickettsia conorii str. Malish 7]
 gi|20139549|sp|Q92I83|RLPA_RICCN RecName: Full=RlpA-like protein
 gi|15619615|gb|AAL03075.1| rare lipoprotein A precursor [Rickettsia conorii str. Malish 7]
          Length = 320

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 80/121 (66%), Gaps = 3/121 (2%)

Query: 63  GRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYG---KAFHGRLTANGEVYGTEYITAAH 119
           G Y +GK Y+I G+ Y P    ++   G ASWYG     FHG+ TANG+ +    +TAAH
Sbjct: 142 GHYKVGKNYKIKGKTYKPHNPKSFTETGYASWYGGLKDGFHGKKTANGDRFNRNLLTAAH 201

Query: 120 PTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEY 179
            TLPLP  V+VTN  N  ++++ VNDRGP+  NR+ID+S  AA+IL  + +G++KV +EY
Sbjct: 202 KTLPLPCLVKVTNKANNKAVILMVNDRGPFKKNRIIDVSQRAAEILAFKNQGITKVKIEY 261

Query: 180 L 180
           L
Sbjct: 262 L 262


>gi|327482407|gb|AEA85717.1| RlpA family lipoprotein [Pseudomonas stutzeri DSM 4166]
          Length = 330

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 60/114 (52%), Positives = 81/114 (71%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P      Y+A G ASWYG  FHG+ TANGE Y    ++AAH TLPL
Sbjct: 73  YKANPYTVLGKTYFPISDGHRYSATGTASWYGTKFHGQPTANGEKYDLYGMSAAHKTLPL 132

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           P+YV+VTN++NG ++ +RVNDRGP++S+R+IDLS AAAK L   E G ++V VE
Sbjct: 133 PTYVKVTNLDNGRTVTLRVNDRGPFYSDRIIDLSFAAAKKLGFAETGTARVKVE 186


>gi|146284090|ref|YP_001174243.1| RlpA family lipoprotein [Pseudomonas stutzeri A1501]
 gi|145572295|gb|ABP81401.1| lipoprotein, rlpA family [Pseudomonas stutzeri A1501]
          Length = 330

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 60/114 (52%), Positives = 81/114 (71%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P      Y+A G ASWYG  FHG+ TANGE Y    ++AAH TLPL
Sbjct: 73  YKANPYTVLGKTYFPISDGHRYSATGTASWYGTKFHGQPTANGEKYDLYGMSAAHKTLPL 132

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           P+YV+VTN++NG ++ +RVNDRGP++S+R+IDLS AAAK L   E G ++V VE
Sbjct: 133 PTYVKVTNLDNGRTVTLRVNDRGPFYSDRIIDLSFAAAKKLGFAETGTARVKVE 186


>gi|311693498|gb|ADP96371.1| rare lipoprotein A family protein [marine bacterium HP15]
          Length = 297

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 86/139 (61%), Gaps = 4/139 (2%)

Query: 40  PESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWY-VPRQYTAYAAVGMASWYGKA 98
           P   + V+  D  +     PR  G      PYQ+ G+ Y V      Y A G ASWYG+ 
Sbjct: 42  PSGNFDVSGLDDAIPVYEAPRRAGNK---SPYQVWGKQYHVLDSNDGYVARGTASWYGEK 98

Query: 99  FHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLS 158
           FHG  T+NGE +    ++AAH +L +P Y RVTN++NG S++VRVNDRGP+HS+R+IDLS
Sbjct: 99  FHGHKTSNGETFNMYTMSAAHKSLRIPGYARVTNLDNGRSVIVRVNDRGPFHSDRIIDLS 158

Query: 159 NAAAKILRVEERGVSKVHV 177
            AAAK L  + RG ++V V
Sbjct: 159 YAAAKKLGYQARGTARVEV 177


>gi|194367219|ref|YP_002029829.1| rare lipoprotein A [Stenotrophomonas maltophilia R551-3]
 gi|194350023|gb|ACF53146.1| rare lipoprotein A [Stenotrophomonas maltophilia R551-3]
          Length = 423

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/148 (48%), Positives = 89/148 (60%), Gaps = 14/148 (9%)

Query: 46  VTASDRIVSGKRVPRGGGRYFLGKPYQIMG--RWYVPRQYTAYAAVGMASWYGKAFHGRL 103
           VTA DR   G + P       LGK Y+++   R YV R        G AS+YG  FHGRL
Sbjct: 97  VTAEDRSAIGNKTPY----VVLGKSYKVLDDTRNYVER--------GTASYYGAKFHGRL 144

Query: 104 TANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAK 163
           T+N EVY     TAAH TLPLPS+ RVTN++NG S++VRVNDRGP+H  R++DLS AAA 
Sbjct: 145 TSNREVYDMYQFTAAHKTLPLPSFARVTNLDNGESVIVRVNDRGPFHDGRVVDLSYAAAV 204

Query: 164 ILRVEERGVSKVHVEYLGMALLNGMDQE 191
            L + +RG   V V  L     N M Q+
Sbjct: 205 RLGITQRGTGNVEVRALQPGESNLMAQK 232


>gi|109897878|ref|YP_661133.1| rare lipoprotein A [Pseudoalteromonas atlantica T6c]
 gi|109700159|gb|ABG40079.1| rare lipoprotein A [Pseudoalteromonas atlantica T6c]
          Length = 321

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 78/111 (70%), Gaps = 1/111 (0%)

Query: 71  YQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y ++G+ Y P +    Y+A G ASWYG+ FHG LT+NGE Y    ++AAH TLPLPSYV+
Sbjct: 64  YSVLGKQYTPLKTGKGYSATGGASWYGQKFHGHLTSNGETYDMYAMSAAHKTLPLPSYVK 123

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VTN++NG   +VRVNDRGP+H  R+IDLS AAA  L +   G ++V +E +
Sbjct: 124 VTNLKNGREAIVRVNDRGPFHDKRIIDLSYAAAMKLGMLSTGTTQVKLEVI 174


>gi|229586662|ref|YP_002845163.1| Rare lipoprotein A precursor [Rickettsia africae ESF-5]
 gi|228021712|gb|ACP53420.1| Rare lipoprotein A precursor [Rickettsia africae ESF-5]
          Length = 320

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 80/121 (66%), Gaps = 3/121 (2%)

Query: 63  GRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYG---KAFHGRLTANGEVYGTEYITAAH 119
           G Y +GK Y+I G+ Y P    ++   G ASWYG     FHG+ TANG+ +    +TAAH
Sbjct: 142 GHYKVGKNYKIKGKTYKPHNPKSFTETGYASWYGGLKDGFHGKKTANGDRFNRNLLTAAH 201

Query: 120 PTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEY 179
            TLPLP  V+VTN  N  ++++ VNDRGP+  NR+ID+S  AA+IL  + +G++KV +EY
Sbjct: 202 KTLPLPCLVKVTNKANNKAVILMVNDRGPFKKNRIIDVSQRAAEILAFKNQGITKVKIEY 261

Query: 180 L 180
           L
Sbjct: 262 L 262


>gi|34580545|ref|ZP_00142025.1| rare lipoprotein A precursor [Rickettsia sibirica 246]
 gi|28261930|gb|EAA25434.1| rare lipoprotein A precursor [Rickettsia sibirica 246]
          Length = 320

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 80/121 (66%), Gaps = 3/121 (2%)

Query: 63  GRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYG---KAFHGRLTANGEVYGTEYITAAH 119
           G Y +GK Y+I G+ Y P    ++   G ASWYG     FHG+ TANG+ +    +TAAH
Sbjct: 142 GHYKVGKNYKIKGKTYKPHNPKSFTETGYASWYGGLKDGFHGKKTANGDRFNRNLLTAAH 201

Query: 120 PTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEY 179
            TLPLP  V+VTN  N  ++++ VNDRGP+  NR+ID+S  AA+IL  + +G++KV +EY
Sbjct: 202 KTLPLPCLVKVTNKANNKAVILMVNDRGPFKKNRIIDVSQRAAEILAFKNQGITKVKIEY 261

Query: 180 L 180
           L
Sbjct: 262 L 262


>gi|15604255|ref|NP_220771.1| rare lipoprotein A precursor (rlpA) [Rickettsia prowazekii str.
           Madrid E]
 gi|20139867|sp|Q9ZDE1|RLPA_RICPR RecName: Full=RlpA-like protein
 gi|3860947|emb|CAA14847.1| RARE LIPOPROTEIN A PRECURSOR (rlpA) [Rickettsia prowazekii]
 gi|292572001|gb|ADE29916.1| Rare lipoprotein A precursor [Rickettsia prowazekii Rp22]
          Length = 320

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/121 (48%), Positives = 79/121 (65%), Gaps = 3/121 (2%)

Query: 63  GRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYG---KAFHGRLTANGEVYGTEYITAAH 119
           G Y +GK Y+I G+ Y P     +   G ASWYG     FHG+ TANG+ +    +TAAH
Sbjct: 142 GHYKVGKNYKIKGKIYKPHTPKYFTETGYASWYGGRKDGFHGKTTANGDRFNRNLLTAAH 201

Query: 120 PTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEY 179
            TLPLP  V+VTN  N  S+++ VNDRGP+  NR+ID+S  AA+IL  + +GV+KV +EY
Sbjct: 202 KTLPLPCLVKVTNKVNNKSVILMVNDRGPFKKNRIIDVSQKAAEILAFKNQGVTKVRIEY 261

Query: 180 L 180
           L
Sbjct: 262 L 262


>gi|170728040|ref|YP_001762066.1| rare lipoprotein A [Shewanella woodyi ATCC 51908]
 gi|169813387|gb|ACA87971.1| rare lipoprotein A [Shewanella woodyi ATCC 51908]
          Length = 264

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 76/178 (42%), Positives = 99/178 (55%), Gaps = 17/178 (9%)

Query: 9   LLKGSVVCVVVLGMSSCFFSSTYK----DDKLEYFPESMYGVT-ASDRIVSGKRVPRGGG 63
           L K   +  +VL +S+C  S+  +    +DK    P S   VT   D     +   RGG 
Sbjct: 5   LSKAITIASLVLLVSACSSSNNSRYQMVNDKA---PTSAPDVTKVEDAHPKYEAYSRGGN 61

Query: 64  R---YFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHP 120
           +     LGK YQ+M           Y   G ASWYG  FHG LT+NGE Y    ++AAH 
Sbjct: 62  KKNYTVLGKSYQVMDTG------KGYRNSGTASWYGSKFHGHLTSNGETYDMYSMSAAHK 115

Query: 121 TLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           TLPLPSYV+VTN  N   ++VRVNDRGP+H +R+IDLS AAA  L + + G +KV +E
Sbjct: 116 TLPLPSYVKVTNQANNKQVIVRVNDRGPFHEDRIIDLSYAAAHRLDMLKTGTAKVDIE 173


>gi|74316283|ref|YP_314023.1| rare lipoprotein A [Thiobacillus denitrificans ATCC 25259]
 gi|74055778|gb|AAZ96218.1| rare lipoprotein A [Thiobacillus denitrificans ATCC 25259]
          Length = 286

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 80/116 (68%), Gaps = 1/116 (0%)

Query: 66  FLGKPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           F  + Y  +G  Y P  Q  AY   G+ASWYG+ FHG+ TA+GE Y    +TAAHPTLP+
Sbjct: 78  FANRTYTALGATYTPMAQRRAYREEGVASWYGRRFHGKKTASGEPYDMYAMTAAHPTLPI 137

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           PSY RVT++ NG S+VVR+NDRGP+HS R+IDLS  AA  L   ++G ++V VE L
Sbjct: 138 PSYARVTSLANGKSVVVRINDRGPFHSKRVIDLSYTAAHKLGYVKQGSARVRVESL 193


>gi|152996857|ref|YP_001341692.1| rare lipoprotein A [Marinomonas sp. MWYL1]
 gi|150837781|gb|ABR71757.1| rare lipoprotein A [Marinomonas sp. MWYL1]
          Length = 311

 Score =  123 bits (309), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 84/122 (68%), Gaps = 5/122 (4%)

Query: 60  RGGGRYFLGKPYQIMGR-WYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAA 118
           RGG +     PY++ G+ ++V      Y A G ASWYGK FHG  T+NGE Y     +AA
Sbjct: 72  RGGNK----SPYEVWGKKYWVMDSAQGYVAEGTASWYGKKFHGHKTSNGETYDMYSFSAA 127

Query: 119 HPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           H +LPLP+Y++VTN++N  S++VRVNDRGP+H +RLIDLS AAA  L   ++G+++V +E
Sbjct: 128 HKSLPLPTYLKVTNLDNQRSVIVRVNDRGPFHGDRLIDLSYAAAARLDYHKKGLARVRIE 187

Query: 179 YL 180
            +
Sbjct: 188 AI 189


>gi|237809570|ref|YP_002894010.1| rare lipoprotein A [Tolumonas auensis DSM 9187]
 gi|237501831|gb|ACQ94424.1| rare lipoprotein A [Tolumonas auensis DSM 9187]
          Length = 256

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 81/114 (71%), Gaps = 6/114 (5%)

Query: 67  LGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
            G+PY++   W   +QY+     G ASWYG  FHG+ T+NGE+Y  E I+AAH  LPLPS
Sbjct: 63  FGQPYKV---WNGIQQYSTE---GTASWYGPGFHGKYTSNGELYNQEDISAAHKNLPLPS 116

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           Y+RVTN+ENG  L+VRVNDRGP+H +R++DLS+ AA  L +   G ++V+VE +
Sbjct: 117 YLRVTNLENGRRLIVRVNDRGPFHGDRILDLSHGAASRLGIIGSGTARVNVELI 170


>gi|163854747|ref|YP_001629045.1| putative lipoprotein [Bordetella petrii DSM 12804]
 gi|163258475|emb|CAP40774.1| putative lipoprotein [Bordetella petrii]
          Length = 322

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 61/114 (53%), Positives = 81/114 (71%), Gaps = 2/114 (1%)

Query: 69  KPYQIMGRWYVP--RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
           +PY + G+ YVP      AY   G+ASWYGK FHG+ T+ GE+Y    +TAAHPT+PLPS
Sbjct: 66  RPYTVFGKRYVPIADNDHAYKERGIASWYGKKFHGQRTSIGEIYDMYAMTAAHPTMPLPS 125

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           Y RVT+  NG +++VRVNDRGP+HSNR++DLS AAA+ L +   G  +V VE +
Sbjct: 126 YARVTSSINGRTVIVRVNDRGPFHSNRIMDLSYAAARKLGIIGPGSGEVTVERI 179


>gi|51473580|ref|YP_067337.1| rare lipoprotein A precursor [Rickettsia typhi str. Wilmington]
 gi|81390131|sp|Q68WY7|RLPA_RICTY RecName: Full=RlpA-like protein
 gi|51459892|gb|AAU03855.1| rare lipoprotein A precursor [Rickettsia typhi str. Wilmington]
          Length = 320

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 58/121 (47%), Positives = 79/121 (65%), Gaps = 3/121 (2%)

Query: 63  GRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYG---KAFHGRLTANGEVYGTEYITAAH 119
           G Y +GK Y+I G+ Y P     +   G ASWYG     FHG+ TANG+ +    +TAAH
Sbjct: 142 GHYKVGKNYKIKGKIYKPYTPKYFTETGYASWYGGRKDGFHGKKTANGDRFNRNLLTAAH 201

Query: 120 PTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEY 179
            TLPLP  V+VTN  N  S+++ VNDRGP+  NR+ID+S  AA+IL  + +G++KV +EY
Sbjct: 202 KTLPLPCLVKVTNKANNKSVILMVNDRGPFKKNRIIDVSQKAAEILAFKNQGITKVRIEY 261

Query: 180 L 180
           L
Sbjct: 262 L 262


>gi|56477152|ref|YP_158741.1| hypothetical protein ebA3043 [Aromatoleum aromaticum EbN1]
 gi|56313195|emb|CAI07840.1| similar to rare lipoprotein A [Aromatoleum aromaticum EbN1]
          Length = 303

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 59/116 (50%), Positives = 79/116 (68%), Gaps = 1/116 (0%)

Query: 66  FLGKPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           F  +PY + G+ YVP  + +A+   G ASWYG+ FHG+ T++GE Y    +TAAHPTLP+
Sbjct: 89  FANRPYSVFGQEYVPATELSAFRQRGRASWYGRRFHGKPTSSGEPYDMYAMTAAHPTLPI 148

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           PSY RVTN  NG ++VVR+NDRGP+H +R+IDLS A A  L     G + V VE +
Sbjct: 149 PSYARVTNPANGRTIVVRINDRGPFHKDRIIDLSYAGAHRLGYVNAGSAPVEVETI 204


>gi|224419269|ref|ZP_03657275.1| rare lipoprotein A RLPA [Helicobacter canadensis MIT 98-5491]
 gi|253826983|ref|ZP_04869868.1| rare lipoprotein A [Helicobacter canadensis MIT 98-5491]
 gi|313142771|ref|ZP_07804964.1| rare lipoprotein a rlpa [Helicobacter canadensis MIT 98-5491]
 gi|253510389|gb|EES89048.1| rare lipoprotein A [Helicobacter canadensis MIT 98-5491]
 gi|313131802|gb|EFR49419.1| rare lipoprotein a rlpa [Helicobacter canadensis MIT 98-5491]
          Length = 267

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 60/123 (48%), Positives = 82/123 (66%), Gaps = 3/123 (2%)

Query: 69  KPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQI G+WY P          G+ASWYG  FHG+ T+NGE Y     TAAH TLP+ + 
Sbjct: 48  RPYQINGKWYYPTMVALGETYDGIASWYGPKFHGKKTSNGETYSMYAHTAAHKTLPMNTI 107

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM--ALL 185
           VRVT+ ENG S +VR+NDRGP+ S R+IDLSN+AA+ + + ++G + V +E +G   A+ 
Sbjct: 108 VRVTSKENGKSTIVRINDRGPFISGRIIDLSNSAARDIDMLQKGTANVRIEVIGFNGAIS 167

Query: 186 NGM 188
           N M
Sbjct: 168 NSM 170


>gi|114331574|ref|YP_747796.1| rare lipoprotein A [Nitrosomonas eutropha C91]
 gi|114308588|gb|ABI59831.1| rare lipoprotein A [Nitrosomonas eutropha C91]
          Length = 317

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 79/113 (69%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY  +G+ Y P      Y   G ASWYGK +HG+ TA+G+VY    +TAAHPTLP+PSY
Sbjct: 93  RPYVALGKTYTPMTTLKPYKERGQASWYGKRYHGQRTASGDVYDMYSMTAAHPTLPIPSY 152

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VRVTN++NG S++VR+NDRGP+  +RLIDLS  AA  L V   G ++V VE +
Sbjct: 153 VRVTNLQNGSSVIVRINDRGPFLESRLIDLSYVAAHKLGVLANGSARVEVESI 205


>gi|110834819|ref|YP_693678.1| lipoprotein, rare lipoprotein A family lipoprotein [Alcanivorax
           borkumensis SK2]
 gi|110647930|emb|CAL17406.1| lipoprotein, rare lipoprotein A family [Alcanivorax borkumensis
           SK2]
          Length = 309

 Score =  122 bits (307), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 62/118 (52%), Positives = 80/118 (67%), Gaps = 1/118 (0%)

Query: 64  RYFLGKPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTL 122
           RY   + Y + G+ Y V  Q   Y A G ASWYG+ FHG  T++GE +     TAAH +L
Sbjct: 71  RYGNPQSYSVWGKTYQVLPQAEGYVAEGNASWYGQKFHGHRTSSGESFDMYQFTAAHRSL 130

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           PLP+Y RVTN++NG SLVVRVNDRGP+H +R+IDLS AAA  L +E+ G  +V VE +
Sbjct: 131 PLPTYARVTNLDNGKSLVVRVNDRGPFHEDRIIDLSWAAAVRLGIEQAGTGRVRVEAI 188


>gi|255744732|ref|ZP_05418683.1| rare lipoprotein A precursor [Vibrio cholera CIRS 101]
 gi|262161134|ref|ZP_06030245.1| rare lipoprotein A precursor [Vibrio cholerae INDRE 91/1]
 gi|262168637|ref|ZP_06036332.1| rare lipoprotein A precursor [Vibrio cholerae RC27]
 gi|262190530|ref|ZP_06048774.1| rare lipoprotein A precursor [Vibrio cholerae CT 5369-93]
 gi|255737763|gb|EET93157.1| rare lipoprotein A precursor [Vibrio cholera CIRS 101]
 gi|262022755|gb|EEY41461.1| rare lipoprotein A precursor [Vibrio cholerae RC27]
 gi|262028884|gb|EEY47537.1| rare lipoprotein A precursor [Vibrio cholerae INDRE 91/1]
 gi|262033603|gb|EEY52097.1| rare lipoprotein A precursor [Vibrio cholerae CT 5369-93]
 gi|327483674|gb|AEA78081.1| Rare lipoprotein A precursor [Vibrio cholerae LMA3894-4]
          Length = 238

 Score =  122 bits (307), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 77/113 (68%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           K Y + G+ Y + +    +   G ASWYGK FHG LT+NGE+Y    +TAAH TLP+PSY
Sbjct: 32  KDYNLRGKSYRIIKNPKGFTESGKASWYGKKFHGHLTSNGEIYDMYSMTAAHKTLPIPSY 91

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           V+VTN +NG S VVRVNDRGP+H  R+IDLS AAA  + V + G + V +E +
Sbjct: 92  VKVTNTDNGKSTVVRVNDRGPFHDGRIIDLSYAAAYKIGVVQAGTANVRIEVI 144


>gi|329893663|ref|ZP_08269797.1| Rare lipoprotein A precursor [gamma proteobacterium IMCC3088]
 gi|328923590|gb|EGG30902.1| Rare lipoprotein A precursor [gamma proteobacterium IMCC3088]
          Length = 263

 Score =  122 bits (307), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 80/115 (69%), Gaps = 3/115 (2%)

Query: 70  PYQIMGR--WYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           PY + G   W +P     +   G ASWYG  FHG LT+NGEV+     +AAH +LP+P++
Sbjct: 57  PYTVNGETYWVMP-SAVGFEETGTASWYGAKFHGELTSNGEVFDMYKASAAHKSLPIPTF 115

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           V+VTN++NG S+VVRVNDRGP+HS+R+IDLS  AA  L  ++ G ++VH+E L +
Sbjct: 116 VKVTNLDNGRSMVVRVNDRGPFHSDRIIDLSYGAAVKLGFDQVGTAQVHLEVLSI 170


>gi|156973524|ref|YP_001444431.1| hypothetical protein VIBHAR_01215 [Vibrio harveyi ATCC BAA-1116]
 gi|156525118|gb|ABU70204.1| hypothetical protein VIBHAR_01215 [Vibrio harveyi ATCC BAA-1116]
          Length = 267

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 63/119 (52%), Positives = 77/119 (64%), Gaps = 3/119 (2%)

Query: 65  YFLG--KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPT 121
           Y LG    Y + G  Y + R    +   G ASWYGK F G LT+NGE+Y    +TAAH T
Sbjct: 58  YSLGGNSDYNLRGSDYKIVRDAKGFTEKGRASWYGKKFQGHLTSNGEIYDMYSMTAAHKT 117

Query: 122 LPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           LPLPSYV+VTN +NG S VVRVNDRGP+H  R+IDLS AAA  L V + G + V +E +
Sbjct: 118 LPLPSYVKVTNTDNGKSTVVRVNDRGPFHDGRIIDLSYAAAHKLDVVKTGTANVEIEVI 176


>gi|329118735|ref|ZP_08247435.1| rare lipoprotein A [Neisseria bacilliformis ATCC BAA-1200]
 gi|327465170|gb|EGF11455.1| rare lipoprotein A [Neisseria bacilliformis ATCC BAA-1200]
          Length = 203

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 80/120 (66%)

Query: 82  QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVV 141
           Q T ++  G ASWYG  FHG+ TANGE +    +TAAH TLP+ S VRVTN+ NG S+VV
Sbjct: 76  QTTKFSQTGKASWYGPGFHGKKTANGERFDMNTLTAAHRTLPISSRVRVTNLANGKSVVV 135

Query: 142 RVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNS 201
           R+NDRGPYH NR++DLS AAA+ L     G ++V +E L  A    + ++  RS ++ ++
Sbjct: 136 RINDRGPYHGNRVMDLSKAAAQELGFIRTGTAQVKIEPLAPADGKTISEQNRRSGIVTDA 195


>gi|90022978|ref|YP_528805.1| sugar fermentation stimulation protein [Saccharophagus degradans
           2-40]
 gi|89952578|gb|ABD82593.1| rare lipoprotein A [Saccharophagus degradans 2-40]
          Length = 297

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 65/126 (51%), Positives = 82/126 (65%), Gaps = 3/126 (2%)

Query: 58  VPRGGGRYFLGK--PYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEY 114
           VPR   R   G   PY ++G+ Y V      Y   G+ASWYG  FHGR T+NGE+Y    
Sbjct: 51  VPRYEPRTRAGNYSPYTVLGKTYHVMDNPDGYRERGVASWYGNKFHGRRTSNGEIYDMYA 110

Query: 115 ITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSK 174
           +TAAH TLP+PSYVRVTN+ N  S++VRVNDRGP+H +R+IDLS  AA+ L     G + 
Sbjct: 111 VTAAHKTLPIPSYVRVTNLANNRSIIVRVNDRGPFHGDRIIDLSYTAARKLGYANAGTAH 170

Query: 175 VHVEYL 180
           V VEY+
Sbjct: 171 VTVEYI 176


>gi|121591026|ref|ZP_01678343.1| rare lipoprotein A, putative [Vibrio cholerae 2740-80]
 gi|121728051|ref|ZP_01681089.1| rare lipoprotein A, putative [Vibrio cholerae V52]
 gi|147673217|ref|YP_001216422.1| putative rare lipoprotein A [Vibrio cholerae O395]
 gi|153817184|ref|ZP_01969851.1| rare lipoprotein A, putative [Vibrio cholerae NCTC 8457]
 gi|153826107|ref|ZP_01978774.1| rare lipoprotein A, putative [Vibrio cholerae MZO-2]
 gi|153830930|ref|ZP_01983597.1| putative rare lipoprotein A [Vibrio cholerae 623-39]
 gi|227081122|ref|YP_002809673.1| putative rare lipoprotein A [Vibrio cholerae M66-2]
 gi|229505451|ref|ZP_04394961.1| rare lipoprotein A precursor [Vibrio cholerae BX 330286]
 gi|229512958|ref|ZP_04402424.1| rare lipoprotein A precursor [Vibrio cholerae TMA 21]
 gi|229523259|ref|ZP_04412666.1| rare lipoprotein A precursor [Vibrio cholerae TM 11079-80]
 gi|229525559|ref|ZP_04414964.1| rare lipoprotein A precursor [Vibrio cholerae bv. albensis VL426]
 gi|229529955|ref|ZP_04419345.1| Rare lipoprotein A precursor [Vibrio cholerae 12129(1)]
 gi|254225714|ref|ZP_04919320.1| rare lipoprotein A, putative [Vibrio cholerae V51]
 gi|254285619|ref|ZP_04960583.1| rare lipoprotein A, putative [Vibrio cholerae AM-19226]
 gi|297581328|ref|ZP_06943252.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|298498935|ref|ZP_07008742.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|121547136|gb|EAX57268.1| rare lipoprotein A, putative [Vibrio cholerae 2740-80]
 gi|121629680|gb|EAX62100.1| rare lipoprotein A, putative [Vibrio cholerae V52]
 gi|125621722|gb|EAZ50050.1| rare lipoprotein A, putative [Vibrio cholerae V51]
 gi|126512218|gb|EAZ74812.1| rare lipoprotein A, putative [Vibrio cholerae NCTC 8457]
 gi|146315100|gb|ABQ19639.1| putative rare lipoprotein A [Vibrio cholerae O395]
 gi|148873585|gb|EDL71720.1| putative rare lipoprotein A [Vibrio cholerae 623-39]
 gi|149740130|gb|EDM54289.1| rare lipoprotein A, putative [Vibrio cholerae MZO-2]
 gi|150424481|gb|EDN16418.1| rare lipoprotein A, putative [Vibrio cholerae AM-19226]
 gi|227009010|gb|ACP05222.1| putative rare lipoprotein A [Vibrio cholerae M66-2]
 gi|227012765|gb|ACP08975.1| putative rare lipoprotein A [Vibrio cholerae O395]
 gi|229333729|gb|EEN99215.1| Rare lipoprotein A precursor [Vibrio cholerae 12129(1)]
 gi|229339140|gb|EEO04157.1| rare lipoprotein A precursor [Vibrio cholerae bv. albensis VL426]
 gi|229339622|gb|EEO04637.1| rare lipoprotein A precursor [Vibrio cholerae TM 11079-80]
 gi|229349851|gb|EEO14805.1| rare lipoprotein A precursor [Vibrio cholerae TMA 21]
 gi|229357674|gb|EEO22591.1| rare lipoprotein A precursor [Vibrio cholerae BX 330286]
 gi|297534644|gb|EFH73481.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297543268|gb|EFH79318.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 263

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 77/113 (68%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           K Y + G+ Y + +    +   G ASWYGK FHG LT+NGE+Y    +TAAH TLP+PSY
Sbjct: 57  KDYNLRGKSYRIIKNPKGFTESGKASWYGKKFHGHLTSNGEIYDMYSMTAAHKTLPIPSY 116

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           V+VTN +NG S VVRVNDRGP+H  R+IDLS AAA  + V + G + V +E +
Sbjct: 117 VKVTNTDNGKSTVVRVNDRGPFHDGRIIDLSYAAAYKIGVVQAGTANVRIEVI 169


>gi|15640964|ref|NP_230595.1| rare lipoprotein A, putative [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|153213868|ref|ZP_01949074.1| rare lipoprotein A, putative [Vibrio cholerae 1587]
 gi|153823307|ref|ZP_01975974.1| rare lipoprotein A, putative [Vibrio cholerae B33]
 gi|229510879|ref|ZP_04400358.1| rare lipoprotein A precursor [Vibrio cholerae B33]
 gi|229518000|ref|ZP_04407444.1| rare lipoprotein A precursor [Vibrio cholerae RC9]
 gi|229608470|ref|YP_002879118.1| rare lipoprotein A precursor [Vibrio cholerae MJ-1236]
 gi|254848080|ref|ZP_05237430.1| rare lipoprotein A [Vibrio cholerae MO10]
 gi|20139784|sp|Q9KTF4|RLPA_VIBCH RecName: Full=RlpA-like lipoprotein; Flags: Precursor
 gi|9655407|gb|AAF94110.1| rare lipoprotein A, putative [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|124115702|gb|EAY34522.1| rare lipoprotein A, putative [Vibrio cholerae 1587]
 gi|126519171|gb|EAZ76394.1| rare lipoprotein A, putative [Vibrio cholerae B33]
 gi|229344715|gb|EEO09689.1| rare lipoprotein A precursor [Vibrio cholerae RC9]
 gi|229350844|gb|EEO15785.1| rare lipoprotein A precursor [Vibrio cholerae B33]
 gi|229371125|gb|ACQ61548.1| rare lipoprotein A precursor [Vibrio cholerae MJ-1236]
 gi|254843785|gb|EET22199.1| rare lipoprotein A [Vibrio cholerae MO10]
          Length = 263

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 77/113 (68%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           K Y + G+ Y + +    +   G ASWYGK FHG LT+NGE+Y    +TAAH TLP+PSY
Sbjct: 57  KDYNLRGKSYRIIKNPKGFTESGKASWYGKKFHGHLTSNGEIYDMYSMTAAHKTLPIPSY 116

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           V+VTN +NG S VVRVNDRGP+H  R+IDLS AAA  + V + G + V +E +
Sbjct: 117 VKVTNTDNGKSTVVRVNDRGPFHDGRIIDLSYAAAYKIGVVQAGTANVRIEVI 169


>gi|328472497|gb|EGF43360.1| putative rare lipoprotein A [Vibrio parahaemolyticus 10329]
          Length = 267

 Score =  122 bits (306), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 80/126 (63%), Gaps = 3/126 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + G  Y + R    +   G ASWYGK F G LT+NGE+Y    +TAAH TLPLPSYV+
Sbjct: 66  YHLRGNNYKIVRDAKGFTEKGRASWYGKKFQGHLTSNGEIYDMYSMTAAHKTLPLPSYVK 125

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN +NG + VVRVNDRGP+H  R+IDLS AAA  L V + G + V +E + +      D
Sbjct: 126 VTNTDNGKTTVVRVNDRGPFHDGRIIDLSYAAAHKLDVIKTGTANVEIEVISVE--KPTD 183

Query: 190 QEYLRS 195
           Q+ L S
Sbjct: 184 QKSLES 189


>gi|118594290|ref|ZP_01551637.1| hypothetical protein MB2181_01440 [Methylophilales bacterium
           HTCC2181]
 gi|118440068|gb|EAV46695.1| hypothetical protein MB2181_01440 [Methylophilales bacterium
           HTCC2181]
          Length = 266

 Score =  122 bits (306), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 60/112 (53%), Positives = 78/112 (69%), Gaps = 1/112 (0%)

Query: 70  PYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY++ G  YVP R+   Y  +G ASWYGK +HG  T+ GEVY    +TAAH TLP+P YV
Sbjct: 67  PYKVFGEKYVPMREIEPYKEIGYASWYGKKYHGNKTSVGEVYDMYGMTAAHKTLPIPCYV 126

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +VTN+ N  +++VRVNDRGP+  NRLIDLS AAA  L + E+G  +V VE +
Sbjct: 127 KVTNLVNNKTVIVRVNDRGPFIKNRLIDLSYAAAYRLDIIEKGSERVLVELI 178


>gi|28897494|ref|NP_797099.1| putative rare lipoprotein A [Vibrio parahaemolyticus RIMD 2210633]
 gi|260898943|ref|ZP_05907384.1| rare lipoprotein A [Vibrio parahaemolyticus Peru-466]
 gi|260899159|ref|ZP_05907554.1| rare lipoprotein A [Vibrio parahaemolyticus AQ4037]
 gi|28805706|dbj|BAC58983.1| putative rare lipoprotein A [Vibrio parahaemolyticus RIMD 2210633]
 gi|308089343|gb|EFO39038.1| rare lipoprotein A [Vibrio parahaemolyticus Peru-466]
 gi|308110605|gb|EFO48145.1| rare lipoprotein A [Vibrio parahaemolyticus AQ4037]
          Length = 267

 Score =  122 bits (306), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 80/126 (63%), Gaps = 3/126 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + G  Y + R    +   G ASWYGK F G LT+NGE+Y    +TAAH TLPLPSYV+
Sbjct: 66  YHLRGNDYKIVRDAKGFTEKGRASWYGKKFQGHLTSNGEIYDMYSMTAAHKTLPLPSYVK 125

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN +NG + VVRVNDRGP+H  R+IDLS AAA  L V + G + V +E + +      D
Sbjct: 126 VTNTDNGKTTVVRVNDRGPFHDGRIIDLSYAAAHKLDVIKTGTANVEIEVISVE--KPTD 183

Query: 190 QEYLRS 195
           Q+ L S
Sbjct: 184 QKSLES 189


>gi|260876428|ref|ZP_05888783.1| rare lipoprotein A [Vibrio parahaemolyticus AN-5034]
 gi|308091630|gb|EFO41325.1| rare lipoprotein A [Vibrio parahaemolyticus AN-5034]
          Length = 205

 Score =  122 bits (306), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 80/126 (63%), Gaps = 3/126 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + G  Y + R    +   G ASWYGK F G LT+NGE+Y    +TAAH TLPLPSYV+
Sbjct: 4   YHLRGNDYKIVRDAKGFTEKGRASWYGKKFQGHLTSNGEIYDMYSMTAAHKTLPLPSYVK 63

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN +NG + VVRVNDRGP+H  R+IDLS AAA  L V + G + V +E + +      D
Sbjct: 64  VTNTDNGKTTVVRVNDRGPFHDGRIIDLSYAAAHKLDVIKTGTANVEIEVISVE--KPTD 121

Query: 190 QEYLRS 195
           Q+ L S
Sbjct: 122 QKSLES 127


>gi|126665210|ref|ZP_01736193.1| Lipoprotein [Marinobacter sp. ELB17]
 gi|126630580|gb|EBA01195.1| Lipoprotein [Marinobacter sp. ELB17]
          Length = 324

 Score =  122 bits (306), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 78/109 (71%), Gaps = 1/109 (0%)

Query: 70  PYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY + G+ Y V      Y A GMASWYG+ FHG  T+NGEV+    +TAAH +L +PSY 
Sbjct: 69  PYTVWGKKYSVMDDNNGYVAEGMASWYGEKFHGHKTSNGEVFDMYQMTAAHKSLRIPSYA 128

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           RVTN+ NG S++VRVNDRGP+H +R+IDLS AAAK L  + +GV++V V
Sbjct: 129 RVTNLANGRSVIVRVNDRGPFHGDRMIDLSYAAAKRLGYQGQGVAQVEV 177


>gi|54310017|ref|YP_131037.1| rare lipoprotein A [Photobacterium profundum SS9]
 gi|46914456|emb|CAG21235.1| hypothetical rare lipoprotein A [Photobacterium profundum SS9]
          Length = 301

 Score =  122 bits (306), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 83/134 (61%), Gaps = 2/134 (1%)

Query: 59  PRGGGRYFLG-KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYIT 116
           PR   +   G K Y + G+ Y +      +   G ASWYG+ FHG  T+NGE+Y    +T
Sbjct: 80  PRYESKSLAGNKDYTLRGKRYKIENIENGFTEQGNASWYGEKFHGHKTSNGEIYDMYSMT 139

Query: 117 AAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVH 176
           AAH TLPLPSYV+VTN  NG S +VRVNDRGP+H  R+IDLS AAA  L V + G + V 
Sbjct: 140 AAHKTLPLPSYVKVTNTNNGQSTIVRVNDRGPFHDGRIIDLSMAAASKLGVIKTGTAPVK 199

Query: 177 VEYLGMALLNGMDQ 190
           +E + +A  +  D+
Sbjct: 200 IELIKVAKPDSADE 213


>gi|269961548|ref|ZP_06175910.1| RlpA-like lipoprotein precursor [Vibrio harveyi 1DA3]
 gi|269833589|gb|EEZ87686.1| RlpA-like lipoprotein precursor [Vibrio harveyi 1DA3]
          Length = 267

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 63/119 (52%), Positives = 77/119 (64%), Gaps = 3/119 (2%)

Query: 65  YFLG--KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPT 121
           Y LG    Y + G  Y + R    +   G ASWYGK F G LT+NGE+Y    +TAAH T
Sbjct: 58  YSLGGNSDYNLRGSDYKIVRDAKGFTEKGRASWYGKKFQGHLTSNGEIYDMYSMTAAHKT 117

Query: 122 LPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           LPLPSYV+VTN +NG S VVRVNDRGP+H  R+IDLS AAA  L V + G + V +E +
Sbjct: 118 LPLPSYVKVTNTDNGKSTVVRVNDRGPFHEGRIIDLSYAAAHKLDVVKTGTANVEIEVI 176


>gi|258621966|ref|ZP_05716995.1| RlpA-like lipoprotein precursor [Vibrio mimicus VM573]
 gi|258625416|ref|ZP_05720310.1| RlpA-like lipoprotein precursor [Vibrio mimicus VM603]
 gi|262165191|ref|ZP_06032928.1| rare lipoprotein A precursor [Vibrio mimicus VM223]
 gi|262172041|ref|ZP_06039719.1| rare lipoprotein A precursor [Vibrio mimicus MB-451]
 gi|258582327|gb|EEW07182.1| RlpA-like lipoprotein precursor [Vibrio mimicus VM603]
 gi|258585719|gb|EEW10439.1| RlpA-like lipoprotein precursor [Vibrio mimicus VM573]
 gi|261893117|gb|EEY39103.1| rare lipoprotein A precursor [Vibrio mimicus MB-451]
 gi|262024907|gb|EEY43575.1| rare lipoprotein A precursor [Vibrio mimicus VM223]
          Length = 263

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 77/113 (68%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           K Y + G+ Y + +    +   G ASWYGK FHG LT+NGE+Y    +TAAH TLP+PSY
Sbjct: 59  KDYNLRGQSYRIIKNPKGFTEAGKASWYGKKFHGHLTSNGEIYDMYSMTAAHKTLPIPSY 118

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           V+VTN +NG S +VRVNDRGP+H  R+IDLS AAA  + V + G + V +E +
Sbjct: 119 VKVTNTDNGKSTIVRVNDRGPFHDGRIIDLSYAAAYKIGVVQAGTANVRIEVI 171


>gi|261212006|ref|ZP_05926292.1| rare lipoprotein A precursor [Vibrio sp. RC341]
 gi|260838614|gb|EEX65265.1| rare lipoprotein A precursor [Vibrio sp. RC341]
          Length = 238

 Score =  122 bits (305), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 78/113 (69%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           K Y + G+ Y + +    ++  G ASWYGK FHG LT+NGE+Y    +TAAH TLPLPSY
Sbjct: 32  KDYNLRGQSYRIIKNPQGFSESGKASWYGKKFHGHLTSNGEIYDMYSMTAAHKTLPLPSY 91

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           V+VTN +NG S +VRVNDRGP+H  R+IDLS AAA  + V + G + V V+ +
Sbjct: 92  VKVTNTDNGKSTIVRVNDRGPFHDGRVIDLSYAAAYKIGVVQAGTANVRVDVI 144


>gi|254509297|ref|ZP_05121389.1| rare lipoprotein A [Vibrio parahaemolyticus 16]
 gi|219547785|gb|EED24818.1| rare lipoprotein A [Vibrio parahaemolyticus 16]
          Length = 259

 Score =  122 bits (305), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 61/116 (52%), Positives = 77/116 (66%), Gaps = 3/116 (2%)

Query: 65  YFLG--KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPT 121
           Y LG  K Y + G  Y + +  T +   G++SWYGK FHG LT+NGE+Y    +TAAH T
Sbjct: 54  YSLGGNKDYTLRGNHYTIIKDSTGFTEQGISSWYGKKFHGHLTSNGEIYDMYSMTAAHKT 113

Query: 122 LPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           LPLPSYV VTN +NG   +VRVNDRGP+H  R+IDLS AAA  L V + G + V +
Sbjct: 114 LPLPSYVEVTNQDNGKKAIVRVNDRGPFHPGRIIDLSYAAATKLDVIKTGTANVSI 169


>gi|91205137|ref|YP_537492.1| rare lipoprotein A precursor [Rickettsia bellii RML369-C]
 gi|122425929|sp|Q1RJR1|RLPA_RICBR RecName: Full=RlpA-like lipoprotein; Flags: Precursor
 gi|91068681|gb|ABE04403.1| Rare lipoprotein A precursor [Rickettsia bellii RML369-C]
          Length = 227

 Score =  122 bits (305), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 81/121 (66%), Gaps = 3/121 (2%)

Query: 63  GRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYG---KAFHGRLTANGEVYGTEYITAAH 119
           G Y +G  Y+I G+ Y P    ++   G ASWYG     FHG+ TANG+++    +TAAH
Sbjct: 51  GYYKVGSQYKIKGKTYKPNAPKSFTETGYASWYGGGGDKFHGKKTANGDMFNKNLLTAAH 110

Query: 120 PTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEY 179
            TLPLP  V+VTN  N  S+++ VNDRGP+  NR+ID+S  AA++L  +++G++KV +EY
Sbjct: 111 KTLPLPCLVKVTNKTNNKSVILMVNDRGPFKPNRIIDVSAKAAEVLAFKKQGLAKVKIEY 170

Query: 180 L 180
           L
Sbjct: 171 L 171


>gi|148549881|ref|YP_001269983.1| rare lipoprotein A [Pseudomonas putida F1]
 gi|148513939|gb|ABQ80799.1| rare lipoprotein A [Pseudomonas putida F1]
          Length = 333

 Score =  122 bits (305), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 61/114 (53%), Positives = 81/114 (71%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +   PY ++G+ Y P Q +  Y A G ASWYG  FHG+ TANGE+Y    ++AAH TLPL
Sbjct: 77  YKANPYTVLGKTYYPMQDSRNYRAEGTASWYGTKFHGQNTANGELYDLYGMSAAHKTLPL 136

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           P+YV+VTN+ N  S+++RVNDRGP++S+R+IDLS AAAK L   E G + V VE
Sbjct: 137 PAYVKVTNLANNRSVILRVNDRGPFYSDRIIDLSYAAAKKLGYAEIGTAHVRVE 190


>gi|88800721|ref|ZP_01116280.1| Lipoprotein [Reinekea sp. MED297]
 gi|88776585|gb|EAR07801.1| Lipoprotein [Reinekea sp. MED297]
          Length = 251

 Score =  122 bits (305), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 60/118 (50%), Positives = 79/118 (66%), Gaps = 1/118 (0%)

Query: 70  PYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY + G+ Y +      Y   G+ASWYG  FHG  T+NGE +    I+AAH TLPLPS+V
Sbjct: 61  PYTVNGQTYRIMASADGYREEGIASWYGAKFHGHSTSNGETFDMNLISAAHKTLPLPSWV 120

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLN 186
           RVTN++NG S+ VRVNDRGP+H  R+IDLS AAA  L   ++G ++V VE L   +L+
Sbjct: 121 RVTNLDNGRSINVRVNDRGPFHDGRIIDLSYAAAVKLGYHDKGTARVRVEALTDQVLD 178


>gi|157827530|ref|YP_001496594.1| rare lipoprotein A precursor [Rickettsia bellii OSU 85-389]
 gi|157802834|gb|ABV79557.1| Rare lipoprotein A precursor [Rickettsia bellii OSU 85-389]
          Length = 226

 Score =  122 bits (305), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 81/121 (66%), Gaps = 3/121 (2%)

Query: 63  GRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYG---KAFHGRLTANGEVYGTEYITAAH 119
           G Y +G  Y+I G+ Y P    ++   G ASWYG     FHG+ TANG+++    +TAAH
Sbjct: 50  GYYKVGSQYKIKGKTYKPNAPKSFTETGYASWYGGGGDKFHGKKTANGDMFNKNLLTAAH 109

Query: 120 PTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEY 179
            TLPLP  V+VTN  N  S+++ VNDRGP+  NR+ID+S  AA++L  +++G++KV +EY
Sbjct: 110 KTLPLPCLVKVTNKTNNKSVILMVNDRGPFKPNRIIDVSAKAAEVLAFKKQGLAKVKIEY 169

Query: 180 L 180
           L
Sbjct: 170 L 170


>gi|34558355|ref|NP_908170.1| rare lipoprotein A RLPA [Wolinella succinogenes DSM 1740]
 gi|34484074|emb|CAE11070.1| RARE LIPOPROTEIN A RLPA [Wolinella succinogenes]
          Length = 278

 Score =  121 bits (304), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 79/122 (64%), Gaps = 1/122 (0%)

Query: 69  KPYQIMGRWYVPRQY-TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQI G+WY P        ++G+ASWYG  FHG+ T+NGE Y     TAAH T P+ + 
Sbjct: 56  RPYQIDGKWYYPSHVDVGEKSMGIASWYGPNFHGKKTSNGETYSMYARTAAHKTFPMNTI 115

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
           V+VTN ENG S +VR+NDRGP+   R+IDLSN AAK + +  +G + V VE LG + +  
Sbjct: 116 VKVTNRENGKSTIVRINDRGPFVEGRIIDLSNTAAKEIDMVTKGTAPVVVEVLGFSGIIS 175

Query: 188 MD 189
            D
Sbjct: 176 SD 177


>gi|298370451|ref|ZP_06981767.1| RlpA family protein [Neisseria sp. oral taxon 014 str. F0314]
 gi|298281911|gb|EFI23400.1| RlpA family protein [Neisseria sp. oral taxon 014 str. F0314]
          Length = 245

 Score =  121 bits (304), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 54/111 (48%), Positives = 79/111 (71%), Gaps = 1/111 (0%)

Query: 71  YQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G+ Y P  + ++++  G ASWYG  FHGR TA+GE Y    +TAAH TLP+PSY R
Sbjct: 49  YKVAGKRYTPLTKVSSFSQTGKASWYGNQFHGRKTASGERYDMNALTAAHRTLPIPSYAR 108

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VTN +NG S++VRVNDRGP+H +R++D+S AAA+ L    +G + + +E +
Sbjct: 109 VTNTKNGKSVIVRVNDRGPFHGSRVMDVSKAAAQKLGFISQGTTHIKIEQV 159


>gi|294669720|ref|ZP_06734786.1| hypothetical protein NEIELOOT_01620 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291308286|gb|EFE49529.1| hypothetical protein NEIELOOT_01620 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 193

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 82/122 (67%), Gaps = 4/122 (3%)

Query: 71  YQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G+ Y P ++   ++  G ASWYG  FHG+ T++GE +    ++AAH TLP+PSY R
Sbjct: 55  YKVAGKRYQPTKKIEQFSQTGKASWYGPGFHGKKTSSGERFDMNTLSAAHRTLPIPSYAR 114

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN+ NG S+VVR+NDRGP+H NR++D+S AAAK L     G + V VE +   L NG  
Sbjct: 115 VTNLSNGKSVVVRINDRGPFHGNRVMDVSKAAAKELGFIHTGTANVKVEQI---LPNGKG 171

Query: 190 QE 191
           Q+
Sbjct: 172 QK 173


>gi|242309670|ref|ZP_04808825.1| rare lipoprotein a rlpa [Helicobacter pullorum MIT 98-5489]
 gi|239523671|gb|EEQ63537.1| rare lipoprotein a rlpa [Helicobacter pullorum MIT 98-5489]
          Length = 270

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 78/115 (67%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQI G+WY P        + G+ASWYG  FHG+ T+NGE Y     TAAH TLP+ + 
Sbjct: 51  RPYQINGKWYYPTMVALGETSDGIASWYGPNFHGKKTSNGETYSMYAHTAAHKTLPMNTI 110

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           VRVT+ ENG S +VR+NDRGP+ S R+IDLSN+AA+ + +  +G + V +E +G 
Sbjct: 111 VRVTSKENGKSTIVRINDRGPFVSGRIIDLSNSAARDIDMIAKGTANVRIEVIGF 165


>gi|152980505|ref|YP_001351891.1| rare lipoprotein A [Janthinobacterium sp. Marseille]
 gi|151280582|gb|ABR88992.1| rare lipoprotein A [Janthinobacterium sp. Marseille]
          Length = 340

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 89/139 (64%), Gaps = 1/139 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY + G+ YVP      +   G  SWYGK FHG+ T++GE Y    +TAAHPTLP+PSY
Sbjct: 93  KPYVVFGKQYVPISDERPFKQRGRGSWYGKKFHGQKTSSGEPYDMYQMTAAHPTLPIPSY 152

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
            RVTN+ NG  ++VRVNDRGP+HS+R+IDLS  AA  L     G +++ VE L  A +  
Sbjct: 153 ARVTNLSNGRQVIVRVNDRGPFHSSRVIDLSYTAALKLGYIGHGSAELEVERLLPADIER 212

Query: 188 MDQEYLRSTVMVNSATVLP 206
           ++     +T++ +++ V P
Sbjct: 213 INANKGAATMVSDASPVQP 231


>gi|160872731|ref|ZP_02062863.1| rare lipoprotein A family protein [Rickettsiella grylli]
 gi|159121530|gb|EDP46868.1| rare lipoprotein A family protein [Rickettsiella grylli]
          Length = 291

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 109/193 (56%), Gaps = 4/193 (2%)

Query: 9   LLKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTA-SDRIVSGKRVPRGGGRYFL 67
             K S+  + +L + +C  ++T ++ +     +   G    + RI + K  P    +   
Sbjct: 13  FFKTSLFILFILNLVACSSNATNQNYRYHLHEDKAPGFKINAKRIPNAKPKPETRSKRGN 72

Query: 68  GKPYQIMG-RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
            K Y + G R+YV +    Y A G+ASWYG  FH  +T+NG+VY    +TAAH TLPLP+
Sbjct: 73  PKSYVVFGQRYYVMKSAKGYRARGIASWYGMKFHNFITSNGDVYNVAGMTAAHRTLPLPT 132

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL--GMAL 184
           Y++VTN+ NG  ++V+VNDRGP+  NRLIDLS  AAK L +   G + V +  +  G++ 
Sbjct: 133 YLQVTNLRNGKKIIVKVNDRGPFVKNRLIDLSYVAAKKLDMIATGTAPVSIVAITPGISR 192

Query: 185 LNGMDQEYLRSTV 197
           L   +Q + R  +
Sbjct: 193 LARNNQPFRRQKI 205


>gi|307544790|ref|YP_003897269.1| lipoprotein A [Halomonas elongata DSM 2581]
 gi|307216814|emb|CBV42084.1| K03642 rare lipoprotein A [Halomonas elongata DSM 2581]
          Length = 302

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 78/111 (70%), Gaps = 1/111 (0%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G+ Y V    + Y   G ASWYGK FHG  T+NGE+Y    ++AAH TLPLP+Y R
Sbjct: 79  YEVWGKTYHVLSDASDYERRGTASWYGKKFHGYATSNGEIYDMYKMSAAHRTLPLPTYAR 138

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VTN++NG S++VRVNDRGP+HS R IDLS AAA  L + +RG  +V VE +
Sbjct: 139 VTNLDNGRSVIVRVNDRGPFHSEREIDLSYAAAARLDILDRGTGRVRVEAI 189


>gi|254521650|ref|ZP_05133705.1| rare lipoprotein A [Stenotrophomonas sp. SKA14]
 gi|219719241|gb|EED37766.1| rare lipoprotein A [Stenotrophomonas sp. SKA14]
          Length = 413

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 68/137 (49%), Positives = 84/137 (61%), Gaps = 14/137 (10%)

Query: 46  VTASDRIVSGKRVPRGGGRYFLGKPYQIMG--RWYVPRQYTAYAAVGMASWYGKAFHGRL 103
           VTA +R   G + P       LGK Y ++   R YV R        G AS+YG  FHGRL
Sbjct: 88  VTAEERSAIGNKSPY----VVLGKSYNVLDDTRNYVER--------GTASYYGAKFHGRL 135

Query: 104 TANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAK 163
           T+N EVY     TAAH TLPLPS+ RVTN++NG S++VRVNDRGP+H  R++DLS AAA 
Sbjct: 136 TSNREVYDMYQFTAAHKTLPLPSFARVTNLDNGESVIVRVNDRGPFHDGRVVDLSYAAAV 195

Query: 164 ILRVEERGVSKVHVEYL 180
            L + +RG   V V  L
Sbjct: 196 RLGITQRGTGNVEVRAL 212


>gi|90414080|ref|ZP_01222063.1| hypothetical rare lipoprotein A [Photobacterium profundum 3TCK]
 gi|90324875|gb|EAS41403.1| hypothetical rare lipoprotein A [Photobacterium profundum 3TCK]
          Length = 301

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 83/134 (61%), Gaps = 2/134 (1%)

Query: 59  PRGGGRYFLG-KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYIT 116
           PR   +   G K Y + G+ Y +      +   G ASWYG+ FHG  T+NGE+Y    +T
Sbjct: 80  PRYESKSLAGNKDYTLRGKRYKIENIENGFTEQGNASWYGEKFHGHKTSNGEIYDMYSMT 139

Query: 117 AAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVH 176
           AAH TLPLPSYV+VTN  NG S +VRVNDRGP+H  R+IDLS AAA  L V + G + V 
Sbjct: 140 AAHKTLPLPSYVKVTNTNNGQSTIVRVNDRGPFHDGRIIDLSMAAASKLGVIKTGTAPVK 199

Query: 177 VEYLGMALLNGMDQ 190
           +E + +   + +D+
Sbjct: 200 IELINVVKPDSVDE 213


>gi|119504243|ref|ZP_01626323.1| Sugar fermentation stimulation protein [marine gamma
           proteobacterium HTCC2080]
 gi|119459751|gb|EAW40846.1| Sugar fermentation stimulation protein [marine gamma
           proteobacterium HTCC2080]
          Length = 255

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 113/208 (54%), Gaps = 12/208 (5%)

Query: 19  VLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWY 78
           VL + S      Y  ++ +  P  +      D I   + + R G       PY + G+ Y
Sbjct: 7   VLAVVSLLGGCAYSVEEADRAPPPISPGAVPDAIPYAEPITRAGN----SSPYTVNGKTY 62

Query: 79  -VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGI 137
            V      Y+  G+ASWYG  FHGR TANGE +     TAAH +LP+P+++RVTN+EN  
Sbjct: 63  TVLSSAENYSEEGVASWYGLKFHGRATANGERFSAYEPTAAHRSLPIPTFIRVTNLENQA 122

Query: 138 SLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGM----DQEY- 192
           S+VVRVNDRGP+H +R++DLS  AA  L   ++G +KV +E + +  ++ +    D EY 
Sbjct: 123 SMVVRVNDRGPFHPDRILDLSYGAAVRLGFADQGTAKVRIESVEVMGVSDLRTRGDDEYL 182

Query: 193 -LRSTVMVNSATVLPLGCQYREEIVVIP 219
            L+    +N AT   L  +  + +V +P
Sbjct: 183 TLQLGAFMNEATAKAL-ARDSQRLVTVP 209


>gi|23957815|gb|AAN40828.1| unknown [Synechococcus elongatus PCC 7942]
          Length = 341

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 54/99 (54%), Positives = 71/99 (71%)

Query: 82  QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVV 141
           Q      VGMASWYG  FHGR TANGEV+    +TAAH TLP  + VRVTN+ +G ++VV
Sbjct: 234 QQVVSTTVGMASWYGPGFHGRRTANGEVFNQHTLTAAHRTLPFGTLVRVTNLRSGSNVVV 293

Query: 142 RVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           R+NDRGP+H NRLIDLS  AA+++ +   GV++V ++ L
Sbjct: 294 RINDRGPFHGNRLIDLSQGAAEVIGLRSSGVAQVRLDVL 332


>gi|262402707|ref|ZP_06079268.1| rare lipoprotein A precursor [Vibrio sp. RC586]
 gi|262351489|gb|EEZ00622.1| rare lipoprotein A precursor [Vibrio sp. RC586]
          Length = 238

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 78/113 (69%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           K Y + G+ Y + +    ++ VG ASWYGK FHG LT+NGE+Y    +TAAH TLP+PSY
Sbjct: 32  KDYTLRGQSYRIIKNPKGFSEVGKASWYGKKFHGHLTSNGEIYDMYSMTAAHKTLPIPSY 91

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           V+V N +NG S +VRVNDRGP+H  R+IDLS AAA  + V + G + V +E +
Sbjct: 92  VKVINTDNGKSTIVRVNDRGPFHEGRVIDLSYAAAYKIGVVQAGTANVRIEVI 144


>gi|253997623|ref|YP_003049687.1| rare lipoprotein A [Methylotenera mobilis JLW8]
 gi|253984302|gb|ACT49160.1| rare lipoprotein A [Methylotenera mobilis JLW8]
          Length = 320

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/110 (53%), Positives = 77/110 (70%), Gaps = 1/110 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPYQ +G+ YVP   Y  Y+  G+ASWYGK +HGR T++GEVY    ++AAH TLP+PS+
Sbjct: 79  KPYQALGKKYVPMTSYAPYSKQGVASWYGKRYHGRKTSSGEVYDMYGMSAAHTTLPIPSF 138

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
            +V N  NG +++VRVNDRGP+ S+RLIDLS AAA  L +   G   V V
Sbjct: 139 AKVVNPANGKAVIVRVNDRGPFKSDRLIDLSYAAAHKLGLVANGSGTVEV 188


>gi|56750407|ref|YP_171108.1| hypothetical protein syc0398_d [Synechococcus elongatus PCC 6301]
 gi|56685366|dbj|BAD78588.1| hypothetical protein [Synechococcus elongatus PCC 6301]
          Length = 341

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 54/99 (54%), Positives = 71/99 (71%)

Query: 82  QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVV 141
           Q      VGMASWYG  FHGR TANGEV+    +TAAH TLP  + VRVTN+ +G ++VV
Sbjct: 234 QQVVSTTVGMASWYGPGFHGRRTANGEVFNQHTLTAAHRTLPFGTLVRVTNLRSGSNVVV 293

Query: 142 RVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           R+NDRGP+H NRLIDLS  AA+++ +   GV++V ++ L
Sbjct: 294 RINDRGPFHGNRLIDLSQGAAEVIGLRSSGVAQVRLDVL 332


>gi|81299961|ref|YP_400169.1| rare lipoprotein A [Synechococcus elongatus PCC 7942]
 gi|81168842|gb|ABB57182.1| rare lipoprotein A [Synechococcus elongatus PCC 7942]
          Length = 335

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 54/99 (54%), Positives = 71/99 (71%)

Query: 82  QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVV 141
           Q      VGMASWYG  FHGR TANGEV+    +TAAH TLP  + VRVTN+ +G ++VV
Sbjct: 228 QQVVSTTVGMASWYGPGFHGRRTANGEVFNQHTLTAAHRTLPFGTLVRVTNLRSGSNVVV 287

Query: 142 RVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           R+NDRGP+H NRLIDLS  AA+++ +   GV++V ++ L
Sbjct: 288 RINDRGPFHGNRLIDLSQGAAEVIGLRSSGVAQVRLDVL 326


>gi|190575884|ref|YP_001973729.1| putative exported rare lipoprotein A [Stenotrophomonas maltophilia
           K279a]
 gi|190013806|emb|CAQ47443.1| putative exported rare lipoprotein A [Stenotrophomonas maltophilia
           K279a]
          Length = 422

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 68/146 (46%), Positives = 87/146 (59%), Gaps = 10/146 (6%)

Query: 46  VTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTA 105
           VTA +R   G + P       LGK Y+++   +       Y   G AS+YG  FHGRLT+
Sbjct: 97  VTAEERSAIGNKSPY----VVLGKSYKVLDDTH------DYVERGTASYYGAKFHGRLTS 146

Query: 106 NGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKIL 165
           N EVY     TAAH TLPLPS+ RVTN++NG S++VRVNDRGP+H  R++DLS AAA  L
Sbjct: 147 NREVYDMYQFTAAHKTLPLPSFARVTNLDNGESVIVRVNDRGPFHDGRVVDLSYAAAVRL 206

Query: 166 RVEERGVSKVHVEYLGMALLNGMDQE 191
            + +RG   V V  L     N M Q+
Sbjct: 207 GITQRGTGNVEVRALQPGESNLMAQK 232


>gi|254516726|ref|ZP_05128785.1| rare lipoprotein A [gamma proteobacterium NOR5-3]
 gi|219675149|gb|EED31516.1| rare lipoprotein A [gamma proteobacterium NOR5-3]
          Length = 262

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 63/115 (54%), Positives = 78/115 (67%), Gaps = 1/115 (0%)

Query: 70  PYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY I G  Y V      Y+  G+ASWYG  FHG  TANGE+Y     TAAH +LP+PSY 
Sbjct: 61  PYSIDGVEYRVLDSAEGYSEKGIASWYGTKFHGNKTANGEIYDLYLATAAHRSLPIPSYA 120

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           RVTN+ NG  +VVRVNDRGP+H++RLIDLS AAA  L   ++G ++V VE + MA
Sbjct: 121 RVTNLWNGRQIVVRVNDRGPFHADRLIDLSYAAAVKLGFVDKGTTEVLVETISMA 175


>gi|163752392|ref|ZP_02159586.1| rare lipoprotein A [Shewanella benthica KT99]
 gi|161327729|gb|EDP98917.1| rare lipoprotein A [Shewanella benthica KT99]
          Length = 268

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 81/127 (63%), Gaps = 9/127 (7%)

Query: 60  RGGGRY---FLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYIT 116
           RGG +     LGK YQ++           +   G+ASWYG  FHG LT+NGE Y    ++
Sbjct: 62  RGGNKTNYTVLGKTYQVLDSG------KDFQQTGLASWYGSKFHGHLTSNGETYDMYSMS 115

Query: 117 AAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVH 176
           AAH +LPLPSYV+VTN+ N   ++VRVNDRGP+H +R+IDLS AAA  L + + G + V 
Sbjct: 116 AAHKSLPLPSYVKVTNINNNKQVIVRVNDRGPFHDDRIIDLSYAAAHRLDMLKTGTANVK 175

Query: 177 VEYLGMA 183
           +E + +A
Sbjct: 176 IEVIYIA 182


>gi|323698418|ref|ZP_08110330.1| rare lipoprotein A [Desulfovibrio sp. ND132]
 gi|323458350|gb|EGB14215.1| rare lipoprotein A [Desulfovibrio desulfuricans ND132]
          Length = 246

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/113 (53%), Positives = 77/113 (68%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY ++GR Y P Q    Y  +G+ASWYG  FHGR TANG+ Y    ++AAH TLPL S 
Sbjct: 45  KPYTVLGRTYYPLQSADGYDEIGLASWYGADFHGRKTANGQTYNMYGVSAAHKTLPLGSR 104

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VRVTN+EN  S+V+ +NDRGP+ + R++DLS  AAK L   E GV+KV V  L
Sbjct: 105 VRVTNLENNRSVVLTINDRGPFVNERILDLSYGAAKKLGTVESGVAKVRVTSL 157


>gi|260773273|ref|ZP_05882189.1| rare lipoprotein A precursor [Vibrio metschnikovii CIP 69.14]
 gi|260612412|gb|EEX37615.1| rare lipoprotein A precursor [Vibrio metschnikovii CIP 69.14]
          Length = 265

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 78/119 (65%), Gaps = 8/119 (6%)

Query: 61  GGGRYFL--GKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAA 118
           GG R +   G+ YQI+      R    +   G ASWYGK FHG LT+NGE+Y    +TAA
Sbjct: 59  GGNRDYTLRGESYQII------RNPKGFTERGQASWYGKKFHGHLTSNGEIYDMYSMTAA 112

Query: 119 HPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           H TLPLPSYV+VTN++NG   +VRVNDRGP+H  R+IDLS AAA  L V + G + V +
Sbjct: 113 HKTLPLPSYVKVTNLDNGREAIVRVNDRGPFHEGRIIDLSYAAAYKLGVIQTGTANVDI 171


>gi|34499839|ref|NP_904054.1| rare lipoprotein A [Chromobacterium violaceum ATCC 12472]
 gi|34105689|gb|AAQ62043.1| rare lipoprotein A [Chromobacterium violaceum ATCC 12472]
          Length = 292

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/110 (54%), Positives = 77/110 (70%), Gaps = 1/110 (0%)

Query: 70  PYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY  +G  + P  +   Y AVG ASWYGK FHGR T++GE Y    +TAAHPTLP+PSY 
Sbjct: 81  PYSALGMSFRPDVREKPYHAVGRASWYGKQFHGRKTSSGERYDMFAMTAAHPTLPIPSYA 140

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           RVTN+ NG S+VVRVND GP+H  RL+DLS AAA  L   ++G +K+ ++
Sbjct: 141 RVTNLTNGKSVVVRVNDCGPFHKKRLMDLSYAAAYKLGFVQQGSAKIAID 190


>gi|119944889|ref|YP_942569.1| rare lipoprotein A [Psychromonas ingrahamii 37]
 gi|119863493|gb|ABM02970.1| rare lipoprotein A [Psychromonas ingrahamii 37]
          Length = 260

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 84/139 (60%), Gaps = 5/139 (3%)

Query: 84  TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRV 143
           T  +  G+ASWYG  FHG LT+NGE Y    +TAAH  LPLPSYVRV N+EN   +VVRV
Sbjct: 78  TKLSERGIASWYGNKFHGHLTSNGERYDMFAMTAAHKNLPLPSYVRVINLENNKRIVVRV 137

Query: 144 NDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQE-----YLRSTVM 198
           NDRGP+H  R+IDLS AAA  L + + G +KV ++ L   +   +  +     Y++  V 
Sbjct: 138 NDRGPFHEGRIIDLSYAAAYKLDILKTGTAKVEIQLLHFPVQEDLSNQFNGDYYIQYLVT 197

Query: 199 VNSATVLPLGCQYREEIVV 217
            ++     LG +YR E  V
Sbjct: 198 YSADKANDLGKKYRAEYQV 216


>gi|254281718|ref|ZP_04956686.1| rare lipoprotein A [gamma proteobacterium NOR51-B]
 gi|219677921|gb|EED34270.1| rare lipoprotein A [gamma proteobacterium NOR51-B]
          Length = 248

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 73/112 (65%), Gaps = 1/112 (0%)

Query: 70  PYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY + GR Y V      Y   G ASWYG  FHGR T+NGE++     TAAH TLP+PSY 
Sbjct: 47  PYTVNGRTYTVLDSAAGYRKKGTASWYGTKFHGRRTSNGEIFDVYAATAAHKTLPIPSYA 106

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RVTN++N  S+VVRVNDRGP+H NR+IDLS  AA  L    +G + V VE L
Sbjct: 107 RVTNLDNNRSMVVRVNDRGPFHDNRIIDLSYGAAVKLGFANQGTAPVIVEAL 158


>gi|149377634|ref|ZP_01895372.1| Lipoprotein [Marinobacter algicola DG893]
 gi|149358107|gb|EDM46591.1| Lipoprotein [Marinobacter algicola DG893]
          Length = 289

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 77/109 (70%), Gaps = 1/109 (0%)

Query: 70  PYQIMGR-WYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PYQ+ G+ ++V      Y   G ASWYG+ FHG  T+NGEV+    ++AAH +L +P Y 
Sbjct: 65  PYQVWGKEYHVLGNNDGYVQRGTASWYGEKFHGHKTSNGEVFDMYEMSAAHKSLRIPGYA 124

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           RVTN++NG S+VVRVNDRGP+H +RLIDLS AAAK L  + RG ++V V
Sbjct: 125 RVTNLDNGRSVVVRVNDRGPFHGDRLIDLSYAAAKKLGYQGRGTARVEV 173


>gi|332978290|gb|EGK15018.1| rare lipoprotein A [Psychrobacter sp. 1501(2011)]
          Length = 199

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 54/92 (58%), Positives = 70/92 (76%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  FHGR TA+GE +    +TAAHP+LP  +Y+RVTN  NG S+VV+VNDRGPY
Sbjct: 106 GSASWYGGKFHGRKTASGERFDMNSLTAAHPSLPFNTYLRVTNKGNGKSVVVKVNDRGPY 165

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           HSNR++DLS AAAK + +  RG++ V +E +G
Sbjct: 166 HSNRMLDLSYAAAKQIGLVSRGIANVTIERVG 197


>gi|300313949|ref|YP_003778041.1| lipoprotein [Herbaspirillum seropedicae SmR1]
 gi|300076734|gb|ADJ66133.1| lipoprotein [Herbaspirillum seropedicae SmR1]
          Length = 398

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 65/152 (42%), Positives = 94/152 (61%), Gaps = 9/152 (5%)

Query: 31  YKDDKL-EYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVP-RQYTAYAA 88
           YKDD   ++ P+ +  V  ++  V  + V +   R     PY + G+ YVP      +  
Sbjct: 77  YKDDGPGDHIPDGLLDVADAEPQV--EPVSKAASR-----PYAVFGKTYVPITDNQPFVQ 129

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G+ SWYGK FHG+ T++GE+Y    +TAAHPTLP+PSY RVTN++ G  ++VR+NDRGP
Sbjct: 130 RGIGSWYGKKFHGQKTSSGELYDMYKMTAAHPTLPIPSYARVTNLKTGKQVIVRINDRGP 189

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +HS+R+IDLS  AA  L     G S++ VE +
Sbjct: 190 FHSSRIIDLSYTAALKLGYLGSGSSELEVERI 221


>gi|90407770|ref|ZP_01215948.1| Rare lipoprotein A [Psychromonas sp. CNPT3]
 gi|90311130|gb|EAS39237.1| Rare lipoprotein A [Psychromonas sp. CNPT3]
          Length = 258

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 74/173 (42%), Positives = 100/173 (57%), Gaps = 15/173 (8%)

Query: 14  VVCVVVLGMSSCFFSSTY--KDDKL---EYFPESMYGVTASDRIVSGKRVPRGGGRYFLG 68
           ++C+ +L +S+C  S+ Y   DD        P   +   AS R    +   RGG      
Sbjct: 8   ILCISLLVLSACS-SNRYAINDDHAPNKSSIPPLAHIENASPRY---EPYSRGGN----- 58

Query: 69  KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           K Y + G  Y V +  T++   G ASWYGK FHG LT+NGE Y    ++AAH  LPLPSY
Sbjct: 59  KDYNVRGIHYKVLKNVTSFTEKGNASWYGKKFHGHLTSNGERYNMFAMSAAHKNLPLPSY 118

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           V VTN++N   ++VRVNDRGP+HS R+IDLS AAAK L +   G + V ++ L
Sbjct: 119 VEVTNLKNSKKIIVRVNDRGPFHSKRIIDLSYAAAKKLDMLASGTTPVSIKLL 171


>gi|294142180|ref|YP_003558158.1| rare lipoprotein A [Shewanella violacea DSS12]
 gi|293328649|dbj|BAJ03380.1| rare lipoprotein A [Shewanella violacea DSS12]
          Length = 265

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 79/122 (64%), Gaps = 9/122 (7%)

Query: 60  RGGGR---YFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYIT 116
           RGG +     LGK YQ++           +   G ASWYG  FHG LT+NGE Y    ++
Sbjct: 59  RGGNKSNYKVLGKTYQVLNSG------KGFVQTGYASWYGSKFHGHLTSNGETYDMYSMS 112

Query: 117 AAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVH 176
           AAH +LPLPSYVRVTN++N   ++VRVNDRGP+H++R+IDLS AAA  L + + G + V 
Sbjct: 113 AAHKSLPLPSYVRVTNLKNNKQVIVRVNDRGPFHTSRIIDLSYAAAHKLDMLKNGTAYVK 172

Query: 177 VE 178
           +E
Sbjct: 173 IE 174


>gi|296273486|ref|YP_003656117.1| rare lipoprotein A [Arcobacter nitrofigilis DSM 7299]
 gi|296097660|gb|ADG93610.1| rare lipoprotein A [Arcobacter nitrofigilis DSM 7299]
          Length = 269

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 98/179 (54%), Gaps = 8/179 (4%)

Query: 6   CDCLLKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASD-RIVSGKRVPRGGGR 64
            D L K     ++ +  + CF SS+Y       F +    +   + ++ + + + R   R
Sbjct: 5   IDNLFKLVFTFLITILFTGCF-SSSYNYSNFNVFKKDRSSIKVPEQKMKNSEAMHRATMR 63

Query: 65  YFLGKPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLP 123
                PYQ+ G+WY P          G++SWYG  FH + T+NGE+Y     TAAH TLP
Sbjct: 64  -----PYQVFGKWYYPTVAKIGDTQTGISSWYGPNFHAKPTSNGEIYNMYKATAAHKTLP 118

Query: 124 LPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           + + ++V N+ENG S +VRVNDRGP+   R+IDLSN AA+ + +  +G +KV +  +G 
Sbjct: 119 MNTMLKVENLENGKSTIVRVNDRGPFVGTRIIDLSNKAARDIDMVAKGTAKVRITVIGF 177


>gi|297539772|ref|YP_003675541.1| rare lipoprotein A [Methylotenera sp. 301]
 gi|297259119|gb|ADI30964.1| rare lipoprotein A [Methylotenera sp. 301]
          Length = 354

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 76/113 (67%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWYVPRQ-YTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY  +G+ Y P   Y  Y   G+ASWYGK FHG+ T+ GEVY    +T AH  LP+PSY
Sbjct: 102 KPYSALGQQYTPMTGYVPYKKQGIASWYGKRFHGKKTSTGEVYDMYAMTGAHTILPIPSY 161

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            +VTN  NG S++VR+NDRGP+  +RLIDLS AAA  LR+ ++G   V VE +
Sbjct: 162 AKVTNPANGRSVIVRINDRGPFKRDRLIDLSYAAAYQLRLIKQGSGLVEVETI 214


>gi|237753225|ref|ZP_04583705.1| rare lipoprotein A rlpA [Helicobacter winghamensis ATCC BAA-430]
 gi|229375492|gb|EEO25583.1| rare lipoprotein A rlpA [Helicobacter winghamensis ATCC BAA-430]
          Length = 274

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 78/115 (67%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQI G+WY P   T      G+ASWYG  FHG+ T+NGE Y     TAAH TLP+ + 
Sbjct: 55  RPYQINGKWYYPTTVTLGETYDGIASWYGPKFHGKKTSNGETYSMYAHTAAHKTLPMNTI 114

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           VRVT+ ENG S +VR+NDRGP+ + R+IDLS +AA+ + +  +G ++V VE +G 
Sbjct: 115 VRVTSKENGRSTIVRINDRGPFIAGRIIDLSKSAAEDIDMMAKGTARVRVEVIGF 169


>gi|303256306|ref|ZP_07342322.1| RlpA family protein [Burkholderiales bacterium 1_1_47]
 gi|302861035|gb|EFL84110.1| RlpA family protein [Burkholderiales bacterium 1_1_47]
          Length = 378

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 79/118 (66%), Gaps = 1/118 (0%)

Query: 69  KPYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY +MG+ YVP         VG  SWYGK FHG+ T+ GE+Y    ++AAH T+ LPSY
Sbjct: 56  RPYTVMGKRYVPMTGDKPLTQVGYGSWYGKQFHGKKTSTGEIYNMYEMSAAHTTMELPSY 115

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALL 185
            RVTN+ENG S++VRVNDRGP+  +R+IDLS AAA  L    +G ++V VE +  A +
Sbjct: 116 ARVTNLENGKSVIVRVNDRGPFLHSRVIDLSYAAATKLGYAGKGTARVKVERITRAQI 173


>gi|325294529|ref|YP_004281043.1| rare lipoprotein A [Desulfurobacterium thermolithotrophum DSM
           11699]
 gi|325064977|gb|ADY72984.1| rare lipoprotein A [Desulfurobacterium thermolithotrophum DSM
           11699]
          Length = 236

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 58/112 (51%), Positives = 81/112 (72%), Gaps = 1/112 (0%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ GR Y V ++   Y   G+ASWYG  FHGR TA+GE+Y    +TAAH TLPL +YV+
Sbjct: 38  YKVNGRTYCVRKKADGYVEYGIASWYGPGFHGRRTASGEIYNMYKLTAAHKTLPLGTYVK 97

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           V N+ENG S++V++NDRGP+   R+IDLS AAAK +R+ ++G +KV +  LG
Sbjct: 98  VINLENGRSVIVKINDRGPFVRGRIIDLSYAAAKKIRMLKKGTAKVKIIALG 149


>gi|82701449|ref|YP_411015.1| rare lipoprotein A [Nitrosospira multiformis ATCC 25196]
 gi|82409514|gb|ABB73623.1| rare lipoprotein A [Nitrosospira multiformis ATCC 25196]
          Length = 394

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 62/113 (54%), Positives = 79/113 (69%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY  +G+ Y P  ++  Y   GMASWYG+ +HG+ TA+GEVY    +TAAHPTLP+PSY
Sbjct: 107 RPYSALGKRYKPMTRHERYKTRGMASWYGRRYHGQKTASGEVYDMYAMTAAHPTLPIPSY 166

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            RVT++ +G S+VVRVNDRGP+ SNRLIDLS  AA  L V   G   V VE +
Sbjct: 167 ARVTSVTSGKSVVVRVNDRGPFLSNRLIDLSYTAAYKLDVLGGGSGLVEVESI 219


>gi|237748820|ref|ZP_04579300.1| rare lipoprotein A [Oxalobacter formigenes OXCC13]
 gi|229380182|gb|EEO30273.1| rare lipoprotein A [Oxalobacter formigenes OXCC13]
          Length = 329

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 77/118 (65%), Gaps = 1/118 (0%)

Query: 64  RYFLGKPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTL 122
           R    +PY + G+ Y P  +   Y   G+ SWYGK FHG+ T++GE Y    +TAAHPTL
Sbjct: 81  RTATARPYVVFGQTYTPMTELQPYKKSGVGSWYGKKFHGQKTSSGEAYDMFAMTAAHPTL 140

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           P+PSY RVT++E G  ++V+VNDRGP+ SNR+IDLS  AA  L    +G  +V VE L
Sbjct: 141 PIPSYARVTSLETGRQVIVKVNDRGPFLSNRIIDLSYTAAFKLGYLNKGSGQVQVELL 198


>gi|308048533|ref|YP_003912099.1| rare lipoprotein A [Ferrimonas balearica DSM 9799]
 gi|307630723|gb|ADN75025.1| rare lipoprotein A [Ferrimonas balearica DSM 9799]
          Length = 264

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 78/121 (64%), Gaps = 8/121 (6%)

Query: 60  RGGGRYF--LGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITA 117
           RGG R +   GK YQ++           Y   G ASWYG  FHG LT+NGE Y     +A
Sbjct: 56  RGGNRDYEVWGKSYQVL------PSAEGYVEEGNASWYGAKFHGHLTSNGETYDMFSFSA 109

Query: 118 AHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           AH +LPLP+Y +VTN+ NG SLVVR+NDRGP+HS+R+IDLS AAA  L + + G + V V
Sbjct: 110 AHRSLPLPTYAKVTNLSNGKSLVVRINDRGPFHSDRIIDLSYAAAWHLDILKSGTAPVRV 169

Query: 178 E 178
           E
Sbjct: 170 E 170


>gi|120555322|ref|YP_959673.1| rare lipoprotein A [Marinobacter aquaeolei VT8]
 gi|120325171|gb|ABM19486.1| rare lipoprotein A [Marinobacter aquaeolei VT8]
          Length = 295

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 76/109 (69%), Gaps = 1/109 (0%)

Query: 70  PYQIMG-RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY + G R++V      Y   G ASWYG+ FHG  T+NGEV+    ++AAH +L +P Y 
Sbjct: 68  PYTVWGKRYHVMDSNDGYVQRGTASWYGEKFHGHKTSNGEVFDMYAMSAAHKSLRIPGYA 127

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           RVTN++NG S++VRVNDRGP+H +RLIDLS AAAK L  + RG ++V V
Sbjct: 128 RVTNLDNGRSVIVRVNDRGPFHGDRLIDLSYAAAKKLGYQSRGTARVEV 176


>gi|330999001|ref|ZP_08322726.1| sporulation and cell division repeat protein [Parasutterella
           excrementihominis YIT 11859]
 gi|329575743|gb|EGG57269.1| sporulation and cell division repeat protein [Parasutterella
           excrementihominis YIT 11859]
          Length = 385

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 79/118 (66%), Gaps = 1/118 (0%)

Query: 69  KPYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY +MG+ YVP         VG  SWYGK FHG+ T+ GE+Y    ++AAH T+ LPSY
Sbjct: 63  RPYTVMGKRYVPMTGDKPLTQVGYGSWYGKQFHGKKTSTGEIYNMYEMSAAHTTMELPSY 122

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALL 185
            RVTN+ENG S++VRVNDRGP+  +R+IDLS AAA  L    +G ++V VE +  A +
Sbjct: 123 ARVTNLENGKSVIVRVNDRGPFLHSRVIDLSYAAATKLGYAGKGTARVKVERITRAQI 180


>gi|254491413|ref|ZP_05104592.1| putative rare lipoprotein A double-psi beta-barrel [Methylophaga
           thiooxidans DMS010]
 gi|224462891|gb|EEF79161.1| putative rare lipoprotein A double-psi beta-barrel [Methylophaga
           thiooxydans DMS010]
          Length = 273

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 78/123 (63%), Gaps = 3/123 (2%)

Query: 58  VPRGGGRYFLGKP--YQIMG-RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEY 114
           VP+   R   G P  Y++ G R+Y       Y   G+ASWYG  FHGR T++GE Y    
Sbjct: 46  VPKYEPRSKYGNPAQYEVFGKRYYTLTSAEGYREKGIASWYGTKFHGRRTSSGETYDMYE 105

Query: 115 ITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSK 174
           +TAAH TLPLPSY  VTN+ENG  ++V+VNDRGP+H NRLIDLS +AA  L +  +G   
Sbjct: 106 MTAAHKTLPLPSYAEVTNLENGRKVIVKVNDRGPFHGNRLIDLSYSAATKLGIVAKGTGL 165

Query: 175 VHV 177
           V V
Sbjct: 166 VEV 168


>gi|86151747|ref|ZP_01069961.1| rare lipoprotein A [Campylobacter jejuni subsp. jejuni 260.94]
 gi|315124161|ref|YP_004066165.1| rare lipoprotein A [Campylobacter jejuni subsp. jejuni ICDCCJ07001]
 gi|85841376|gb|EAQ58624.1| rare lipoprotein A [Campylobacter jejuni subsp. jejuni 260.94]
 gi|315017883|gb|ADT65976.1| rare lipoprotein A [Campylobacter jejuni subsp. jejuni ICDCCJ07001]
          Length = 275

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 72/182 (39%), Positives = 96/182 (52%), Gaps = 18/182 (9%)

Query: 10  LKGSVVCVVVLGMSSC----FFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRY 65
           LK S V + VL  S C    FFSS   D+   Y+P + +           K  P   G  
Sbjct: 8   LKLSAVSLGVLFFSGCLGTSFFSSL--DNAQVYYPSNDF-----------KSSPSSSGTK 54

Query: 66  FLGKPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
              KPY I G+ Y P        A G+ASWYG  FHG+ T+NGE Y    +TAAH TLP+
Sbjct: 55  GTMKPYTINGKTYYPTVVAVGETADGIASWYGPGFHGKKTSNGETYNQNALTAAHKTLPM 114

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMAL 184
            + ++VTN+ N   + VRVNDRGP+ +NR+IDLS  AA  + +   G + V +E +G   
Sbjct: 115 NTILKVTNLNNNRQVTVRVNDRGPFVNNRIIDLSKGAASQIDMIASGTAPVRLEVIGFGS 174

Query: 185 LN 186
            N
Sbjct: 175 SN 176


>gi|71898463|ref|ZP_00680635.1| Rare lipoprotein A [Xylella fastidiosa Ann-1]
 gi|71731776|gb|EAO33835.1| Rare lipoprotein A [Xylella fastidiosa Ann-1]
          Length = 384

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 66/145 (45%), Positives = 89/145 (61%), Gaps = 5/145 (3%)

Query: 70  PYQIMGR-WYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY ++G+ ++V  +   Y   G+AS+YG  FHGRLT+N EVY     TAAH TLPLPS+ 
Sbjct: 108 PYVVLGKSYWVLDEAKGYIKRGIASYYGTKFHGRLTSNREVYDMYAFTAAHKTLPLPSFA 167

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM----AL 184
            +TN++NG S+VVRVNDRGP+H +RLIDLS AAA  L   E G++ V V  L       L
Sbjct: 168 LITNLDNGKSVVVRVNDRGPFHDDRLIDLSYAAAVKLGFTENGLANVEVRVLSEDDNPML 227

Query: 185 LNGMDQEYLRSTVMVNSATVLPLGC 209
           L   D+    +T    + T+ P+  
Sbjct: 228 LARHDKRIAPTTANPVATTMAPMAT 252


>gi|319779016|ref|YP_004129929.1| Rare lipoprotein A precursor [Taylorella equigenitalis MCE9]
 gi|317109040|gb|ADU91786.1| Rare lipoprotein A precursor [Taylorella equigenitalis MCE9]
          Length = 157

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 77/116 (66%), Gaps = 1/116 (0%)

Query: 68  GKPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
           GK Y++ G+ Y P  +   ++  G ASWYG  FHGRLTANG+ Y    +TAAH  LP  S
Sbjct: 38  GKAYKVAGKVYRPYTKIKEFSQTGTASWYGPGFHGRLTANGQKYNQNALTAAHKELPFNS 97

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
            V+VT+   G S++V +NDRGP+H+NR+IDLS  AAK L + ++G  KV +E +G 
Sbjct: 98  IVKVTSETTGKSVIVYINDRGPFHNNRIIDLSYEAAKQLGIHKKGTDKVKIELVGF 153


>gi|119477454|ref|ZP_01617645.1| Lipoprotein [marine gamma proteobacterium HTCC2143]
 gi|119449380|gb|EAW30619.1| Lipoprotein [marine gamma proteobacterium HTCC2143]
          Length = 262

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 99/170 (58%), Gaps = 10/170 (5%)

Query: 13  SVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQ 72
           +++ + ++G  S    S  KD   ++    +   T  D I     V R G +     PY 
Sbjct: 8   AILTLTLVGCQSVGRISEQKDGAPQH---QVSADTIVDAIPRKDAVTRAGNK----NPYT 60

Query: 73  IMGRWY--VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRV 130
           ++G+ Y  +P     Y   G+ASWYG  F GR TANGE Y    +TAAH TLP+P+YVRV
Sbjct: 61  VLGKTYHLLPTS-AGYNQRGVASWYGTKFQGRPTANGEPYNLYGMTAAHRTLPIPAYVRV 119

Query: 131 TNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           TN++N  + +VRVNDRGP+H +R+IDLS AAA  L   E+G ++V VE +
Sbjct: 120 TNLDNNRTAIVRVNDRGPFHDDRIIDLSYAAAVKLGYAEKGTARVLVETI 169


>gi|218780717|ref|YP_002432035.1| rare lipoprotein A [Desulfatibacillum alkenivorans AK-01]
 gi|218762101|gb|ACL04567.1| rare lipoprotein A [Desulfatibacillum alkenivorans AK-01]
          Length = 238

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 77/113 (68%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY+I G+WY P      +   G ASWYGK FHG+ TANGEVY    +TAAH TLPL ++
Sbjct: 34  KPYKIQGKWYHPIPDARGFTQTGKASWYGKDFHGKKTANGEVYNMHAMTAAHKTLPLGTW 93

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VRV N+ NG +  VRVNDRGP+   R+IDLS +AAK + +   GV+KV ++ L
Sbjct: 94  VRVYNLTNGKTCDVRVNDRGPFVRGRIIDLSYSAAKEIGLVGPGVAKVRIKAL 146


>gi|85713002|ref|ZP_01044040.1| Rare lipoprotein A [Idiomarina baltica OS145]
 gi|85693171|gb|EAQ31131.1| Rare lipoprotein A [Idiomarina baltica OS145]
          Length = 269

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 60/114 (52%), Positives = 77/114 (67%), Gaps = 1/114 (0%)

Query: 68  GKPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
            + YQ+ G +Y V  +   Y+  G+ASWYG  FHG LT+NGE Y    +TAAH  LPLP+
Sbjct: 62  NQDYQVNGVFYDVMERAEGYSETGIASWYGNKFHGHLTSNGEYYDMYSMTAAHTRLPLPT 121

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           YVRVTN+ N   ++VRVNDRGP+HS+RLIDLS AAA  L +   G + V VE +
Sbjct: 122 YVRVTNLNNQRQVIVRVNDRGPFHSDRLIDLSFAAAYKLDIVGHGTAPVKVEAI 175


>gi|260752473|ref|YP_003225366.1| lipoprotein A [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|283856401|ref|YP_162823.2| rare lipoprotein A [Zymomonas mobilis subsp. mobilis ZM4]
 gi|258551836|gb|ACV74782.1| rare lipoprotein A [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|283775401|gb|AAV89712.2| rare lipoprotein A [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 157

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 60/112 (53%), Positives = 75/112 (66%)

Query: 69  KPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           +PY + G  YVP+   +Y  VG ASWYG  F G  TA GE +    I+AAH TLPLP YV
Sbjct: 46  RPYTVGGVTYVPKDDPSYNEVGYASWYGDDFAGHPTAIGEKFSPNAISAAHKTLPLPCYV 105

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            VTN+E G  LVVRVNDRGP+   R+IDLS  AA+ L +E++G +KV V+ L
Sbjct: 106 EVTNLETGRRLVVRVNDRGPFVQGRIIDLSRGAARALGIEKKGTAKVRVKRL 157


>gi|238023025|ref|ZP_04603451.1| hypothetical protein GCWU000324_02947 [Kingella oralis ATCC 51147]
 gi|237865408|gb|EEP66548.1| hypothetical protein GCWU000324_02947 [Kingella oralis ATCC 51147]
          Length = 285

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 77/112 (68%), Gaps = 2/112 (1%)

Query: 71  YQIMGRWYVPRQYTA--YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           Y++ G+ Y PR+     ++  G ASWYG  FHG+ T++GE +    +TAAH TLP+PSY 
Sbjct: 64  YKVAGKRYYPRKSVEKNFSQTGRASWYGPGFHGKKTSSGERFDMNALTAAHRTLPIPSYA 123

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RVTN+ NG ++VVR+NDRGP+H  R++DLS  AAK L   ++G + V +E L
Sbjct: 124 RVTNLANGKTIVVRINDRGPFHGKRVLDLSKGAAKALGFIQQGSTNVRIEAL 175


>gi|319944914|ref|ZP_08019176.1| rare lipoprotein A [Lautropia mirabilis ATCC 51599]
 gi|319741484|gb|EFV93909.1| rare lipoprotein A [Lautropia mirabilis ATCC 51599]
          Length = 397

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 61/116 (52%), Positives = 79/116 (68%), Gaps = 1/116 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY++MG+ + P  +   Y   G+ASWYG+ FHG+ T+ GE Y    +TAAHPTLPLPSY
Sbjct: 71  RPYRVMGQDFAPMTERKPYKKQGVASWYGQRFHGKPTSTGETYDMYQMTAAHPTLPLPSY 130

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
            RVT ++NG S+VVRVNDRGP+   RLIDLS  AA  L    +G ++V VE L  A
Sbjct: 131 ARVTRLDNGRSVVVRVNDRGPFLRGRLIDLSYLAASKLGYVGKGHAEVEVELLNPA 186


>gi|291280451|ref|YP_003497286.1| rare lipoprotein A [Deferribacter desulfuricans SSM1]
 gi|290755153|dbj|BAI81530.1| rare lipoprotein A [Deferribacter desulfuricans SSM1]
          Length = 240

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 63/120 (52%), Positives = 82/120 (68%), Gaps = 3/120 (2%)

Query: 62  GGRYFLGKPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHP 120
           G RY  GKPY I G+ Y P  + + +  VG+ASWYGK  HG+LTA+GE +    +TAAH 
Sbjct: 33  GVRY--GKPYVIRGKLYYPYTKISHFQQVGIASWYGKEEHGKLTASGERFNMYDLTAAHK 90

Query: 121 TLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            LPL SYV V N+ENG  + VR+NDRGP+ S R+IDLS AAAK + + E+G +KV +  L
Sbjct: 91  LLPLGSYVHVKNLENGKEVDVRINDRGPFISGRIIDLSYAAAKKIGIVEKGTAKVKITLL 150


>gi|84394381|ref|ZP_00993100.1| putative rare lipoprotein A [Vibrio splendidus 12B01]
 gi|84374983|gb|EAP91911.1| putative rare lipoprotein A [Vibrio splendidus 12B01]
          Length = 279

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 87/144 (60%), Gaps = 7/144 (4%)

Query: 61  GGGRYFL-GKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAH 119
           G   Y L G+ Y+I+ R         +   G ASWYGK FHG LT+NGE+Y    ++AAH
Sbjct: 74  GNTNYTLRGEDYKIIKRT------EGFTEKGKASWYGKKFHGHLTSNGEIYDMYSMSAAH 127

Query: 120 PTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEY 179
            TLP+PSYV+VTN +N  + +VR+NDRGP+H  R+IDLS AAA  L V   G + V +E 
Sbjct: 128 KTLPIPSYVKVTNTDNNKTTIVRINDRGPFHEGRIIDLSYAAAYKLDVLRTGTANVEIEV 187

Query: 180 LGMALLNGMDQEYLRSTVMVNSAT 203
           + +A+    +++      ++  AT
Sbjct: 188 ITVAMPTDANKKAALPQFIIQVAT 211


>gi|239904865|ref|YP_002951603.1| putative rare lipoprotein A [Desulfovibrio magneticus RS-1]
 gi|239794728|dbj|BAH73717.1| putative rare lipoprotein A [Desulfovibrio magneticus RS-1]
          Length = 237

 Score =  119 bits (297), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 75/111 (67%), Gaps = 1/111 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY I G  YVP R    Y   G+ASWYG  FHG+ T+NGEVY    +T AH  LP+ + 
Sbjct: 36  RPYTIKGVTYVPLRSAKGYREEGIASWYGPGFHGKRTSNGEVYDQYQLTCAHKLLPMQTK 95

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           VRVTN+ENG S+ +RVNDRGP+ + R+IDLS A A+ L V  RG ++V VE
Sbjct: 96  VRVTNLENGRSMTLRVNDRGPFVAGRIIDLSQAGARELGVHARGTARVRVE 146


>gi|148981389|ref|ZP_01816385.1| putative rare lipoprotein A [Vibrionales bacterium SWAT-3]
 gi|145960881|gb|EDK26211.1| putative rare lipoprotein A [Vibrionales bacterium SWAT-3]
          Length = 279

 Score =  119 bits (297), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 55/115 (47%), Positives = 77/115 (66%), Gaps = 1/115 (0%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + G  Y + ++   +   G ASWYGK FHG LT+NGE+Y    ++AAH TLP+PSYV+
Sbjct: 78  YTLRGEDYKIVKETEGFTEKGKASWYGKKFHGHLTSNGEIYDMYSMSAAHKTLPIPSYVK 137

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMAL 184
           VTN +N  + +VR+NDRGP+H  R+IDLS AAA  L V   G + V +E + +A+
Sbjct: 138 VTNTDNNKTTIVRINDRGPFHEGRIIDLSYAAAYKLDVLRTGTANVEIEVIKVAM 192


>gi|260550870|ref|ZP_05825076.1| rare lipoprotein A family protein [Acinetobacter sp. RUH2624]
 gi|260405997|gb|EEW99483.1| rare lipoprotein A family protein [Acinetobacter sp. RUH2624]
          Length = 205

 Score =  119 bits (297), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 52/93 (55%), Positives = 70/93 (75%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           ++  GMASWYG+ FHGR TA+GE +    +TAAH +LPL  Y+RVTN +NG S+VV+VND
Sbjct: 106 FSQTGMASWYGRQFHGRKTASGETFDMNALTAAHRSLPLNCYIRVTNKDNGKSVVVKVND 165

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           RGP+H+NR++DLS  AAK L +   G +KV +E
Sbjct: 166 RGPFHANRVLDLSYGAAKRLGITNAGTAKVSIE 198


>gi|15838776|ref|NP_299464.1| rare lipoprotein A [Xylella fastidiosa 9a5c]
 gi|9107327|gb|AAF84984.1|AE004032_3 rare lipoprotein A [Xylella fastidiosa 9a5c]
          Length = 415

 Score =  118 bits (296), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 77/112 (68%), Gaps = 1/112 (0%)

Query: 70  PYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY ++G+ Y V  +   Y   G+AS+YG  FHGRLT+N EVY     TAAH TLPLPS+ 
Sbjct: 108 PYVVLGKSYRVLDEAKGYIKRGVASYYGTKFHGRLTSNREVYDMYAFTAAHKTLPLPSFA 167

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            +TN++NG S+VVRVNDRGP+H +RLIDLS AAA  L   E G++ V V  L
Sbjct: 168 LITNLDNGKSVVVRVNDRGPFHDDRLIDLSYAAAVKLGFTENGLANVEVRVL 219


>gi|317011808|gb|ADU85555.1| rare lipoprotein A [Helicobacter pylori SouthAfrica7]
          Length = 315

 Score =  118 bits (296), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 88/138 (63%), Gaps = 4/138 (2%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+ G+WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 96  RPYQVGGKWYYPTKVDLGEKFDGIASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTI 155

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
           V+V N+EN +S +VR+NDRGP+ S+R+IDLSNAAA+ + + ++G + V +  LG     G
Sbjct: 156 VKVINVENHLSTIVRINDRGPFVSDRIIDLSNAAARDIDMVKKGTASVRLIVLGFG---G 212

Query: 188 MDQEYLRSTVMVNSATVL 205
           +  +    +   NS+ +L
Sbjct: 213 VISKQYEQSFNANSSKIL 230


>gi|28199123|ref|NP_779437.1| rare lipoprotein A [Xylella fastidiosa Temecula1]
 gi|182681851|ref|YP_001830011.1| rare lipoprotein A [Xylella fastidiosa M23]
 gi|28057221|gb|AAO29086.1| rare lipoprotein A [Xylella fastidiosa Temecula1]
 gi|182631961|gb|ACB92737.1| rare lipoprotein A [Xylella fastidiosa M23]
 gi|307578101|gb|ADN62070.1| rare lipoprotein A [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 417

 Score =  118 bits (296), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 88/145 (60%), Gaps = 5/145 (3%)

Query: 70  PYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY ++G+ Y V  +   Y   G+AS+YG  FHGRLT+N EVY     TAAH TLPLPS+ 
Sbjct: 108 PYVVLGKSYRVLDEAKGYIKRGVASYYGTKFHGRLTSNREVYDMYAFTAAHKTLPLPSFA 167

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM----AL 184
            +TN++NG S+VVRVNDRGP+H +RLIDLS AAA  L   E G++ V V  L       L
Sbjct: 168 LITNLDNGKSVVVRVNDRGPFHDDRLIDLSYAAAVKLGFTENGLANVEVRVLSEDDNPML 227

Query: 185 LNGMDQEYLRSTVMVNSATVLPLGC 209
           L   D+    +T    + T+ P+  
Sbjct: 228 LARHDKRIAPTTANPVATTMAPMAT 252


>gi|330445207|ref|ZP_08308859.1| rare lipoA family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489398|dbj|GAA03356.1| rare lipoA family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 292

 Score =  118 bits (296), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 78/124 (62%), Gaps = 6/124 (4%)

Query: 60  RGGGRYFLGKPYQIMG-RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAA 118
           RGG      K Y + G R+++ +    Y   G ASWYG+ FHG  T+NGE Y    +TAA
Sbjct: 82  RGGN-----KDYTLRGKRYHIIKNTKGYTETGYASWYGEKFHGHKTSNGETYNMFAMTAA 136

Query: 119 HPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           H TLPLPS+VRVTN  NG S +VRVNDRGP+H  R+IDLS AAA  + V   G + V +E
Sbjct: 137 HKTLPLPSFVRVTNTRNGKSTIVRVNDRGPFHDGRIIDLSMAAAAKIGVISLGTAPVKIE 196

Query: 179 YLGM 182
            + +
Sbjct: 197 VINV 200


>gi|218708732|ref|YP_002416353.1| RlpA-like lipoprotein [Vibrio splendidus LGP32]
 gi|218321751|emb|CAV17706.1| RlpA-like lipoprotein [Vibrio splendidus LGP32]
          Length = 280

 Score =  118 bits (296), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 57/134 (42%), Positives = 84/134 (62%), Gaps = 1/134 (0%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + G  Y + ++   +   G ASWYGK FHG LT+NGE+Y    ++AAH TLP+PSYV+
Sbjct: 79  YTLRGEDYKIVKKTEGFTEKGKASWYGKKFHGHLTSNGEIYDMYSMSAAHKTLPIPSYVK 138

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN +N  + +VR+NDRGP+H  R+IDLS AAA  L V   G + V +E + +A+    +
Sbjct: 139 VTNTDNNKTTIVRINDRGPFHEGRIIDLSYAAAYKLDVLRTGTANVEIEVITVAMPTDAN 198

Query: 190 QEYLRSTVMVNSAT 203
           ++      ++  AT
Sbjct: 199 KKAALPQFIIQVAT 212


>gi|269102003|ref|ZP_06154700.1| rare lipoprotein A precursor [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268161901|gb|EEZ40397.1| rare lipoprotein A precursor [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 289

 Score =  118 bits (296), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 62/127 (48%), Positives = 79/127 (62%), Gaps = 2/127 (1%)

Query: 58  VPRGGGRYFLG-KPYQIMG-RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYI 115
           VPR   R   G K Y + G R+++ +    +   G ASWYG  FHG  TANGE Y    +
Sbjct: 72  VPRYEPRSLAGNKDYTLRGKRYHIIKNPKGFTQTGYASWYGMKFHGHKTANGETYDIYDM 131

Query: 116 TAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKV 175
           TAAH TLP+PSYV+VTN  NG + +VRVNDRGP+H  R+IDLS AAA  L V   G + V
Sbjct: 132 TAAHKTLPIPSYVKVTNTRNGKTAIVRVNDRGPFHDGRIIDLSLAAATKLDVVNHGTAPV 191

Query: 176 HVEYLGM 182
            +E + +
Sbjct: 192 KIEVISV 198


>gi|71276308|ref|ZP_00652586.1| Rare lipoprotein A [Xylella fastidiosa Dixon]
 gi|71900284|ref|ZP_00682420.1| Rare lipoprotein A [Xylella fastidiosa Ann-1]
 gi|170730511|ref|YP_001775944.1| rare lipoprotein A [Xylella fastidiosa M12]
 gi|71162916|gb|EAO12640.1| Rare lipoprotein A [Xylella fastidiosa Dixon]
 gi|71729932|gb|EAO32027.1| Rare lipoprotein A [Xylella fastidiosa Ann-1]
 gi|167965304|gb|ACA12314.1| rare lipoprotein A [Xylella fastidiosa M12]
          Length = 415

 Score =  118 bits (296), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 77/112 (68%), Gaps = 1/112 (0%)

Query: 70  PYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY ++G+ Y V  +   Y   G+AS+YG  FHGRLT+N EVY     TAAH TLPLPS+ 
Sbjct: 108 PYVVLGKSYRVLDEAKGYIKRGVASYYGTKFHGRLTSNREVYDMYAFTAAHKTLPLPSFA 167

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            +TN++NG S+VVRVNDRGP+H +RLIDLS AAA  L   E G++ V V  L
Sbjct: 168 LITNLDNGKSVVVRVNDRGPFHDDRLIDLSYAAAVKLGFTENGLANVEVRVL 219


>gi|319785897|ref|YP_004145372.1| lipoprotein A [Pseudoxanthomonas suwonensis 11-1]
 gi|317464409|gb|ADV26141.1| rare lipoprotein A [Pseudoxanthomonas suwonensis 11-1]
          Length = 381

 Score =  118 bits (296), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 80/124 (64%), Gaps = 10/124 (8%)

Query: 67  LGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
           LGK Y++M R +       Y   G+AS+YG  FHGR T+N EVY     +AAH TLPLPS
Sbjct: 118 LGKQYKVMDRPH------GYVEQGIASYYGSKFHGRRTSNQEVYDMYTFSAAHKTLPLPS 171

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLN 186
           + RVTN++NG S+VVRVNDRGP+H  R+IDLS AAA  L +  RG  +V V     AL+ 
Sbjct: 172 FARVTNLDNGKSVVVRVNDRGPFHDGRVIDLSYAAAVKLGIVARGTGRVEVR----ALVP 227

Query: 187 GMDQ 190
           G D 
Sbjct: 228 GEDD 231


>gi|86148566|ref|ZP_01066851.1| putative rare lipoprotein A [Vibrio sp. MED222]
 gi|85833632|gb|EAQ51805.1| putative rare lipoprotein A [Vibrio sp. MED222]
          Length = 279

 Score =  118 bits (296), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 57/134 (42%), Positives = 84/134 (62%), Gaps = 1/134 (0%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + G  Y + ++   +   G ASWYGK FHG LT+NGE+Y    ++AAH TLP+PSYV+
Sbjct: 78  YTLRGEDYKIVKKTEGFTEKGKASWYGKKFHGHLTSNGEIYDMYSMSAAHKTLPIPSYVK 137

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN +N  + +VR+NDRGP+H  R+IDLS AAA  L V   G + V +E + +A+    +
Sbjct: 138 VTNTDNNKTTIVRINDRGPFHEGRIIDLSYAAAYKLDVLRTGTANVEIEVITVAMPTDAN 197

Query: 190 QEYLRSTVMVNSAT 203
           ++      ++  AT
Sbjct: 198 KKAALPQFIIQVAT 211


>gi|117924768|ref|YP_865385.1| lipoprotein A [Magnetococcus sp. MC-1]
 gi|117608524|gb|ABK43979.1| rare lipoprotein A [Magnetococcus sp. MC-1]
          Length = 282

 Score =  118 bits (296), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 86/139 (61%), Gaps = 2/139 (1%)

Query: 67  LGKPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLP 125
           +G+PY I G  Y P      Y AVG+ASWYG  FHG+ TANGE++    +TAAH TLPLP
Sbjct: 39  VGEPYSIEGITYRPVPTARGYDAVGVASWYGSQFHGKPTANGEIFDMHAMTAAHKTLPLP 98

Query: 126 SYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL-GMAL 184
           S  +VTN+ NG  ++VR+NDRGP+  +RLID+S  AA+ L    +G +KV ++ L G   
Sbjct: 99  SIAQVTNLSNGRRVIVRINDRGPFVGDRLIDMSYEAARRLGFAVQGTTKVRIQALSGEPK 158

Query: 185 LNGMDQEYLRSTVMVNSAT 203
           L    Q+    T   + AT
Sbjct: 159 LQHEPQDMQVPTEAAHPAT 177


>gi|293609653|ref|ZP_06691955.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828105|gb|EFF86468.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 203

 Score =  118 bits (296), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 52/93 (55%), Positives = 70/93 (75%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           ++  GMASWYG+ FHGR TA+GE +    +TAAH +LPL  Y+RVTN +NG S+VV+VND
Sbjct: 104 FSQTGMASWYGRQFHGRKTASGETFDMNALTAAHRSLPLNCYIRVTNKDNGKSVVVKVND 163

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           RGP+H NR++DLS  AAK L +   G +KV++E
Sbjct: 164 RGPFHGNRVLDLSYGAAKRLGITNAGTAKVNIE 196


>gi|205355496|ref|ZP_03222267.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni CG8421]
 gi|205346730|gb|EDZ33362.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni CG8421]
          Length = 275

 Score =  118 bits (296), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 96/182 (52%), Gaps = 18/182 (9%)

Query: 10  LKGSVVCVVVLGMSSC----FFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRY 65
           LK S V +  L  S C    FFSS   D+   Y+P + +           K  P   G  
Sbjct: 8   LKLSAVSLGALFFSGCLGTSFFSSL--DNAQVYYPSNDF-----------KSSPSSSGTK 54

Query: 66  FLGKPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
              KPY I G+ Y P        A G+ASWYG  FHG+ T+NGE Y    +TAAH TLP+
Sbjct: 55  GTMKPYTINGKTYYPTVVAVGETADGIASWYGPGFHGKKTSNGETYNQNALTAAHKTLPM 114

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMAL 184
            + ++VTN+ N   + VRVNDRGP+ +NR+IDLS  AA  + +   G++ V +E +G   
Sbjct: 115 NTILKVTNLNNNRQVTVRVNDRGPFVNNRIIDLSKGAASQIDMIASGIAPVRLEVIGFGS 174

Query: 185 LN 186
            N
Sbjct: 175 SN 176


>gi|323495454|ref|ZP_08100531.1| putative rare lipoprotein A [Vibrio brasiliensis LMG 20546]
 gi|323310377|gb|EGA63564.1| putative rare lipoprotein A [Vibrio brasiliensis LMG 20546]
          Length = 260

 Score =  118 bits (296), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 103/176 (58%), Gaps = 10/176 (5%)

Query: 65  YFLG--KPYQIMG-RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPT 121
           Y LG    Y + G R+ + +    +   G+ASWYGK FHG LT+NGEVY    ++AAH  
Sbjct: 55  YSLGGNSDYTLRGNRYTIIKDPQGFKEEGIASWYGKKFHGHLTSNGEVYDMYSMSAAHKE 114

Query: 122 LPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           LP+PSYV+VTN +NG + +VRVNDRGP+H  R+IDLS AAA  L V + G + V +E + 
Sbjct: 115 LPIPSYVKVTNKDNGKTAIVRVNDRGPFHPGRIIDLSYAAATKLDVIKTGTANVAIEVIT 174

Query: 182 MALLNGMDQEYLRSTVMVNSATVLPLGCQYREEIVVIPYLLTRSRTV--HLNNCDD 235
           +       ++   S   V  A+      Q+++ +  +   L++  +V  ++N+ +D
Sbjct: 175 VDKPTQTHKQEALSKFAVQVAS-----SQHQDRVETLAQDLSQKLSVKSYVNSTND 225


>gi|89074974|ref|ZP_01161419.1| hypothetical rare lipoprotein A [Photobacterium sp. SKA34]
 gi|89049213|gb|EAR54777.1| hypothetical rare lipoprotein A [Photobacterium sp. SKA34]
          Length = 292

 Score =  118 bits (296), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 78/124 (62%), Gaps = 6/124 (4%)

Query: 60  RGGGRYFLGKPYQIMG-RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAA 118
           RGG      K Y + G R+++ +    Y   G ASWYG+ FHG  T+NGE Y    +TAA
Sbjct: 82  RGGN-----KDYTLRGKRYHIIKNTKGYTETGYASWYGEKFHGHKTSNGETYNMFAMTAA 136

Query: 119 HPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           H TLPLPS+VRVTN  NG S +VRVNDRGP+H  R+IDLS AAA  + V   G + V +E
Sbjct: 137 HKTLPLPSFVRVTNTLNGKSTIVRVNDRGPFHDGRIIDLSMAAAAKIGVISLGTAPVKIE 196

Query: 179 YLGM 182
            + +
Sbjct: 197 VINI 200


>gi|255065470|ref|ZP_05317325.1| RlpA family protein [Neisseria sicca ATCC 29256]
 gi|255050295|gb|EET45759.1| RlpA family protein [Neisseria sicca ATCC 29256]
          Length = 188

 Score =  118 bits (296), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 53/95 (55%), Positives = 69/95 (72%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           ++  G ASWYG  FHGR T++GE Y    +TAAH TLP+PSY RVTN +NG S++VRVND
Sbjct: 7   FSQTGNASWYGSQFHGRKTSSGERYNMNALTAAHKTLPIPSYARVTNTKNGKSVIVRVND 66

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+H NR+ID+S AAA+ L    +G + V VE +
Sbjct: 67  RGPFHGNRVIDVSKAAAQQLGFINQGTAHVKVEQI 101


>gi|114561879|ref|YP_749392.1| rare lipoprotein A [Shewanella frigidimarina NCIMB 400]
 gi|114333172|gb|ABI70554.1| rare lipoprotein A [Shewanella frigidimarina NCIMB 400]
          Length = 270

 Score =  118 bits (296), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 60/121 (49%), Positives = 77/121 (63%), Gaps = 8/121 (6%)

Query: 60  RGGGRYF--LGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITA 117
           R G R +  LGK YQ++           +   G ASWYG  FHG LT+NGE Y    ++A
Sbjct: 66  RQGNRNYTVLGKSYQVLDSG------KGFKEQGHASWYGSKFHGHLTSNGETYDMYTMSA 119

Query: 118 AHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           AH  LPLPSYV+VTN++N   ++VRVNDRGP+H  R+IDLS AAA  L +  RG +KV +
Sbjct: 120 AHKNLPLPSYVKVTNLDNNKQIIVRVNDRGPFHHGRVIDLSYAAAYHLGMLARGTAKVAI 179

Query: 178 E 178
           E
Sbjct: 180 E 180


>gi|325122874|gb|ADY82397.1| putative lipoprotein precursor (RlpA-like) [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 187

 Score =  118 bits (295), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 52/93 (55%), Positives = 70/93 (75%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           ++  GMASWYG+ FHGR TA+GE +    +TAAH +LPL  Y+RVTN +NG S+VV+VND
Sbjct: 88  FSQTGMASWYGRQFHGRKTASGETFDMNALTAAHRSLPLNCYIRVTNKDNGKSVVVKVND 147

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           RGP+H NR++DLS  AAK L +   G +KV++E
Sbjct: 148 RGPFHGNRVLDLSYGAAKRLGITNAGTAKVNIE 180


>gi|313143412|ref|ZP_07805605.1| rare lipoprotein A [Helicobacter cinaedi CCUG 18818]
 gi|313128443|gb|EFR46060.1| rare lipoprotein A [Helicobacter cinaedi CCUG 18818]
          Length = 304

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 54/116 (46%), Positives = 76/116 (65%), Gaps = 1/116 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+ G+WY P + +      G ASWYG  FH + T+NGE Y     TAAH T P+ + 
Sbjct: 79  RPYQVAGKWYYPEKVSLGDKFDGYASWYGADFHAKKTSNGETYNMHAHTAAHKTFPINTV 138

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           V+V N+ENG S +VR+NDRGP+   R+IDLSNAAA+ + + + G +KV +E +G  
Sbjct: 139 VKVLNVENGKSTIVRINDRGPFVEGRIIDLSNAAAEDIDMVKVGTAKVRLEIIGFG 194


>gi|224436940|ref|ZP_03657921.1| rare lipoprotein A [Helicobacter cinaedi CCUG 18818]
          Length = 297

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 54/116 (46%), Positives = 76/116 (65%), Gaps = 1/116 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+ G+WY P + +      G ASWYG  FH + T+NGE Y     TAAH T P+ + 
Sbjct: 72  RPYQVAGKWYYPEKVSLGDKFDGYASWYGADFHAKKTSNGETYNMHAHTAAHKTFPINTV 131

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           V+V N+ENG S +VR+NDRGP+   R+IDLSNAAA+ + + + G +KV +E +G  
Sbjct: 132 VKVLNVENGKSTIVRINDRGPFVEGRIIDLSNAAAEDIDMVKVGTAKVRLEIIGFG 187


>gi|224826041|ref|ZP_03699144.1| rare lipoprotein A [Lutiella nitroferrum 2002]
 gi|224601678|gb|EEG07858.1| rare lipoprotein A [Lutiella nitroferrum 2002]
          Length = 285

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/110 (52%), Positives = 74/110 (67%), Gaps = 1/110 (0%)

Query: 70  PYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY  +G  + P      Y A G ASWYGK FHGR T +GE Y    +TAAHPTLP+PSY 
Sbjct: 77  PYSALGMSFHPDTSDKPYEAKGRASWYGKQFHGRHTTSGEPYDMYAMTAAHPTLPIPSYA 136

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           RVTN++NG +++VR+NDRGP+H  RL+DLS AAA  L    +G + + VE
Sbjct: 137 RVTNLKNGKAVIVRINDRGPFHRGRLMDLSYAAAYKLGFVHQGSAPIKVE 186


>gi|90581615|ref|ZP_01237406.1| hypothetical rare lipoprotein A [Vibrio angustum S14]
 gi|90437198|gb|EAS62398.1| hypothetical rare lipoprotein A [Vibrio angustum S14]
          Length = 292

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 75/116 (64%), Gaps = 1/116 (0%)

Query: 68  GKPYQIMG-RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
            K Y + G R+++ +    Y   G ASWYG+ FHG  T+NGE Y    +TAAH TLPLPS
Sbjct: 85  NKDYTLRGKRYHIIKNTKGYTETGYASWYGEKFHGHKTSNGETYNMFAMTAAHKTLPLPS 144

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           +VRVTN  NG S +VRVNDRGP+H  R+IDLS AAA  + V   G + V +E + +
Sbjct: 145 FVRVTNTLNGKSTIVRVNDRGPFHDGRIIDLSMAAAAKIGVISLGTAPVKIEVINI 200


>gi|71905753|ref|YP_283340.1| rare lipoprotein A [Dechloromonas aromatica RCB]
 gi|71845374|gb|AAZ44870.1| Rare lipoprotein A [Dechloromonas aromatica RCB]
          Length = 333

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 65/136 (47%), Positives = 86/136 (63%), Gaps = 1/136 (0%)

Query: 69  KPYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY ++G+ YVP      Y A G+ASWYGK FHG+ T+ GE Y    +TAAHP+L LPSY
Sbjct: 88  KPYVVLGKEYVPNTTVKPYKARGIASWYGKKFHGQKTSIGEPYDMFAMTAAHPSLALPSY 147

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
           VRVT++++G S+VVR+ DRGP+H++R+IDLS  AA  L +   G  +V VE +    L G
Sbjct: 148 VRVTSVQSGKSVVVRITDRGPFHADRVIDLSYTAAYKLGLINGGSGQVEVEAIIPGDLAG 207

Query: 188 MDQEYLRSTVMVNSAT 203
                  S   V S T
Sbjct: 208 TTYAQTTSPPRVTSTT 223


>gi|289165101|ref|YP_003455239.1| rare lipoprotein A [Legionella longbeachae NSW150]
 gi|288858274|emb|CBJ12142.1| putative rare lipoprotein A [Legionella longbeachae NSW150]
          Length = 281

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/119 (49%), Positives = 78/119 (65%), Gaps = 1/119 (0%)

Query: 64  RYFLGKPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTL 122
           RY     Y + GR Y V R  + Y   G+ASWYG  FH + T++GE Y    +TAAH TL
Sbjct: 86  RYGNPSEYSVDGRSYQVMRNSSGYKTRGVASWYGTKFHKQRTSSGEPYNMYVMTAAHKTL 145

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           PLP+Y++V N++NG   +V+VNDRGP+HSNR+IDLS AAA  L V  +G + V +E L 
Sbjct: 146 PLPTYIKVKNLDNGKEAIVKVNDRGPFHSNRIIDLSYAAALKLGVFPKGTANVEIETLA 204


>gi|169632961|ref|YP_001706697.1| rare lipoprotein A family protein [Acinetobacter baumannii SDF]
 gi|184158838|ref|YP_001847177.1| lipoprotein [Acinetobacter baumannii ACICU]
 gi|239502451|ref|ZP_04661761.1| lipoprotein [Acinetobacter baumannii AB900]
 gi|260556761|ref|ZP_05828979.1| rare lipoprotein A family protein [Acinetobacter baumannii ATCC
           19606]
 gi|332875264|ref|ZP_08443096.1| putative rare lipoprotein A double-psi beta-barrel protein
           [Acinetobacter baumannii 6014059]
 gi|169151753|emb|CAP00559.1| putative rare lipoprotein A family (RlpA-like) [Acinetobacter
           baumannii]
 gi|183210432|gb|ACC57830.1| Lipoprotein [Acinetobacter baumannii ACICU]
 gi|193077862|gb|ABO12739.2| putative lipoprotein precursor (RlpA-like) [Acinetobacter baumannii
           ATCC 17978]
 gi|260410020|gb|EEX03320.1| rare lipoprotein A family protein [Acinetobacter baumannii ATCC
           19606]
 gi|332736521|gb|EGJ67516.1| putative rare lipoprotein A double-psi beta-barrel protein
           [Acinetobacter baumannii 6014059]
          Length = 205

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 52/93 (55%), Positives = 69/93 (74%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           ++  GMASWYG+ FHGR TA+GE +    +TAAH +LPL  Y+RVTN +NG S+VV+VND
Sbjct: 106 FSQTGMASWYGRQFHGRKTASGETFDMNALTAAHRSLPLNCYIRVTNKDNGKSVVVKVND 165

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           RGP+H NR++DLS  AAK L +   G +KV +E
Sbjct: 166 RGPFHGNRVLDLSYGAAKRLGITNAGTAKVSIE 198


>gi|169795297|ref|YP_001713090.1| rare lipoprotein A family protein [Acinetobacter baumannii AYE]
 gi|213158039|ref|YP_002320090.1| rare lipoprotein A [Acinetobacter baumannii AB0057]
 gi|215482829|ref|YP_002325032.1| rare lipoprotein A family protein [Acinetobacter baumannii
           AB307-0294]
 gi|301345529|ref|ZP_07226270.1| rare lipoprotein A [Acinetobacter baumannii AB056]
 gi|301511310|ref|ZP_07236547.1| rare lipoprotein A [Acinetobacter baumannii AB058]
 gi|301594804|ref|ZP_07239812.1| rare lipoprotein A [Acinetobacter baumannii AB059]
 gi|332850405|ref|ZP_08432725.1| putative rare lipoprotein A double-psi beta-barrel protein
           [Acinetobacter baumannii 6013150]
 gi|332871843|ref|ZP_08440266.1| putative rare lipoprotein A double-psi beta-barrel protein
           [Acinetobacter baumannii 6013113]
 gi|169148224|emb|CAM86087.1| putative rare lipoprotein A family (RlpA-like) [Acinetobacter
           baumannii AYE]
 gi|213057199|gb|ACJ42101.1| rare lipoprotein A [Acinetobacter baumannii AB0057]
 gi|213988606|gb|ACJ58905.1| rare lipoprotein A family protein [Acinetobacter baumannii
           AB307-0294]
 gi|332730676|gb|EGJ61987.1| putative rare lipoprotein A double-psi beta-barrel protein
           [Acinetobacter baumannii 6013150]
 gi|332731172|gb|EGJ62472.1| putative rare lipoprotein A double-psi beta-barrel protein
           [Acinetobacter baumannii 6013113]
          Length = 205

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 52/93 (55%), Positives = 69/93 (74%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           ++  GMASWYG+ FHGR TA+GE +    +TAAH +LPL  Y+RVTN +NG S+VV+VND
Sbjct: 106 FSQTGMASWYGRQFHGRKTASGETFDMNALTAAHRSLPLNCYIRVTNKDNGKSVVVKVND 165

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           RGP+H NR++DLS  AAK L +   G +KV +E
Sbjct: 166 RGPFHGNRVLDLSYGAAKRLGITNAGTAKVSIE 198


>gi|270160122|ref|ZP_06188778.1| rare lipoprotein A [Legionella longbeachae D-4968]
 gi|269988461|gb|EEZ94716.1| rare lipoprotein A [Legionella longbeachae D-4968]
          Length = 278

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/119 (49%), Positives = 78/119 (65%), Gaps = 1/119 (0%)

Query: 64  RYFLGKPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTL 122
           RY     Y + GR Y V R  + Y   G+ASWYG  FH + T++GE Y    +TAAH TL
Sbjct: 83  RYGNPSEYSVDGRSYQVMRNSSGYKTRGVASWYGTKFHKQRTSSGEPYNMYVMTAAHKTL 142

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           PLP+Y++V N++NG   +V+VNDRGP+HSNR+IDLS AAA  L V  +G + V +E L 
Sbjct: 143 PLPTYIKVKNLDNGKEAIVKVNDRGPFHSNRIIDLSYAAALKLGVFPKGTANVEIETLA 201


>gi|241761933|ref|ZP_04760018.1| rare lipoprotein A [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|241373613|gb|EER63185.1| rare lipoprotein A [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 166

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/112 (53%), Positives = 75/112 (66%)

Query: 69  KPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           +PY + G  YVP+   +Y  VG ASWYG  F G  TA GE +    I+AAH TLPLP YV
Sbjct: 55  RPYTVGGVTYVPKDDPSYNEVGYASWYGDDFAGHPTAIGEKFSPNAISAAHKTLPLPCYV 114

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            VTN+E G  LVVRVNDRGP+   R+IDLS  AA+ L +E++G +KV V+ L
Sbjct: 115 EVTNLETGRRLVVRVNDRGPFVQGRIIDLSRGAARALGIEKKGTAKVRVKRL 166


>gi|57236959|ref|YP_178760.1| rare lipoprotein A [Campylobacter jejuni RM1221]
 gi|86149873|ref|ZP_01068102.1| rare lipoprotein A [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|86153507|ref|ZP_01071711.1| rare lipoprotein a [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|88597142|ref|ZP_01100378.1| rare lipoprotein A [Campylobacter jejuni subsp. jejuni 84-25]
 gi|153952168|ref|YP_001398396.1| rare lipoprotein A [Campylobacter jejuni subsp. doylei 269.97]
 gi|157414925|ref|YP_001482181.1| rare lipoprotein A [Campylobacter jejuni subsp. jejuni 81116]
 gi|167005292|ref|ZP_02271050.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni 81-176]
 gi|218562296|ref|YP_002344075.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni NCTC
           11168]
 gi|20139822|sp|Q9PHM1|RLPA_CAMJE RecName: Full=RlpA-like lipoprotein; Flags: Precursor
 gi|57165763|gb|AAW34542.1| rare lipoprotein A [Campylobacter jejuni RM1221]
 gi|85839691|gb|EAQ56951.1| rare lipoprotein A [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|85843233|gb|EAQ60444.1| rare lipoprotein a [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|88190831|gb|EAQ94804.1| rare lipoprotein A [Campylobacter jejuni subsp. jejuni 84-25]
 gi|112360002|emb|CAL34791.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni NCTC
           11168]
 gi|152939614|gb|ABS44355.1| rare lipoprotein A [Campylobacter jejuni subsp. doylei 269.97]
 gi|157385889|gb|ABV52204.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni 81116]
 gi|284925906|gb|ADC28258.1| rare lipoprotein A [Campylobacter jejuni subsp. jejuni IA3902]
 gi|307747563|gb|ADN90833.1| RlpA-like lipoprotein [Campylobacter jejuni subsp. jejuni M1]
 gi|315058060|gb|ADT72389.1| RlpA-like lipoprotein precursor [Campylobacter jejuni subsp. jejuni
           S3]
          Length = 275

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 95/182 (52%), Gaps = 18/182 (9%)

Query: 10  LKGSVVCVVVLGMSSC----FFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRY 65
           LK S V +  L  S C    FFSS   D+   Y+P + +           K  P   G  
Sbjct: 8   LKLSAVSLGALFFSGCLGTSFFSSL--DNAQVYYPSNDF-----------KSSPSSSGTK 54

Query: 66  FLGKPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
              KPY I G+ Y P        A G+ASWYG  FHG+ T+NGE Y    +TAAH TLP+
Sbjct: 55  GTMKPYTINGKTYYPTVVAVGETADGIASWYGPGFHGKKTSNGETYNQNALTAAHKTLPM 114

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMAL 184
            + ++VTN+ N   + VRVNDRGP+ +NR+IDLS  AA  + +   G + V +E +G   
Sbjct: 115 NTILKVTNLNNNRQVTVRVNDRGPFVNNRIIDLSKGAASQIDMIASGTAPVRLEVIGFGS 174

Query: 185 LN 186
            N
Sbjct: 175 SN 176


>gi|71278428|ref|YP_268451.1| putative rare lipoprotein A [Colwellia psychrerythraea 34H]
 gi|71144168|gb|AAZ24641.1| putative rare lipoprotein A [Colwellia psychrerythraea 34H]
          Length = 293

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 82/130 (63%), Gaps = 8/130 (6%)

Query: 50  DRIVSGKRVPRGGGRYF--LGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANG 107
           D +   +   RGG + +   GKPY+++           +   G ASWYGK FHG LT+NG
Sbjct: 44  DALARAEPHSRGGNKDYRVFGKPYKVLASA------QGFEQTGTASWYGKKFHGHLTSNG 97

Query: 108 EVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRV 167
           E+Y    ++AAH  LPLP+Y++VTN  N  S++VRVNDRGP+H +R+IDLS +AA  L +
Sbjct: 98  EIYDMYTMSAAHKNLPLPTYLKVTNTANNKSVIVRVNDRGPFHQSRIIDLSYSAAYKLDM 157

Query: 168 EERGVSKVHV 177
            + G ++V +
Sbjct: 158 LKTGTAQVKI 167


>gi|315928943|gb|EFV08197.1| rare lipoprotein A [Campylobacter jejuni subsp. jejuni 305]
          Length = 276

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 95/182 (52%), Gaps = 18/182 (9%)

Query: 10  LKGSVVCVVVLGMSSC----FFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRY 65
           LK S V +  L  S C    FFSS   D+   Y+P + +           K  P   G  
Sbjct: 9   LKLSAVSLGALFFSGCLGTSFFSSL--DNAQVYYPSNDF-----------KSSPSSSGTK 55

Query: 66  FLGKPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
              KPY I G+ Y P        A G+ASWYG  FHG+ T+NGE Y    +TAAH TLP+
Sbjct: 56  GTMKPYTINGKTYYPTVVAVGETADGIASWYGPGFHGKKTSNGETYNQNALTAAHKTLPM 115

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMAL 184
            + ++VTN+ N   + VRVNDRGP+ +NR+IDLS  AA  + +   G + V +E +G   
Sbjct: 116 NTILKVTNLNNNRQVTVRVNDRGPFVNNRIIDLSKGAASQIDMIASGTAPVRLEVIGFGS 175

Query: 185 LN 186
            N
Sbjct: 176 SN 177


>gi|126642357|ref|YP_001085341.1| putative lipoprotein precursor (RlpA-like) [Acinetobacter baumannii
           ATCC 17978]
 gi|322507350|gb|ADX02804.1| Putative rare lipoprotein A family [Acinetobacter baumannii 1656-2]
 gi|323518752|gb|ADX93133.1| lipoprotein [Acinetobacter baumannii TCDC-AB0715]
          Length = 189

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 52/93 (55%), Positives = 69/93 (74%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           ++  GMASWYG+ FHGR TA+GE +    +TAAH +LPL  Y+RVTN +NG S+VV+VND
Sbjct: 90  FSQTGMASWYGRQFHGRKTASGETFDMNALTAAHRSLPLNCYIRVTNKDNGKSVVVKVND 149

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           RGP+H NR++DLS  AAK L +   G +KV +E
Sbjct: 150 RGPFHGNRVLDLSYGAAKRLGITNAGTAKVSIE 182


>gi|217033817|ref|ZP_03439242.1| hypothetical protein HP9810_877g21 [Helicobacter pylori 98-10]
 gi|216943715|gb|EEC23158.1| hypothetical protein HP9810_877g21 [Helicobacter pylori 98-10]
          Length = 315

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 88/138 (63%), Gaps = 4/138 (2%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+  +WY P +        G+ASWYG +FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 96  RPYQVGNKWYYPTKVDLGEKFDGIASWYGPSFHAKKTSNGEIYNMYAHTAAHKTLPMNTV 155

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
           V+V N+EN +S +VR+NDRGP+ S+R+IDLSNAAA+ + + ++G + V +  LG     G
Sbjct: 156 VKVINVENNLSTIVRINDRGPFVSDRIIDLSNAAARDIDMIKKGTASVRLIVLGFG---G 212

Query: 188 MDQEYLRSTVMVNSATVL 205
           +  +    +   NS+ +L
Sbjct: 213 VISKQYEQSFNANSSKIL 230


>gi|299769332|ref|YP_003731358.1| rare lipoprotein A [Acinetobacter sp. DR1]
 gi|298699420|gb|ADI89985.1| rare lipoprotein A [Acinetobacter sp. DR1]
          Length = 203

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 51/93 (54%), Positives = 70/93 (75%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           ++  GMASWYG+ FHGR TA+G+ +    +TAAH +LPL  Y+RVTN +NG S+VV+VND
Sbjct: 104 FSQTGMASWYGRQFHGRKTASGDTFDMNALTAAHRSLPLNCYIRVTNKDNGKSVVVKVND 163

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           RGP+H NR++DLS  AAK L +   G +KV++E
Sbjct: 164 RGPFHGNRVLDLSYGAAKRLGITNAGTAKVNIE 196


>gi|262278383|ref|ZP_06056168.1| rare lipoprotein A family protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262258734|gb|EEY77467.1| rare lipoprotein A family protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 203

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 51/93 (54%), Positives = 70/93 (75%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           ++  GMASWYG+ FHGR TA+G+ +    +TAAH +LPL  Y+RVTN +NG S+VV+VND
Sbjct: 104 FSQTGMASWYGRQFHGRKTASGDTFDMNALTAAHRSLPLNCYIRVTNKDNGKSVVVKVND 163

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           RGP+H NR++DLS  AAK L +   G +KV++E
Sbjct: 164 RGPFHGNRVLDLSYGAAKRLGITNAGTAKVNIE 196


>gi|209694546|ref|YP_002262474.1| rare lipoprotein A [Aliivibrio salmonicida LFI1238]
 gi|208008497|emb|CAQ78668.1| rare lipoprotein A [Aliivibrio salmonicida LFI1238]
          Length = 269

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 77/116 (66%), Gaps = 1/116 (0%)

Query: 68  GKPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
            K Y ++G+ Y + R    +   G +SWYG  FHG  T+NGE+Y    ++AAH TLP+PS
Sbjct: 64  NKDYTLLGKDYPIVRDPKGFKQEGKSSWYGNKFHGHKTSNGEIYDMYSMSAAHKTLPIPS 123

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           YV+V N +NG + +VRVNDRGP+H  R+IDLS AAA  L V + G + V +EY+ +
Sbjct: 124 YVKVINKDNGKTAIVRVNDRGPFHEGRIIDLSFAAATKLDVIKTGTANVKIEYISI 179


>gi|207092006|ref|ZP_03239793.1| rare lipoprotein A [Helicobacter pylori HPKX_438_AG0C1]
          Length = 314

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 79/115 (68%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+ G+WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 95  RPYQVGGKWYYPTKVDLGEKFDGIASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTV 154

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           V+V N++N +S +VR+NDRGP+ S+R+IDLSNAAA+ + + ++G + V +  LG 
Sbjct: 155 VKVINVDNNLSTIVRINDRGPFVSDRIIDLSNAAARDIDMVQKGTASVRLIVLGF 209


>gi|323499953|ref|ZP_08104911.1| putative rare lipoprotein A [Vibrio sinaloensis DSM 21326]
 gi|323314970|gb|EGA68023.1| putative rare lipoprotein A [Vibrio sinaloensis DSM 21326]
          Length = 259

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 75/119 (63%), Gaps = 3/119 (2%)

Query: 65  YFLG--KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPT 121
           Y LG  K Y + G  Y + +    +   G ASWYGK FHG LT+NGEVY    ++AAH T
Sbjct: 54  YSLGGNKDYTLRGADYKIVKDAKGFTEQGQASWYGKKFHGHLTSNGEVYDMYSMSAAHKT 113

Query: 122 LPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           LPLPSYV VTN +NG   +VRVNDRGP+H  R+IDLS AAA  L V   G + V +  L
Sbjct: 114 LPLPSYVEVTNKDNGRKAIVRVNDRGPFHPGRVIDLSYAAATKLDVVRTGTANVSIRVL 172


>gi|312882710|ref|ZP_07742447.1| putative rare lipoprotein A [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309369671|gb|EFP97186.1| putative rare lipoprotein A [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 260

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 76/111 (68%), Gaps = 1/111 (0%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G+ Y + +    +   G ASWYGK FHG LT+NGE+Y    ++AAH  LP+PSYV+
Sbjct: 63  YKLRGKSYTIIKSPQGFKQKGTASWYGKKFHGHLTSNGEIYDMYSMSAAHKELPIPSYVK 122

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VTN +NG + +VRVNDRGP+H  R+IDLS AAA  L V + G + V +E +
Sbjct: 123 VTNEDNGKTAIVRVNDRGPFHEGRIIDLSYAAATKLGVVKTGTANVSIEVI 173


>gi|148926630|ref|ZP_01810311.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni CG8486]
 gi|145845149|gb|EDK22244.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni CG8486]
          Length = 275

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 95/182 (52%), Gaps = 18/182 (9%)

Query: 10  LKGSVVCVVVLGMSSC----FFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRY 65
           LK S V +  L  S C    FFSS   D+   Y+P + +           K  P   G  
Sbjct: 8   LKLSAVSLGALFFSGCLGTSFFSSL--DNAQVYYPSNDF-----------KSSPSSSGTK 54

Query: 66  FLGKPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
              KPY I G+ Y P        A G+ASWYG  FHG+ T+NGE Y    +TAAH TLP+
Sbjct: 55  GTMKPYTINGKTYYPTVVAVGETADGIASWYGPGFHGKKTSNGETYNQNALTAAHKTLPM 114

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMAL 184
            + ++VTN+ N   + VRVNDRGP+ +NR+IDLS  AA  + +   G + V +E +G   
Sbjct: 115 NTILKVTNLNNNRQVTVRVNDRGPFVNNRIIDLSKGAASQIDMIASGTAPVRLEVIGFGS 174

Query: 185 LN 186
            N
Sbjct: 175 SN 176


>gi|291612613|ref|YP_003522770.1| rare lipoprotein A [Sideroxydans lithotrophicus ES-1]
 gi|291582725|gb|ADE10383.1| rare lipoprotein A [Sideroxydans lithotrophicus ES-1]
          Length = 323

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 80/118 (67%), Gaps = 1/118 (0%)

Query: 66  FLGKPYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +  +PY  +G+ Y P Q    Y   G+ASWYGK F+G+ T+ GE+Y    +TAAHPTLP+
Sbjct: 89  YANRPYSALGKTYTPMQVPGNYKQRGIASWYGKKFNGQRTSIGEIYDMYGMTAAHPTLPI 148

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           PSY RVTN+ NG S+VVR+NDRGP+  +R++DLS AAA  L     G ++V VE + +
Sbjct: 149 PSYARVTNIANGKSVVVRINDRGPFLHDRIMDLSYAAAYKLGFINSGSAEVEVESIAV 206


>gi|94264339|ref|ZP_01288131.1| Rare lipoprotein A:Sporulation related [delta proteobacterium
           MLMS-1]
 gi|93455233|gb|EAT05446.1| Rare lipoprotein A:Sporulation related [delta proteobacterium
           MLMS-1]
          Length = 268

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 85/132 (64%), Gaps = 4/132 (3%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQI G+ Y P      ++  G+ASWYG  FHGR T+NGE+Y    +TAAH TLP+ ++
Sbjct: 56  RPYQIKGKTYYPIPSAHGFSETGIASWYGAKFHGRRTSNGEIYDMHAMTAAHKTLPMNTH 115

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA---L 184
           + VTN+ENG  + VR+NDRGP+   R+IDLS   A+ L + E+G+++V +  LG     +
Sbjct: 116 LLVTNLENGKEITVRINDRGPFIRGRIIDLSYRGAQKLGMAEQGLARVQITALGQTERYV 175

Query: 185 LNGMDQEYLRST 196
            +G D+    +T
Sbjct: 176 EDGRDKRRFTAT 187


>gi|208435450|ref|YP_002267116.1| rare lipoprotein A [Helicobacter pylori G27]
 gi|208433379|gb|ACI28250.1| rare lipoprotein A [Helicobacter pylori G27]
          Length = 315

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 54/115 (46%), Positives = 79/115 (68%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+ G+WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 96  RPYQVGGKWYYPTKVDLGEKFDGVASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTV 155

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           V+V N+EN +S +VR+NDRGP+ S+R+IDLSNAAA+ + + ++G + V +  LG 
Sbjct: 156 VKVINVENNLSTIVRINDRGPFVSDRIIDLSNAAARDIDMVKKGTASVRLIVLGF 210


>gi|317013386|gb|ADU83994.1| rare lipoprotein A [Helicobacter pylori Lithuania75]
          Length = 314

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 54/116 (46%), Positives = 79/116 (68%), Gaps = 1/116 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+ G+WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 95  RPYQVGGKWYYPTKVDLGEKFDGIASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPINTV 154

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           V+V N+EN +S +VR+NDRGP+ S+R+IDLSNAAA+ + + ++G + V +  LG  
Sbjct: 155 VKVINVENHLSTIVRINDRGPFVSDRIIDLSNAAARDIDMVKKGTASVRLIVLGFG 210


>gi|285017608|ref|YP_003375319.1| hypothetical protein XALc_0813 [Xanthomonas albilineans GPE PC73]
 gi|283472826|emb|CBA15331.1| conserved hypothetical protein [Xanthomonas albilineans]
          Length = 478

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 63/120 (52%), Positives = 78/120 (65%), Gaps = 3/120 (2%)

Query: 64  RYFLGK--PYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHP 120
           R  +G   PY ++GR Y V     +Y   G AS+YG  FHGRLT+N EVY     TAAH 
Sbjct: 103 RSLIGNRSPYMVLGRAYTVIDDPHSYVERGTASYYGNKFHGRLTSNREVYDMYAFTAAHK 162

Query: 121 TLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           TLPLPS+  VTN++NG S+VVR+NDRGP+H +RLIDLS AAA  L +   G  +V V  L
Sbjct: 163 TLPLPSFALVTNLDNGASVVVRINDRGPFHDDRLIDLSYAAAVKLGITGNGTGRVEVRGL 222


>gi|332286590|ref|YP_004418501.1| lipoprotein [Pusillimonas sp. T7-7]
 gi|330430543|gb|AEC21877.1| lipoprotein [Pusillimonas sp. T7-7]
          Length = 327

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 74/113 (65%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY + G+ YVP      +   G ASWYG+ FHG  TANGE Y    +TAAHPTLPLPSY
Sbjct: 68  RPYVVFGKRYVPVSDEKPFRQQGTASWYGRKFHGNKTANGETYDMYAMTAAHPTLPLPSY 127

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            RVT    G S++VR+NDRGP+HS+R+IDLS  AA  L +   G  +V VE +
Sbjct: 128 ARVTRATTGKSVIVRINDRGPFHSSRIIDLSYVAAAKLGLIGPGSGQVIVEAI 180


>gi|119775723|ref|YP_928463.1| rare lipoprotein A [Shewanella amazonensis SB2B]
 gi|119768223|gb|ABM00794.1| rare lipoprotein A [Shewanella amazonensis SB2B]
          Length = 278

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 67/146 (45%), Positives = 89/146 (60%), Gaps = 7/146 (4%)

Query: 35  KLEYFPESMYGVT-ASDRIVSGKRVPRGGGRYFLGKPYQIMGRWY-VPRQYTAYAAVGMA 92
           K + +P+S   V+   D I   +   RGG      KPY +MG+ Y V      +   G+A
Sbjct: 44  KHDAYPDSAPDVSQVPDAIPRYEPYSRGGN-----KPYTVMGKSYNVLASAANFRESGLA 98

Query: 93  SWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSN 152
           SWYG  FHG  T+NGEVY    +TAAH TLPLPS+VRV N++N   ++VRVNDRGP+H  
Sbjct: 99  SWYGTKFHGYHTSNGEVYDMYSMTAAHKTLPLPSFVRVRNLDNKKEVIVRVNDRGPFHEG 158

Query: 153 RLIDLSNAAAKILRVEERGVSKVHVE 178
           R+IDLS AAA  L +   G ++V +E
Sbjct: 159 RIIDLSYAAAYRLGMLNTGTARVEIE 184


>gi|108563945|ref|YP_628261.1| rare lipoprotein A [Helicobacter pylori HPAG1]
 gi|107837718|gb|ABF85587.1| rare lipoprotein A [Helicobacter pylori HPAG1]
          Length = 314

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 54/115 (46%), Positives = 79/115 (68%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+ G+WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 95  RPYQVGGKWYYPTKVDLGEKFDGIASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTV 154

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           V+V N+EN +S +VR+NDRGP+ S+R+IDLSNAAA+ + + ++G + V +  LG 
Sbjct: 155 VKVINVENHLSTIVRINDRGPFVSDRIIDLSNAAARDIDMVKKGTASVRLIVLGF 209


>gi|87119259|ref|ZP_01075157.1| putative rare lipoprotein A [Marinomonas sp. MED121]
 gi|86165650|gb|EAQ66917.1| putative rare lipoprotein A [Marinomonas sp. MED121]
          Length = 314

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/122 (46%), Positives = 79/122 (64%), Gaps = 5/122 (4%)

Query: 60  RGGGRYFLGKPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAA 118
           RGG +      Y++ G+ Y V      +   G ASWYGK FHG  T+NGE Y     +AA
Sbjct: 81  RGGNK----STYEVWGKTYKVMDSAKGFVQTGTASWYGKKFHGHTTSNGETYDMYNYSAA 136

Query: 119 HPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           H  LPLP+Y++VTN++N  S++VRVNDRGP+HS R+IDLS AAA  L    +G+++V +E
Sbjct: 137 HKNLPLPTYLKVTNLDNDKSVIVRVNDRGPFHSKRIIDLSYAAAVKLDYHTKGLARVKIE 196

Query: 179 YL 180
            +
Sbjct: 197 AI 198


>gi|217031726|ref|ZP_03437230.1| hypothetical protein HPB128_155g39 [Helicobacter pylori B128]
 gi|298737137|ref|YP_003729667.1| rare lipoprotein A [Helicobacter pylori B8]
 gi|216946573|gb|EEC25173.1| hypothetical protein HPB128_155g39 [Helicobacter pylori B128]
 gi|298356331|emb|CBI67203.1| rare lipoprotein A [Helicobacter pylori B8]
          Length = 314

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 79/115 (68%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+ G+WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 95  RPYQVGGKWYYPTKVDLGEKFDGIASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTV 154

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           V+V N++N +S +VR+NDRGP+ S+R+IDLSNAAA+ + + ++G + V +  LG 
Sbjct: 155 VKVINVDNNLSTIVRINDRGPFVSDRIIDLSNAAARDIDMVKKGTASVRLIVLGF 209


>gi|77166091|ref|YP_344616.1| rare lipoprotein A [Nitrosococcus oceani ATCC 19707]
 gi|254435772|ref|ZP_05049279.1| Rare lipoprotein A double-psi beta-barrel, putative [Nitrosococcus
           oceani AFC27]
 gi|76884405|gb|ABA59086.1| Rare lipoprotein A [Nitrosococcus oceani ATCC 19707]
 gi|207088883|gb|EDZ66155.1| Rare lipoprotein A double-psi beta-barrel, putative [Nitrosococcus
           oceani AFC27]
          Length = 257

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/108 (52%), Positives = 74/108 (68%), Gaps = 1/108 (0%)

Query: 71  YQIMG-RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G R+Y  R    Y   G+ASWYG  FHGR T++GE+Y    +TAAH +LPLP YV 
Sbjct: 57  YEVNGQRYYTRRSSGGYKEKGIASWYGSKFHGRRTSSGEIYDMHAMTAAHRSLPLPCYVT 116

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           VTN+ N   ++VRVNDRGP+HSNR+IDLS AAA  L ++ +G   V V
Sbjct: 117 VTNLSNKRQIIVRVNDRGPFHSNRIIDLSYAAAVKLGLDRQGTGLVEV 164


>gi|15646178|ref|NP_208362.1| rare lipoprotein A (rlpA) [Helicobacter pylori 26695]
 gi|20139369|sp|O26091|RLPA_HELPY RecName: Full=RlpA-like lipoprotein; Flags: Precursor
 gi|2314752|gb|AAD08608.1| rare lipoprotein A (rlpA) [Helicobacter pylori 26695]
          Length = 315

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 79/115 (68%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+ G+WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 96  RPYQVGGKWYYPTKVDLGEKFDGVASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTV 155

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           V+V N++N +S +VR+NDRGP+ S+R+IDLSNAAA+ + + ++G + V +  LG 
Sbjct: 156 VKVINVDNNLSTIVRINDRGPFVSDRIIDLSNAAARDIDMVKKGTASVRLIVLGF 210


>gi|254780102|ref|YP_003058209.1| putative lipoprotein; putative signal peptide [Helicobacter pylori
           B38]
 gi|254002015|emb|CAX30274.1| Putative lipoprotein; putative signal peptide [Helicobacter pylori
           B38]
          Length = 314

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 79/115 (68%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+ G+WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 95  RPYQVGGKWYYPTKVDLGEKFDGIASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTV 154

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           V+V N++N +S +VR+NDRGP+ S+R+IDLSNAAA+ + + ++G + V +  LG 
Sbjct: 155 VKVINVDNNLSTIVRINDRGPFVSDRIIDLSNAAARDIDMVKKGTASVRLIVLGF 209


>gi|319940707|ref|ZP_08015049.1| rare lipoprotein A [Sutterella wadsworthensis 3_1_45B]
 gi|319805858|gb|EFW02625.1| rare lipoprotein A [Sutterella wadsworthensis 3_1_45B]
          Length = 293

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 87/149 (58%), Gaps = 14/149 (9%)

Query: 64  RYFLGKPYQIMGRWYVP-------RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYIT 116
           R    +PY ++G  Y P       RQ       G ASWYGK FHG  T+ GEVY     T
Sbjct: 54  RQAANRPYTVLGTRYSPMTTDQPLRQR------GTASWYGKQFHGNKTSIGEVYDMYQPT 107

Query: 117 AAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVH 176
           AAHPT+PLPSY RVTN++N  S++VRVNDRGP+   R+IDLS AAAK L     G ++V 
Sbjct: 108 AAHPTMPLPSYARVTNLKNNKSIIVRVNDRGPFLHGRIIDLSYAAAKTLGYANAGTAQVE 167

Query: 177 VEYLGM-ALLNGMDQEYLRSTVMVNSATV 204
           VE L    + +G  +    +T M+ SAT 
Sbjct: 168 VERLTWDDIRSGRWKANTSNTNMLASATA 196


>gi|217968698|ref|YP_002353932.1| lipoprotein A [Thauera sp. MZ1T]
 gi|217506025|gb|ACK53036.1| rare lipoprotein A [Thauera sp. MZ1T]
          Length = 381

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/116 (50%), Positives = 77/116 (66%), Gaps = 1/116 (0%)

Query: 66  FLGKPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           F  +PY +MG+ +VP  +   +   G  SWYG+ FHG  T++GE Y    +TAAHPTLP+
Sbjct: 100 FANRPYHVMGQSFVPATELRPFRQRGHGSWYGRRFHGNPTSSGEPYDMYAMTAAHPTLPI 159

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           PSY RVTN+ NG S+VVRVNDRGP+   R+IDLS AAA  L     G ++V VE +
Sbjct: 160 PSYARVTNLANGRSVVVRVNDRGPFLRGRVIDLSYAAAHKLGYVNGGSAEVEVEQI 215


>gi|50085368|ref|YP_046878.1| putative lipoprotein [Acinetobacter sp. ADP1]
 gi|49531344|emb|CAG69056.1| putative rare lipoprotein A family (RlpA-like) [Acinetobacter sp.
           ADP1]
          Length = 204

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 52/93 (55%), Positives = 69/93 (74%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           ++  G+ASWYG+ FHGR TANGE +    +TAAH +LPL  Y+RVTN +NG S+VV+VND
Sbjct: 105 FSQTGIASWYGRQFHGRKTANGETFDMNELTAAHRSLPLNCYIRVTNKDNGKSVVVKVND 164

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           RGP+H NR++DLS AAAK + +   G  KV +E
Sbjct: 165 RGPFHGNRVLDLSYAAAKRIGMTNAGTGKVSIE 197


>gi|308272582|emb|CBX29186.1| RlpA-like lipoprotein [uncultured Desulfobacterium sp.]
          Length = 232

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 78/126 (61%), Gaps = 1/126 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPYQ+ G+WY P      Y   G ASWYG+ FHG+ T+NGE Y    +TAAH TLPL + 
Sbjct: 26  KPYQVFGKWYQPIPDSKGYHERGTASWYGEDFHGKKTSNGETYNMHDMTAAHKTLPLGTI 85

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
           V+V N++    ++VRVNDRGP+  +R+IDLS+ AAK + +   G   V +  +G  + + 
Sbjct: 86  VKVLNLDTNKEIIVRVNDRGPFVKDRIIDLSHEAAKRIGIVGPGTGSVEIAAIGQEVQSE 145

Query: 188 MDQEYL 193
            DQ  L
Sbjct: 146 TDQAAL 151


>gi|261838858|gb|ACX98624.1| rare lipoprotein A [Helicobacter pylori 51]
          Length = 315

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 87/138 (63%), Gaps = 4/138 (2%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+  +WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 96  RPYQVGNKWYYPTKVDLGEKFDGIASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTV 155

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
           V+V N+EN +S +VR+NDRGP+ S+R+IDLSNAAA+ + + ++G + V +  LG     G
Sbjct: 156 VKVINVENNLSTIVRINDRGPFVSDRIIDLSNAAARDIDMVKKGTASVRLIVLGFG---G 212

Query: 188 MDQEYLRSTVMVNSATVL 205
           +  +    +   NS+ +L
Sbjct: 213 VISKQYEQSFNANSSKIL 230


>gi|261253675|ref|ZP_05946248.1| rare lipoprotein A precursor [Vibrio orientalis CIP 102891]
 gi|260937066|gb|EEX93055.1| rare lipoprotein A precursor [Vibrio orientalis CIP 102891]
          Length = 260

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 74/113 (65%), Gaps = 1/113 (0%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + G  Y + +    +   G ASWYGK FHG LT+NGE+Y    +TAAH  LP+PSYV+
Sbjct: 63  YTLRGESYTIIKDPNGFKQEGQASWYGKKFHGHLTSNGEIYDMYSMTAAHKELPIPSYVK 122

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           VTN +NG + VVRVNDRGP+H  R+IDLS AAA  L V   G + V +E + +
Sbjct: 123 VTNKDNGKTTVVRVNDRGPFHPGRIIDLSYAAALKLDVIRTGTANVAIEVISV 175


>gi|308185358|ref|YP_003929491.1| rare lipoprotein A [Helicobacter pylori SJM180]
 gi|308061278|gb|ADO03174.1| rare lipoprotein A [Helicobacter pylori SJM180]
          Length = 314

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 79/115 (68%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+ G+WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 95  RPYQVGGKWYYPTKVDLGEKFDGVASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTV 154

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           V+V N++N +S +VR+NDRGP+ S+R+IDLSNAAA+ + + ++G + V +  LG 
Sbjct: 155 VKVINVDNNLSTIVRINDRGPFVSDRIIDLSNAAARDIDMVKKGTASVRLIVLGF 209


>gi|261840264|gb|ACY00030.1| rare lipoprotein A [Helicobacter pylori 52]
          Length = 315

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 87/138 (63%), Gaps = 4/138 (2%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+  +WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 96  RPYQVGNKWYYPTKVDLGEKFDGIASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTV 155

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
           V+V N+EN +S +VR+NDRGP+ S+R+IDLSNAAA+ + + ++G + V +  LG     G
Sbjct: 156 VKVINVENNLSTIVRINDRGPFVSDRIIDLSNAAARDIDMVKKGTASVRLIVLGFG---G 212

Query: 188 MDQEYLRSTVMVNSATVL 205
           +  +    +   NS+ +L
Sbjct: 213 VVSKQYEQSFNANSSKIL 230


>gi|210135749|ref|YP_002302188.1| rare lipoprotein A [Helicobacter pylori P12]
 gi|210133717|gb|ACJ08708.1| rare lipoprotein A [Helicobacter pylori P12]
          Length = 314

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 79/115 (68%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+ G+WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 95  RPYQVGGKWYYPTKVDLGEKFDGIASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTV 154

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           V+V N++N +S +VR+NDRGP+ S+R+IDLSNAAA+ + + ++G + V +  LG 
Sbjct: 155 VKVINVDNNLSTIVRINDRGPFVSDRIIDLSNAAARDIDMVKKGTASVRLIVLGF 209


>gi|262369548|ref|ZP_06062876.1| rare lipoprotein A family protein [Acinetobacter johnsonii SH046]
 gi|262315616|gb|EEY96655.1| rare lipoprotein A family protein [Acinetobacter johnsonii SH046]
          Length = 202

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 51/95 (53%), Positives = 69/95 (72%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           ++  GMASWYG+ FHGR TA+GE +    +TAAH +LPL  ++RVTN  NG S+VV+VND
Sbjct: 103 FSQTGMASWYGRQFHGRKTASGETFDMNALTAAHRSLPLNCFIRVTNKTNGKSVVVKVND 162

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+H NR++DLS  AAK L +   G +KV +E +
Sbjct: 163 RGPFHGNRVLDLSYGAAKQLGITNAGTAKVSIERI 197


>gi|109948152|ref|YP_665380.1| rare lipoprotein A [Helicobacter acinonychis str. Sheeba]
 gi|109715373|emb|CAK00381.1| rare lipoprotein A [Helicobacter acinonychis str. Sheeba]
          Length = 315

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 88/138 (63%), Gaps = 4/138 (2%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+  +WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 96  RPYQVGDKWYYPTKVDLGEKFDGIASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTI 155

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
           V+V N+EN +S +VR+NDRGP+ S+R+IDLSNAAA+ + + ++G + V +  LG +   G
Sbjct: 156 VKVINVENNLSTIVRINDRGPFVSDRIIDLSNAAARDIDMVKKGTASVRLIILGFS---G 212

Query: 188 MDQEYLRSTVMVNSATVL 205
           +  +    +   NS+ +L
Sbjct: 213 VISKQYEQSFNANSSKIL 230


>gi|307823378|ref|ZP_07653607.1| rare lipoprotein A [Methylobacter tundripaludum SV96]
 gi|307735363|gb|EFO06211.1| rare lipoprotein A [Methylobacter tundripaludum SV96]
          Length = 265

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 75/111 (67%), Gaps = 5/111 (4%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           Y   G+ASWYG  FHG+ TA+GE+Y    +TAAH TLP+ SY RVTN+EN  S++VR+ND
Sbjct: 67  YLKQGVASWYGPDFHGKKTASGEIYDMYAMTAAHKTLPISSYARVTNLENQRSVIVRIND 126

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG-----MALLNGMDQE 191
           RGPYH NR++DLS AAA+ L +E+ G   V ++ +        L N  +Q+
Sbjct: 127 RGPYHGNRVMDLSYAAAQKLDLEQAGTGAVEIKAIAPEQALAQLQNAAEQQ 177


>gi|172038600|ref|YP_001805101.1| hypothetical protein cce_3687 [Cyanothece sp. ATCC 51142]
 gi|171700054|gb|ACB53035.1| unknown [Cyanothece sp. ATCC 51142]
          Length = 357

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 72/111 (64%), Gaps = 8/111 (7%)

Query: 79  VPRQYTAYAAV--------GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRV 130
            P Q +  A+V        GMASWYG  FHGRLTANGE Y    +TAAH +LP  + VRV
Sbjct: 246 TPEQESGLASVRPVTSRRKGMASWYGPGFHGRLTANGERYNQNGLTAAHKSLPFGTQVRV 305

Query: 131 TNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           TN+ NG S++VR+NDRGPY   R+IDLS  AA ++ +   GV+ V +E LG
Sbjct: 306 TNLHNGRSVIVRINDRGPYIHGRVIDLSKGAANVIGLLNSGVAPVQLEILG 356


>gi|262274733|ref|ZP_06052544.1| rare lipoprotein A precursor [Grimontia hollisae CIP 101886]
 gi|262221296|gb|EEY72610.1| rare lipoprotein A precursor [Grimontia hollisae CIP 101886]
          Length = 271

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 76/123 (61%), Gaps = 8/123 (6%)

Query: 60  RGGGRYFL--GKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITA 117
           R G + +   GK YQI+     P  YT     G+ASWYGK FHG  T+NGE+Y    ++A
Sbjct: 52  RAGNKDYTVRGKNYQILKH---PENYTE---EGIASWYGKKFHGHKTSNGEIYDMYSMSA 105

Query: 118 AHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           AH TLPLPSYV V N  NG   VVRVNDRGP+H  R+IDLS AAA  L + + G + V V
Sbjct: 106 AHKTLPLPSYVEVENTANGKKAVVRVNDRGPFHEGRIIDLSYAAASKLDIIKTGTAPVKV 165

Query: 178 EYL 180
             L
Sbjct: 166 TLL 168


>gi|15612544|ref|NP_224197.1| putative Outer membrane protein [Helicobacter pylori J99]
 gi|20139868|sp|Q9ZJ38|RLPA_HELPJ RecName: Full=RlpA-like lipoprotein; Flags: Precursor
 gi|4156099|gb|AAD07051.1| putative Outer membrane protein [Helicobacter pylori J99]
          Length = 314

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 54/115 (46%), Positives = 77/115 (66%), Gaps = 1/115 (0%)

Query: 70  PYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PYQ+ G+WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + V
Sbjct: 96  PYQVGGKWYYPTKVDLGEKFDGIASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTVV 155

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           +V N++N  S +VR+NDRGP+ SNR+IDLSNAAA+ + + ++G + V +  LG  
Sbjct: 156 KVINVDNNSSTIVRINDRGPFVSNRIIDLSNAAARDIDMVQKGTASVRLIVLGFG 210


>gi|114775711|ref|ZP_01451279.1| Lipoprotein [Mariprofundus ferrooxydans PV-1]
 gi|114553822|gb|EAU56203.1| Lipoprotein [Mariprofundus ferrooxydans PV-1]
          Length = 216

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 62/125 (49%), Positives = 79/125 (63%), Gaps = 2/125 (1%)

Query: 84  TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRV 143
           T Y   G+ASWYGK FHG+ TANGE Y    ++AAH TLPLP+ VRVTN++NG +++VRV
Sbjct: 5   THYDKTGIASWYGKDFHGKRTANGERYDMHALSAAHKTLPLPTLVRVTNLDNGRAVIVRV 64

Query: 144 NDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQ--EYLRSTVMVNS 201
           NDRGP+   RLIDLS AAAK L    +G + V V+ L     N      E +R+ V  + 
Sbjct: 65  NDRGPFVKERLIDLSYAAAKELGYANQGTAHVRVQTLDEVPANTTPTVAEAIRAPVQTSM 124

Query: 202 ATVLP 206
             V P
Sbjct: 125 VNVKP 129


>gi|262372363|ref|ZP_06065642.1| rare lipoprotein A family protein [Acinetobacter junii SH205]
 gi|262312388|gb|EEY93473.1| rare lipoprotein A family protein [Acinetobacter junii SH205]
          Length = 203

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 52/93 (55%), Positives = 69/93 (74%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           ++  G+ASWYG+ FHGR TA+GE +    +TAAH +LPL  Y+RVTN +NG S+VV+VND
Sbjct: 104 FSQTGVASWYGRQFHGRKTASGETFDMNGLTAAHRSLPLNCYIRVTNKDNGKSVVVKVND 163

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           RGP+H NR++DLS  AAK L V   G +KV +E
Sbjct: 164 RGPFHGNRVLDLSYGAAKQLGVTNAGTAKVSIE 196


>gi|325980983|ref|YP_004293385.1| rare lipoprotein A [Nitrosomonas sp. AL212]
 gi|325530502|gb|ADZ25223.1| rare lipoprotein A [Nitrosomonas sp. AL212]
          Length = 322

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 76/111 (68%), Gaps = 1/111 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY  +G+ + P      Y   G+ASWYG+ +HG  TA GEVY    +TAAHPTLPLPSY
Sbjct: 107 QPYVALGKHFKPMTNLEPYRKRGIASWYGRRYHGNNTAVGEVYDMYAMTAAHPTLPLPSY 166

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
            RVTN+ENG S++VR+NDRGP+ S+R+IDLS  AA  L +   G  +V VE
Sbjct: 167 ARVTNLENGKSVIVRLNDRGPFLSDRIIDLSYTAAYKLGILAGGSGQVEVE 217


>gi|283954072|ref|ZP_06371597.1| rare lipoprotein A [Campylobacter jejuni subsp. jejuni 414]
 gi|283794351|gb|EFC33095.1| rare lipoprotein A [Campylobacter jejuni subsp. jejuni 414]
          Length = 275

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 96/182 (52%), Gaps = 18/182 (9%)

Query: 10  LKGSVVCVVVLGMSSC----FFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRY 65
           LK S V +  L  S C    FFSS   D+   Y+P + +           K  P   G  
Sbjct: 8   LKLSAVSLWGLFFSGCLGTSFFSSM--DNAQVYYPSNDF-----------KSSPSSSGTK 54

Query: 66  FLGKPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
              KPY I G+ Y P       +A G+ASWYG  FHG+ T+NGE Y    +TAAH TLP+
Sbjct: 55  GTMKPYTINGKTYYPTVVAVGESADGIASWYGPGFHGKKTSNGETYDQNGLTAAHKTLPM 114

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMAL 184
            + ++VTN+ N   + VRVNDRGP+ +NR+IDLS  AA  + +   G + V +E +G   
Sbjct: 115 NTILKVTNLNNNRQVTVRVNDRGPFVNNRIIDLSKGAASQIDMITSGTAPVRLEVIGFGS 174

Query: 185 LN 186
            N
Sbjct: 175 SN 176


>gi|148652640|ref|YP_001279733.1| rare lipoprotein A [Psychrobacter sp. PRwf-1]
 gi|148571724|gb|ABQ93783.1| rare lipoprotein A [Psychrobacter sp. PRwf-1]
          Length = 198

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 70/96 (72%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           +   G ASWYG  FHGR TA+GE +    +TAAHP+LP  +Y+RVTN  NG S+VV+VND
Sbjct: 101 FKQSGRASWYGGKFHGRKTASGERFDMNSLTAAHPSLPFNTYLRVTNKGNGKSVVVKVND 160

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           RGPYH NR++DLS AAAK + +  RG++ V +E +G
Sbjct: 161 RGPYHGNRVLDLSYAAAKQIGLVSRGIANVTIERVG 196


>gi|308183726|ref|YP_003927853.1| rare lipoprotein A [Helicobacter pylori PeCan4]
 gi|308065911|gb|ADO07803.1| rare lipoprotein A [Helicobacter pylori PeCan4]
          Length = 315

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 86/138 (62%), Gaps = 4/138 (2%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+  +WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 96  RPYQVGNKWYYPTKVDLGEKFDGIASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTV 155

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
           V+V N+EN +S +VR+NDRGP+ S+R+IDLSNAAA+ + +  +G + V +  LG     G
Sbjct: 156 VKVINVENNLSTIVRINDRGPFVSDRIIDLSNAAARDIDMVRKGTASVRLIVLGFG---G 212

Query: 188 MDQEYLRSTVMVNSATVL 205
           +  +    +   NS+ +L
Sbjct: 213 VISKQYEQSFNANSSKIL 230


>gi|134093462|ref|YP_001098537.1| putative lipoprotein with signal peptide [Herminiimonas
           arsenicoxydans]
 gi|133737365|emb|CAL60408.1| Putative Lipoprotein [Herminiimonas arsenicoxydans]
          Length = 336

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 75/113 (66%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY + G+ YVP      +   G  SWYGK FHG+ T++GE Y    ++AAHPTLP+PSY
Sbjct: 91  KPYVVFGKRYVPMTDERPFRQQGRGSWYGKKFHGQKTSSGEPYDMYQMSAAHPTLPIPSY 150

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            RVTN+ NG  ++VRVNDRGP+HS+R+IDLS  AA  L     G + + VE L
Sbjct: 151 ARVTNLSNGKQVIVRVNDRGPFHSSRVIDLSYTAALKLGYIGHGSASLEVERL 203


>gi|308064353|gb|ADO06240.1| rare lipoprotein A [Helicobacter pylori Sat464]
          Length = 315

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 78/115 (67%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+  +WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 96  RPYQVGNKWYYPTKVDLGEKFDGIASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTV 155

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           V+V N+EN +S +VR+NDRGP+ S+R+IDLSNAAA+ + + ++G + V +  LG 
Sbjct: 156 VKVINVENNLSTIVRINDRGPFVSDRIIDLSNAAARDIDMVKKGTASVRLIVLGF 210


>gi|188528363|ref|YP_001911050.1| rare lipoprotein A (rlpA) [Helicobacter pylori Shi470]
 gi|188144603|gb|ACD49020.1| rare lipoprotein A (rlpA) [Helicobacter pylori Shi470]
          Length = 315

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 78/115 (67%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+  +WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 96  RPYQVGNKWYYPTKVDLGEKFDGIASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTV 155

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           V+V N+EN +S +VR+NDRGP+ S+R+IDLSNAAA+ + + ++G + V +  LG 
Sbjct: 156 VKVINVENNLSTIVRINDRGPFVSDRIIDLSNAAARDIDMVKKGTASVRLIVLGF 210


>gi|148359041|ref|YP_001250248.1| rare lipoprotein A [Legionella pneumophila str. Corby]
 gi|296107090|ref|YP_003618790.1| Lipoprotein [Legionella pneumophila 2300/99 Alcoy]
 gi|148280814|gb|ABQ54902.1| rare lipoprotein A [Legionella pneumophila str. Corby]
 gi|295648991|gb|ADG24838.1| Lipoprotein [Legionella pneumophila 2300/99 Alcoy]
          Length = 273

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 69/157 (43%), Positives = 95/157 (60%), Gaps = 9/157 (5%)

Query: 64  RYFLGKPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTL 122
           RY     Y + GR Y V +  T Y   G+ASWYG  FH + T++GE Y    +TAAH TL
Sbjct: 77  RYGNPSEYYVDGRTYEVMKSSTGYKTRGIASWYGTKFHKQRTSSGEPYNMYVMTAAHKTL 136

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL-G 181
           PLP+YV+V N+ENG   +V+VNDRGP+H+NR+IDLS AAA  L V  +G + V +E L G
Sbjct: 137 PLPTYVKVRNLENGKVAIVKVNDRGPFHANRVIDLSYAAALKLGVFPKGTAHVEIETLMG 196

Query: 182 MALLNGMDQEYLRSTVMVNSATVLPLGCQYREEIVVI 218
            A   G    YL++    + A    L  + +E+++ I
Sbjct: 197 PA---GQGHYYLQAGAFSSEA----LAKRLKEKLIHI 226


>gi|121613481|ref|YP_001000347.1| rare lipoprotein A [Campylobacter jejuni subsp. jejuni 81-176]
 gi|121504254|gb|EAQ73111.2| rare lipoprotein A [Campylobacter jejuni subsp. jejuni 81-176]
 gi|315926764|gb|EFV06138.1| rare lipoprotein A family protein [Campylobacter jejuni subsp.
           jejuni DFVF1099]
 gi|315931844|gb|EFV10799.1| rare lipoprotein A family protein [Campylobacter jejuni subsp.
           jejuni 327]
          Length = 266

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 69/179 (38%), Positives = 93/179 (51%), Gaps = 18/179 (10%)

Query: 13  SVVCVVVLGMSSC----FFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLG 68
           S V +  L  S C    FFSS   D+   Y+P + +           K  P   G     
Sbjct: 2   SAVSLGALFFSGCLGTSFFSSL--DNAQVYYPSNDF-----------KSSPSSSGTKGTM 48

Query: 69  KPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY I G+ Y P        A G+ASWYG  FHG+ T+NGE Y    +TAAH TLP+ + 
Sbjct: 49  KPYTINGKTYYPTVVAVGETADGIASWYGPGFHGKKTSNGETYNQNALTAAHKTLPMNTI 108

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLN 186
           ++VTN+ N   + VRVNDRGP+ +NR+IDLS  AA  + +   G + V +E +G    N
Sbjct: 109 LKVTNLNNNRQVTVRVNDRGPFVNNRIIDLSKGAASQIDMIASGTAPVRLEVIGFGSSN 167


>gi|300113195|ref|YP_003759770.1| rare lipoprotein A [Nitrosococcus watsonii C-113]
 gi|299539132|gb|ADJ27449.1| rare lipoprotein A [Nitrosococcus watsonii C-113]
          Length = 248

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 57/108 (52%), Positives = 74/108 (68%), Gaps = 1/108 (0%)

Query: 71  YQIMG-RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G R+Y  R    Y   G+ASWYG  FHGR T++GE+Y    +TAAH +LPLP YV 
Sbjct: 48  YEVNGQRYYTRRSSGGYKEKGIASWYGSKFHGRRTSSGEIYDMHGMTAAHRSLPLPCYVT 107

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           VTN+ N   ++VRVNDRGP+HSNR+IDLS AAA  L ++ +G   V V
Sbjct: 108 VTNLSNKRQVIVRVNDRGPFHSNRIIDLSYAAAVKLGLDRQGTGLVEV 155


>gi|218245938|ref|YP_002371309.1| rare lipoprotein A [Cyanothece sp. PCC 8801]
 gi|257058986|ref|YP_003136874.1| lipoprotein A [Cyanothece sp. PCC 8802]
 gi|218166416|gb|ACK65153.1| rare lipoprotein A [Cyanothece sp. PCC 8801]
 gi|256589152|gb|ACV00039.1| rare lipoprotein A [Cyanothece sp. PCC 8802]
          Length = 360

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 54/92 (58%), Positives = 65/92 (70%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           GMASWYG  FHGR TANGE Y    +TAAH TLP  + V+VTN+ NG S+ VR+NDRGPY
Sbjct: 268 GMASWYGPGFHGRRTANGERYNQNGLTAAHKTLPFGTQVKVTNLNNGRSITVRINDRGPY 327

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
              R+IDLS  AA+IL +   GV+ V +E LG
Sbjct: 328 AHGRIIDLSKGAAQILGLVSSGVAPVQIEILG 359


>gi|317182796|dbj|BAJ60580.1| rare lipoprotein A [Helicobacter pylori F57]
          Length = 315

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/116 (45%), Positives = 78/116 (67%), Gaps = 1/116 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+  +WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 96  RPYQVGNKWYYPTKVDLGEKFDGIASWYGPNFHAKKTSNGEIYNMYVHTAAHKTLPMNTV 155

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           V+V N+EN +S +VR+NDRGP+ S+R+IDLSNAAA+ + + ++G + V +  LG  
Sbjct: 156 VKVINVENNLSTIVRINDRGPFVSDRIIDLSNAAARDIDMVKKGTASVRLIVLGFG 211


>gi|297569298|ref|YP_003690642.1| rare lipoprotein A [Desulfurivibrio alkaliphilus AHT2]
 gi|296925213|gb|ADH86023.1| rare lipoprotein A [Desulfurivibrio alkaliphilus AHT2]
          Length = 276

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 95/160 (59%), Gaps = 13/160 (8%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQI G  Y P      Y+  G+ASWYG+ FHGR T+NGE+Y    +TAAH TLP+ ++
Sbjct: 64  RPYQIQGTTYYPIPSAHGYSETGIASWYGRKFHGRRTSNGEIYDMHAMTAAHKTLPMDTH 123

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA---L 184
           + V N+ENG  + VR+NDRGP+   R+IDLS  AA+ L + E+G+++V +  LG     +
Sbjct: 124 LLVENLENGREITVRINDRGPFVRGRIIDLSYRAAQKLGMAEQGLAQVRITALGATERYV 183

Query: 185 LNGMDQEYLRST---------VMVNSATVLPLGCQYREEI 215
            +G  Q+   +T         V V + TV     + R+++
Sbjct: 184 EDGQLQQRFTATPDFEHGEFYVQVGAFTVAENATRLRDQL 223


>gi|33591880|ref|NP_879524.1| putative lipoprotein [Bordetella pertussis Tohama I]
 gi|33571524|emb|CAE41000.1| putative lipoprotein [Bordetella pertussis Tohama I]
 gi|332381297|gb|AEE66144.1| putative lipoprotein [Bordetella pertussis CS]
          Length = 316

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 76/113 (67%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY + G+ YVP      +   G+ASWYGK FHG  T+NGE Y    +TAAHPT+P+PSY
Sbjct: 65  RPYVVFGKRYVPDTSERPFRQQGLASWYGKKFHGNSTSNGESYDMYAMTAAHPTMPIPSY 124

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            RVT+  NG +++VRVNDRGP+HS+R++DLS  AA  L +   G   V VE +
Sbjct: 125 ARVTSKINGRTVIVRVNDRGPFHSDRIMDLSYVAAHKLGIIGPGSGPVTVERI 177


>gi|254468558|ref|ZP_05081964.1| rare lipoprotein A [beta proteobacterium KB13]
 gi|207087368|gb|EDZ64651.1| rare lipoprotein A [beta proteobacterium KB13]
          Length = 265

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 91/148 (61%), Gaps = 11/148 (7%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY++ G+ Y+P  +   +   G ASWYGK +HG  T+ GE+Y    +T AH  LPLPSY
Sbjct: 61  KPYKVFGQKYIPMTKIVPFKEKGYASWYGKKYHGNKTSTGEIYDMYAMTGAHKILPLPSY 120

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG-----M 182
           V+VTN++N   +++R+NDRGP+  +R+IDLS AAA  L + E+G   V VE +       
Sbjct: 121 VKVTNLKNKKWVIIRLNDRGPFLKDRIIDLSYAAAHKLDIIEKGSELVEVELINPKEYEE 180

Query: 183 ALLNGM--DQEYLRSTV---MVNSATVL 205
           A+++    D+ YL+       +NS T+L
Sbjct: 181 AVVDNQSNDENYLQVGAFKDFINSQTLL 208


>gi|317178293|dbj|BAJ56082.1| rare lipoprotein A [Helicobacter pylori F16]
          Length = 315

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 78/115 (67%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+  +WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 96  RPYQVGNKWYYPTKVDLGEKFDGIASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTV 155

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           V+V N+EN +S +VR+NDRGP+ S+R+IDLSNAAA+ + + ++G + V +  LG 
Sbjct: 156 VKVINVENNLSTIVRINDRGPFVSDRIIDLSNAAARDIDMVKKGTASVRLIVLGF 210


>gi|126657264|ref|ZP_01728430.1| rare lipoprotein A [Cyanothece sp. CCY0110]
 gi|126621535|gb|EAZ92246.1| rare lipoprotein A [Cyanothece sp. CCY0110]
          Length = 336

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 60/121 (49%), Positives = 75/121 (61%), Gaps = 14/121 (11%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV--------GMASWYGKAFHGRLTANGEVYGTEYITAAHP 120
           KP Q       P Q +  A+V        GMASWYG  FHGRLTANGE Y    +TAAH 
Sbjct: 221 KPEQ------TPSQESGLASVRPVTSRRKGMASWYGPGFHGRLTANGERYNQNGLTAAHK 274

Query: 121 TLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +LP  + VRVTN+ NG S++VR+NDRGPY   R+IDLS  AA ++ +   GV+ V +E L
Sbjct: 275 SLPFGTQVRVTNLRNGRSVIVRINDRGPYIHGRVIDLSKGAANVIGLLNSGVAPVQLEIL 334

Query: 181 G 181
           G
Sbjct: 335 G 335


>gi|33598541|ref|NP_886184.1| putative lipoprotein [Bordetella parapertussis 12822]
 gi|33603486|ref|NP_891046.1| putative lipoprotein [Bordetella bronchiseptica RB50]
 gi|33574670|emb|CAE39322.1| putative lipoprotein [Bordetella parapertussis]
 gi|33577610|emb|CAE34875.1| putative lipoprotein [Bordetella bronchiseptica RB50]
          Length = 316

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 76/113 (67%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY + G+ YVP      +   G+ASWYGK FHG  T+NGE Y    +TAAHPT+P+PSY
Sbjct: 65  RPYVVFGKRYVPDTSERPFRQQGLASWYGKKFHGNSTSNGESYDMYAMTAAHPTMPIPSY 124

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            RVT+  NG +++VRVNDRGP+HS+R++DLS  AA  L +   G   V VE +
Sbjct: 125 ARVTSKINGRTVIVRVNDRGPFHSDRIMDLSYVAAHKLGIIGPGSGPVTVERI 177


>gi|91792212|ref|YP_561863.1| rare lipoprotein A [Shewanella denitrificans OS217]
 gi|91714214|gb|ABE54140.1| rare lipoprotein A [Shewanella denitrificans OS217]
          Length = 297

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 77/113 (68%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           K Y+++G+ Y V      +   G+ASWYG  FHG LT+NGEVY    +TAAH TLP+PSY
Sbjct: 93  KDYRVLGKNYAVLNHGKDFRERGIASWYGSKFHGHLTSNGEVYDMYAMTAAHKTLPIPSY 152

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           V+V N +N   ++VRVNDRGP+H  R+IDLS AAA  L V   G ++V++E +
Sbjct: 153 VKVRNEDNNKEIIVRVNDRGPFHEGRVIDLSYAAAYKLGVLSTGTARVNIEAI 205


>gi|67920255|ref|ZP_00513775.1| Rare lipoprotein A [Crocosphaera watsonii WH 8501]
 gi|67857739|gb|EAM52978.1| Rare lipoprotein A [Crocosphaera watsonii WH 8501]
          Length = 332

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 53/92 (57%), Positives = 66/92 (71%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           GMASWYG  FHGRLTANGE Y    +TAAH TLP  + VRVTN+ NG S++VR+NDRGP+
Sbjct: 240 GMASWYGPGFHGRLTANGERYNQNGLTAAHKTLPFGTQVRVTNLRNGRSVIVRINDRGPF 299

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
              R+IDLS  AA ++ +   GV+ V +E LG
Sbjct: 300 VGGRVIDLSKGAASVIGLVSSGVAPVQLEILG 331


>gi|317181273|dbj|BAJ59059.1| rare lipoprotein A [Helicobacter pylori F32]
          Length = 315

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 78/115 (67%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+  +WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 96  RPYQVGNKWYYPTKVDLGEKFDGIASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTV 155

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           V+V N+EN +S +VR+NDRGP+ S+R+IDLSNAAA+ + + ++G + V +  LG 
Sbjct: 156 VKVINVENNLSTIVRINDRGPFVSDRIIDLSNAAARDIDMVKKGTASVRLIVLGF 210


>gi|238795410|ref|ZP_04638925.1| Rare lipoprotein A [Yersinia mollaretii ATCC 43969]
 gi|238720529|gb|EEQ12330.1| Rare lipoprotein A [Yersinia mollaretii ATCC 43969]
          Length = 372

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 57/137 (41%), Positives = 86/137 (62%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G+ Y + +    ++ +G+A+WYG+  +G  TA GE +    +TAAHPTLP+PSYVR
Sbjct: 58  YKVNGQSYSIVKDPQNFSQIGLAAWYGEEANGNTTATGETFDPNALTAAHPTLPIPSYVR 117

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN+ NG  +VVRVNDRGPY S R+IDLS AAA  L +     +KV ++++ +A    + 
Sbjct: 118 VTNVSNGRQIVVRVNDRGPYTSGRVIDLSKAAADRLNISNN--TKVKIDFINVAPDGSLS 175

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +   +  LP
Sbjct: 176 GPGMVGTTIAKQSYALP 192


>gi|238762883|ref|ZP_04623851.1| Rare lipoprotein A [Yersinia kristensenii ATCC 33638]
 gi|238698894|gb|EEP91643.1| Rare lipoprotein A [Yersinia kristensenii ATCC 33638]
          Length = 361

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 57/137 (41%), Positives = 86/137 (62%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G+ Y + +    ++ VG+A+WYG+  +G  TA GE++    +TAAHPTLP+PSYVR
Sbjct: 58  YKVNGQSYSIVKDPQNFSQVGLAAWYGEEANGNTTATGEIFDPNALTAAHPTLPIPSYVR 117

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN+ NG  +VVRVNDRGPY   R+IDLS AAA  L +     +KV ++++ +A    + 
Sbjct: 118 VTNISNGRQIVVRVNDRGPYTPGRVIDLSKAAADRLNISNN--TKVKIDFINVAPDGSLS 175

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +   +  LP
Sbjct: 176 GPGMVGTTIAKQSYALP 192


>gi|262375510|ref|ZP_06068743.1| rare lipoprotein A family protein [Acinetobacter lwoffii SH145]
 gi|262309764|gb|EEY90894.1| rare lipoprotein A family protein [Acinetobacter lwoffii SH145]
          Length = 204

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 68/96 (70%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           ++  G ASWYG+ FHGR TA+GE +    +TAAH +LPL  Y+RVTN  NG S+VV+VND
Sbjct: 105 FSQTGTASWYGRQFHGRKTASGETFDMNAMTAAHRSLPLNCYIRVTNRNNGKSVVVKVND 164

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           RGP+H NR++DLS  AAK L +   G +KV +E + 
Sbjct: 165 RGPFHGNRVVDLSYGAAKQLGITSAGTAKVSIERVA 200


>gi|332674382|gb|AEE71199.1| rare lipoprotein A [Helicobacter pylori 83]
          Length = 315

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 85/133 (63%), Gaps = 3/133 (2%)

Query: 70  PYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PYQ+  +WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + V
Sbjct: 97  PYQVGSKWYYPTKVDLGEKFDGIASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTVV 156

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA--LLN 186
           +V N+EN +S +VR+NDRGP+ S+R+IDLSNAAA+ + + ++G + V +  LG    + N
Sbjct: 157 KVINVENNLSTIVRINDRGPFVSDRIIDLSNAAARDIDMVKKGTASVRLIVLGFGGVISN 216

Query: 187 GMDQEYLRSTVMV 199
             +Q +  S+  +
Sbjct: 217 QYEQSFNASSSKI 229


>gi|304395656|ref|ZP_07377539.1| rare lipoprotein A [Pantoea sp. aB]
 gi|304356950|gb|EFM21314.1| rare lipoprotein A [Pantoea sp. aB]
          Length = 365

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 84/137 (61%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + G+ Y + +  + Y+ VG+A+WYG+   G  TA GE Y  + +TAAHPTLPLPSYVR
Sbjct: 58  YSVNGKNYRIIKDPSNYSEVGLATWYGEEAQGNRTATGEAYDPDALTAAHPTLPLPSYVR 117

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN+ NG  +VVRVNDRGPY   R+IDLS AA   L +     S+V V+Y+ +A    + 
Sbjct: 118 VTNIANGRQIVVRVNDRGPYTPGRIIDLSRAAGDRLNISNN--SRVRVDYIKVAPDGTLS 175

Query: 190 QEYLRSTVMVNSATVLP 206
                 TV+   +  LP
Sbjct: 176 GPGTIGTVVAKQSYSLP 192


>gi|317015008|gb|ADU82444.1| rare lipoprotein A [Helicobacter pylori Gambia94/24]
          Length = 314

 Score =  115 bits (288), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 53/116 (45%), Positives = 78/116 (67%), Gaps = 1/116 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+ G+WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 95  RPYQVGGKWYYPTKVDLGEKFDGIASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTV 154

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           V+V N++N  S +VR+NDRGP+ S+R+IDLSNAAA+ + + ++G + V +  LG  
Sbjct: 155 VKVINVDNNSSTIVRINDRGPFVSDRIIDLSNAAARDIDMVQKGTASVRLIVLGFG 210


>gi|327393101|dbj|BAK10523.1| rare lipoprotein A precursor RlpA [Pantoea ananatis AJ13355]
          Length = 387

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 61/137 (44%), Positives = 83/137 (60%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + G+ Y + +    Y+ VG+A+WYG+   G  TA GE +  + +TAAHPTLPLPSYVR
Sbjct: 59  YSVNGKNYRIIKNPANYSEVGLAAWYGEEAQGNRTATGETFDPDALTAAHPTLPLPSYVR 118

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN+ NG  +VVRVNDRGPY   R+IDLS AA   L +     S+V V+Y+ +A    + 
Sbjct: 119 VTNLANGRQIVVRVNDRGPYTPGRIIDLSRAAGDRLNISNN--SRVRVDYISVAPDGTLS 176

Query: 190 QEYLRSTVMVNSATVLP 206
                 TV+   +  LP
Sbjct: 177 GPGTIGTVVAKQSYALP 193


>gi|291616675|ref|YP_003519417.1| RlpA [Pantoea ananatis LMG 20103]
 gi|291151705|gb|ADD76289.1| RlpA [Pantoea ananatis LMG 20103]
          Length = 393

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 61/137 (44%), Positives = 83/137 (60%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + G+ Y + +    Y+ VG+A+WYG+   G  TA GE +  + +TAAHPTLPLPSYVR
Sbjct: 65  YSVNGKNYRIIKNPANYSEVGLAAWYGEEAQGNRTATGETFDPDALTAAHPTLPLPSYVR 124

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN+ NG  +VVRVNDRGPY   R+IDLS AA   L +     S+V V+Y+ +A    + 
Sbjct: 125 VTNLANGRQIVVRVNDRGPYTPGRIIDLSRAAGDRLNISNN--SRVRVDYISVAPDGTLS 182

Query: 190 QEYLRSTVMVNSATVLP 206
                 TV+   +  LP
Sbjct: 183 GPGTIGTVVAKQSYALP 199


>gi|315585977|gb|ADU40358.1| lipoprotein A [Helicobacter pylori 35A]
          Length = 315

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 78/115 (67%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+  +WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 96  RPYQVGKKWYYPTKVDLGEKFDGIASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTV 155

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           V+V N+EN +S +VR+NDRGP+ S+R+IDLSNAAA+ + + ++G + V +  LG 
Sbjct: 156 VKVINVENNLSTIVRINDRGPFVSDRIIDLSNAAARDIDMVKKGTASVRLIVLGF 210


>gi|254496459|ref|ZP_05109336.1| rare lipoprotein A [Legionella drancourtii LLAP12]
 gi|254354315|gb|EET12973.1| rare lipoprotein A [Legionella drancourtii LLAP12]
          Length = 276

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 75/113 (66%), Gaps = 6/113 (5%)

Query: 68  GKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           GK YQ+M   +       Y A GMASWYG  FH + T++GE Y    ++AAH TLPLP+Y
Sbjct: 91  GKNYQVMANTH------KYKARGMASWYGTKFHKQRTSSGEPYDMYVMSAAHKTLPLPTY 144

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VRV N+ NG   +V+VNDRGP+HS+R+IDLS AAA  L V  +G + V VE L
Sbjct: 145 VRVKNLNNGKVAIVKVNDRGPFHSDRIIDLSYAAALKLGVFPKGTAPVEVEAL 197


>gi|317179772|dbj|BAJ57560.1| rare lipoprotein A [Helicobacter pylori F30]
          Length = 315

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 77/115 (66%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+  +WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 96  RPYQVGNKWYYPTKVDLGEKFDGIASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTV 155

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           V+V N+EN +S +VR+NDRGP+ S+R+IDLSNAAA+ + +  +G + V +  LG 
Sbjct: 156 VKVINVENNLSTIVRINDRGPFVSDRIIDLSNAAARDIDMVRKGTASVRLIVLGF 210


>gi|308186018|ref|YP_003930149.1| Rare lipoprotein A precursor [Pantoea vagans C9-1]
 gi|308056528|gb|ADO08700.1| Rare lipoprotein A precursor [Pantoea vagans C9-1]
          Length = 365

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 84/137 (61%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + G+ Y + +  + Y+ VG+A+WYG+   G  TA GE Y  + +TAAHPTLPLPSYVR
Sbjct: 58  YSVNGKNYRIIKDPSNYSEVGLATWYGEEAQGNRTATGEAYDPDALTAAHPTLPLPSYVR 117

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN+ NG  +VVRVNDRGPY   R+IDLS AA   L +     S+V V+Y+ +A    + 
Sbjct: 118 VTNIANGRQIVVRVNDRGPYTPGRIIDLSRAAGDRLNISNN--SRVRVDYIKVAPDGTLS 175

Query: 190 QEYLRSTVMVNSATVLP 206
                 TV+   +  LP
Sbjct: 176 GPGTIGTVVAKQSYSLP 192


>gi|52841738|ref|YP_095537.1| rare lipoprotein A [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|52628849|gb|AAU27590.1| rare lipoprotein A [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
          Length = 273

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 69/157 (43%), Positives = 95/157 (60%), Gaps = 9/157 (5%)

Query: 64  RYFLGKPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTL 122
           RY     Y + GR Y V +  T Y   G+ASWYG  FH + T++GE Y    +TAAH TL
Sbjct: 77  RYGNPSEYYVDGRTYEVMKSSTGYKTRGIASWYGTKFHKQRTSSGEPYNMYVMTAAHKTL 136

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL-G 181
           PLP+YV+V N+ENG   +V+VNDRGP+H+NR+IDLS AAA  L V  +G + V +E L G
Sbjct: 137 PLPTYVKVRNLENGKVAIVKVNDRGPFHANRVIDLSYAAALKLGVFPKGTAHVEIETLMG 196

Query: 182 MALLNGMDQEYLRSTVMVNSATVLPLGCQYREEIVVI 218
            A   G    YL++    + A    L  + +E+++ I
Sbjct: 197 PA---GQGHYYLQAGAFSSEA----LAKRLKEKLLHI 226


>gi|119896471|ref|YP_931684.1| lipoprotein [Azoarcus sp. BH72]
 gi|119668884|emb|CAL92797.1| lipoprotein [Azoarcus sp. BH72]
          Length = 346

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 77/116 (66%), Gaps = 1/116 (0%)

Query: 66  FLGKPYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           F  +PY + G+ YVP    A +   G+ASWYG+ FHG  T++GE Y    +TAAHPTLP+
Sbjct: 108 FANRPYNVFGQDYVPATRLAPFRERGLASWYGRRFHGGNTSSGEPYDMYAMTAAHPTLPI 167

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           PSY RVTN+  G S+VVR+NDRGP+H  R++DLS  AA  L     G ++V VE +
Sbjct: 168 PSYARVTNVATGRSVVVRINDRGPFHKGRIMDLSYTAAYRLGYVNGGSAEVEVEQI 223


>gi|288942561|ref|YP_003444801.1| rare lipoprotein A [Allochromatium vinosum DSM 180]
 gi|288897933|gb|ADC63769.1| rare lipoprotein A [Allochromatium vinosum DSM 180]
          Length = 199

 Score =  115 bits (287), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 53/111 (47%), Positives = 77/111 (69%), Gaps = 1/111 (0%)

Query: 71  YQIMGR-WYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + GR ++  +    +   G+ASWYG+ FHGR T++GE Y    ++AAH TLPLP+Y R
Sbjct: 54  YVVFGRRYFTQKSARGHVERGLASWYGRPFHGRRTSSGETYDMYAMSAAHKTLPLPTYAR 113

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VTN+ENG  +VVR+NDRGP+H  R+IDLS  AA  L ++ +G ++V V+ +
Sbjct: 114 VTNLENGRRVVVRINDRGPFHDGRVIDLSYTAAVKLGMKRQGTARVEVQAI 164


>gi|54297420|ref|YP_123789.1| hypothetical protein lpp1465 [Legionella pneumophila str. Paris]
 gi|53751205|emb|CAH12616.1| hypothetical protein lpp1465 [Legionella pneumophila str. Paris]
          Length = 273

 Score =  115 bits (287), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 60/118 (50%), Positives = 78/118 (66%), Gaps = 1/118 (0%)

Query: 64  RYFLGKPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTL 122
           RY     Y + GR Y V +  T Y   G+ASWYG  FH + T++GE Y    +TAAH TL
Sbjct: 77  RYGNPSEYYVDGRTYEVMKSSTGYKTRGIASWYGTKFHKQRTSSGEPYNMYVMTAAHKTL 136

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           PLP+YV+V N+ENG   +V+VNDRGP+H+NR+IDLS AAA  L V  +G + V +E L
Sbjct: 137 PLPTYVKVRNLENGKVAIVKVNDRGPFHANRVIDLSYAAALKLGVFPKGTAHVEIETL 194


>gi|307638258|gb|ADN80708.1| lipoprotein A [Helicobacter pylori 908]
 gi|325996850|gb|ADZ52255.1| Rare lipoprotein A [Helicobacter pylori 2018]
 gi|325998442|gb|ADZ50650.1| RlpA like lipoprotein [Helicobacter pylori 2017]
          Length = 314

 Score =  115 bits (287), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 53/116 (45%), Positives = 78/116 (67%), Gaps = 1/116 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+ G+WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 95  RPYQVGGKWYYPTKVDLGEKFDGIASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTV 154

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           V+V N++N  S +VR+NDRGP+ S+R+IDLSNAAA+ + + ++G + V +  LG  
Sbjct: 155 VKVINVDNNSSTIVRINDRGPFVSDRIIDLSNAAARDIDMVQKGTASVRLIVLGFG 210


>gi|304310092|ref|YP_003809690.1| Rare lipoprotein A [gamma proteobacterium HdN1]
 gi|301795825|emb|CBL44024.1| Rare lipoprotein A [gamma proteobacterium HdN1]
          Length = 328

 Score =  115 bits (287), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 56/120 (46%), Positives = 81/120 (67%), Gaps = 1/120 (0%)

Query: 64  RYFLGKPYQIMG-RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTL 122
           RY    PY ++G R+Y+      Y+ VG+ SWYG+ FHG+ T+  E Y    +TAAH +L
Sbjct: 84  RYGNKTPYDVLGKRYYLLPTAAGYSEVGVGSWYGEKFHGQPTSTMEPYDLYEMTAAHKSL 143

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           P+P+Y RVTN+EN  S++VR+NDRGP+  +R+IDLS AAA  +   E+G ++V VE L +
Sbjct: 144 PIPTYARVTNLENNRSVIVRINDRGPFVDDRIIDLSYAAAVKIGYAEKGTARVRVETLSV 203


>gi|123443219|ref|YP_001007193.1| rare lipoprotein A [Yersinia enterocolitica subsp. enterocolitica
           8081]
 gi|122090180|emb|CAL13043.1| rare lipoprotein A precursor [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 365

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/137 (41%), Positives = 86/137 (62%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G+ Y + +    ++ VG+A+WYG+  +G  TA GE++    +TAAHPTLP+PSYVR
Sbjct: 58  YKVNGQSYSIVKDPQNFSQVGLAAWYGEEANGNSTATGEIFDPNALTAAHPTLPIPSYVR 117

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN+ NG  +VVRVNDRGPY   R+IDLS AAA  L +     +KV ++++ +A    + 
Sbjct: 118 VTNISNGRQIVVRVNDRGPYTPGRVIDLSKAAADRLNISNN--TKVKIDFINVAPDGSLS 175

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +   +  LP
Sbjct: 176 GPGMVGTTIAKQSYALP 192


>gi|319789688|ref|YP_004151321.1| rare lipoprotein A [Thermovibrio ammonificans HB-1]
 gi|317114190|gb|ADU96680.1| rare lipoprotein A [Thermovibrio ammonificans HB-1]
          Length = 247

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 83/124 (66%), Gaps = 5/124 (4%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + G+ Y V R    +  VG+ASWYG  FHG  TA+GEVY    +TAAH TLPL +YVR
Sbjct: 49  YTVKGKTYCVRRSARGFVQVGIASWYGPGFHGSRTASGEVYNMFKLTAAHKTLPLGTYVR 108

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           V N+ENG S++V++NDRGP+   R+IDLS AAAK L + ++G +KV +    +AL   +D
Sbjct: 109 VINLENGRSVIVKINDRGPFVPGRIIDLSYAAAKRLGMLKKGTAKVKI----VALGRRVD 164

Query: 190 QEYL 193
             YL
Sbjct: 165 GRYL 168


>gi|332160855|ref|YP_004297432.1| rare lipoprotein A [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|318604757|emb|CBY26255.1| rare lipoprotein A precursor [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325665085|gb|ADZ41729.1| rare lipoprotein A [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|330863384|emb|CBX73506.1| rare lipoprotein A [Yersinia enterocolitica W22703]
          Length = 365

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/137 (41%), Positives = 86/137 (62%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G+ Y + +    ++ VG+A+WYG+  +G  TA GE++    +TAAHPTLP+PSYVR
Sbjct: 58  YKVNGQSYSIVKDPQNFSQVGLAAWYGEEANGNSTATGEIFDPNALTAAHPTLPIPSYVR 117

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN+ NG  +VVRVNDRGPY   R+IDLS AAA  L +     +KV ++++ +A    + 
Sbjct: 118 VTNISNGRQIVVRVNDRGPYTPGRVIDLSKAAADRLNISNN--TKVKIDFINVAPDGSLS 175

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +   +  LP
Sbjct: 176 GPGMVGTTIAKQSYALP 192


>gi|301154769|emb|CBW14232.1| rlpa-like protein precursor [Haemophilus parainfluenzae T3T1]
          Length = 286

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 66/175 (37%), Positives = 97/175 (55%), Gaps = 22/175 (12%)

Query: 9   LLKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTA-SDRIVSGKRVPRGGGRYFL 67
           +LK + +  + +G S   F++T K          MYG+   S  I +  + P+       
Sbjct: 6   ILKTTALFTLTIGTSIAAFANTQK----------MYGIQGDSMSITTTVQAPQ------- 48

Query: 68  GKPYQIMGRWYVPR--QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLP 125
              YQ+ G+ Y  +  +  +Y+  G AS+Y   F+GR TANGE Y +   TAAH TLPL 
Sbjct: 49  --SYQVDGKTYTTQGDEAKSYSKEGTASYYHHKFNGRKTANGERYNSALFTAAHKTLPLN 106

Query: 126 SYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           SY  VTN+ N   ++VR+NDRGP+   R+IDLS++AAK L +  RG  +V +E L
Sbjct: 107 SYAVVTNLHNNRKVIVRINDRGPFSHKRIIDLSHSAAKELGLISRGTGQVRIEAL 161


>gi|54294449|ref|YP_126864.1| hypothetical protein lpl1518 [Legionella pneumophila str. Lens]
 gi|53754281|emb|CAH15758.1| hypothetical protein lpl1518 [Legionella pneumophila str. Lens]
          Length = 273

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 69/157 (43%), Positives = 95/157 (60%), Gaps = 9/157 (5%)

Query: 64  RYFLGKPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTL 122
           RY     Y + GR Y V +  T Y   G+ASWYG  FH + T++GE Y    +TAAH TL
Sbjct: 77  RYGNPSEYYVDGRTYEVMKSSTGYKTRGIASWYGTKFHKQRTSSGEPYNMYVMTAAHKTL 136

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL-G 181
           PLP+YV+V N+ENG   +V+VNDRGP+H++R+IDLS AAA  L V  +G + V +E L G
Sbjct: 137 PLPTYVKVRNLENGKVAIVKVNDRGPFHADRVIDLSYAAALKLGVFPKGTAHVEIETLMG 196

Query: 182 MALLNGMDQEYLRSTVMVNSATVLPLGCQYREEIVVI 218
            A   G    YL++    + A    L  + +E++V I
Sbjct: 197 PA---GQGHYYLQAGAFSSEA----LAKRLKEKLVHI 226


>gi|311109304|ref|YP_003982157.1| RlpA-like lipoprotein [Achromobacter xylosoxidans A8]
 gi|310763993|gb|ADP19442.1| RlpA-like lipoprotein [Achromobacter xylosoxidans A8]
          Length = 320

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 75/113 (66%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWYVPRQY-TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY + G+ YVP      Y   G ASWYGK FHG  T+ GE Y    +TAAH TLPLPSY
Sbjct: 67  RPYVVFGQRYVPDTSGQPYKKRGTASWYGKKFHGNSTSIGESYDMYAMTAAHTTLPLPSY 126

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            RVT+M NG +++VRVNDRGP+HS+R++DLS  AA  L +   G  +V VE +
Sbjct: 127 ARVTSMVNGKTIIVRVNDRGPFHSDRIMDLSYVAAHKLGIIGPGSGQVIVEAI 179


>gi|88705585|ref|ZP_01103295.1| RlpA-like lipoprotein precursor [Congregibacter litoralis KT71]
 gi|88700098|gb|EAQ97207.1| RlpA-like lipoprotein precursor [Congregibacter litoralis KT71]
          Length = 278

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 73/164 (44%), Positives = 92/164 (56%), Gaps = 14/164 (8%)

Query: 70  PYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY I G  Y V      Y   G+ASWYG  FHG  TANGEVY     TAAH +LP+PSY 
Sbjct: 77  PYSIDGVEYRVLPSAEGYREKGIASWYGTKFHGNKTANGEVYDLYLPTAAHRSLPIPSYA 136

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGM 188
            VTN+ NG  +VVR+NDRGP+H +RLIDLS AAA  L   ++G ++V VE + +A   G+
Sbjct: 137 TVTNLWNGRQVVVRINDRGPFHPDRLIDLSYAAAVKLGFVDKGTTEVLVETIALA---GV 193

Query: 189 DQ---------EYLRSTVMVNSATVLPLGCQYREEIVVIPYLLT 223
           D           YL+     N AT   L      E+V +P  +T
Sbjct: 194 DDRRDSDTGAYRYLQLGAFANPATAQGLRDSV-AEMVSVPVNVT 236


>gi|21232886|ref|NP_638803.1| rare lipoprotein A [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|188990135|ref|YP_001902145.1| exported rare lipoprotein A [Xanthomonas campestris pv. campestris
           str. B100]
 gi|21114718|gb|AAM42727.1| rare lipoprotein A [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|167731895|emb|CAP50079.1| exported rare lipoprotein A [Xanthomonas campestris pv. campestris]
          Length = 448

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 60/112 (53%), Positives = 73/112 (65%), Gaps = 1/112 (0%)

Query: 70  PYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY+++G+ YV       Y   G AS+YG  FHGRLT+N EVY     TAAH TLPLPS+ 
Sbjct: 116 PYEVLGKRYVVMDNPGDYVERGTASYYGSKFHGRLTSNKEVYDMYAFTAAHKTLPLPSFA 175

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            VTN +NG S+VVRVNDRGP+H  R+IDLS AAA  L +  +G   V V  L
Sbjct: 176 LVTNTDNGQSVVVRVNDRGPFHDGRVIDLSYAAAVKLGITGKGTGNVEVRGL 227


>gi|307610209|emb|CBW99764.1| hypothetical protein LPW_15311 [Legionella pneumophila 130b]
          Length = 273

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 69/157 (43%), Positives = 95/157 (60%), Gaps = 9/157 (5%)

Query: 64  RYFLGKPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTL 122
           RY     Y + GR Y V +  T Y   G+ASWYG  FH + T++GE Y    +TAAH TL
Sbjct: 77  RYGNPSEYYVDGRTYEVMKSSTGYKTRGIASWYGTKFHKQRTSSGEPYNMYVMTAAHKTL 136

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL-G 181
           PLP+YV+V N+ENG   +V+VNDRGP+H++R+IDLS AAA  L V  +G + V +E L G
Sbjct: 137 PLPTYVKVRNLENGKVAIVKVNDRGPFHADRVIDLSYAAALKLGVFPKGTAHVEIETLMG 196

Query: 182 MALLNGMDQEYLRSTVMVNSATVLPLGCQYREEIVVI 218
            A   G    YL++    + A    L  + +E++V I
Sbjct: 197 PA---GQGHYYLQAGAFSSEA----LAKRLKEKLVHI 226


>gi|297380746|gb|ADI35633.1| rare lipoprotein A [Helicobacter pylori v225d]
          Length = 315

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/134 (41%), Positives = 85/134 (63%), Gaps = 3/134 (2%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+  +WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 96  RPYQVGNKWYYPTKVDLGEKFDGIASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTV 155

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA--LL 185
           V+V N+EN +S +VR+NDRGP+ S+R+IDLSNAAA+ + +  +G + V +  LG    + 
Sbjct: 156 VKVINVENHLSTIVRINDRGPFVSDRIIDLSNAAARDIDMVRKGTASVRLIVLGFGGVIS 215

Query: 186 NGMDQEYLRSTVMV 199
           N  +Q +  S+  +
Sbjct: 216 NQYEQSFNASSSKI 229


>gi|302879987|ref|YP_003848551.1| rare lipoprotein A [Gallionella capsiferriformans ES-2]
 gi|302582776|gb|ADL56787.1| rare lipoprotein A [Gallionella capsiferriformans ES-2]
          Length = 302

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 77/114 (67%), Gaps = 1/114 (0%)

Query: 66  FLGKPYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           +  +PY  + + Y P   T  +   G+ASWYGK FHG+ T++GE Y    +TAAHPTLP+
Sbjct: 79  YANRPYSALDKSYTPLTQTGNFKQRGIASWYGKKFHGQRTSSGEKYDMYQMTAAHPTLPI 138

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           PSY RVT++ +G S+VVRVNDRGP+  +R+IDLS  AA  L +   G S+V +E
Sbjct: 139 PSYARVTHVASGKSVVVRVNDRGPFLHSRVIDLSYTAAHKLGITGSGSSEVEIE 192


>gi|302343277|ref|YP_003807806.1| rare lipoprotein A [Desulfarculus baarsii DSM 2075]
 gi|301639890|gb|ADK85212.1| rare lipoprotein A [Desulfarculus baarsii DSM 2075]
          Length = 255

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 75/114 (65%), Gaps = 1/114 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY + G+ Y P      +   G+ASWYG  FHG+ T+NGE+Y  E +TAAH  LP  +Y
Sbjct: 47  KPYTVFGKTYYPLPNADGFKETGVASWYGGQFHGKRTSNGEIYDMESMTAAHKLLPFGTY 106

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           V+VTN  NG S VVR+NDRGP+ S+R+IDLS AAA+ + +   G + V V  LG
Sbjct: 107 VQVTNTSNGKSTVVRINDRGPFVSDRVIDLSKAAAREIDMIGPGTASVEVLALG 160


>gi|240014976|ref|ZP_04721889.1| RlpA-like protein precursor [Neisseria gonorrhoeae DGI18]
 gi|240122045|ref|ZP_04735007.1| RlpA-like protein precursor [Neisseria gonorrhoeae PID24-1]
          Length = 228

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 51/95 (53%), Positives = 67/95 (70%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           +   G ASWYG  FHGR T+ G+ Y     TAAH TLP+PS+VRVTN +NG S++VRVND
Sbjct: 47  FTQTGNASWYGDRFHGRKTSGGDRYDMNAFTAAHKTLPIPSHVRVTNTKNGKSVIVRVND 106

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+H NR+ID+S AAA+ L    +G + V +E +
Sbjct: 107 RGPFHGNRIIDVSKAAAQKLGFVSQGTAHVKIEQI 141


>gi|71065488|ref|YP_264215.1| lipoprotein A family protein [Psychrobacter arcticus 273-4]
 gi|71038473|gb|AAZ18781.1| possible rare lipoprotein A family [Psychrobacter arcticus 273-4]
          Length = 206

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 51/93 (54%), Positives = 67/93 (72%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           +   G+ASWYG+ FHGR TA+GE +    +TAAH +LPL  YVRVTN  NG S++V+VND
Sbjct: 107 FKQTGLASWYGRQFHGRKTASGETFDMNGLTAAHRSLPLNCYVRVTNKTNGKSVIVKVND 166

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           RGP+H NR++DLS  AAK L +  +GV  V +E
Sbjct: 167 RGPFHGNRVMDLSYGAAKKLGITAKGVGNVSIE 199


>gi|93006312|ref|YP_580749.1| rare lipoprotein A [Psychrobacter cryohalolentis K5]
 gi|92393990|gb|ABE75265.1| rare lipoprotein A [Psychrobacter cryohalolentis K5]
          Length = 206

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 51/93 (54%), Positives = 67/93 (72%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           +   G+ASWYG+ FHGR TA+GE +    +TAAH +LPL  YVRVTN  NG S++V+VND
Sbjct: 107 FKQTGLASWYGRQFHGRKTASGETFDMNGLTAAHRSLPLNCYVRVTNKTNGKSVIVKVND 166

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           RGP+H NR++DLS  AAK L +  +GV  V +E
Sbjct: 167 RGPFHGNRVMDLSYGAAKKLGITAKGVGNVAIE 199


>gi|332968422|gb|EGK07489.1| rare lipoprotein A [Kingella kingae ATCC 23330]
          Length = 264

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 53/111 (47%), Positives = 75/111 (67%), Gaps = 1/111 (0%)

Query: 71  YQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G+ Y P++    ++  G ASWYG  F G+ T++GE +    +TAAHPTLP+ SY R
Sbjct: 65  YKVAGKRYYPQKNVQDFSQTGRASWYGPGFQGKRTSSGERFDMHKLTAAHPTLPISSYAR 124

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VTN+ NG S+VVR+NDRGP+HS+R++D+S  AA  L     G + V VE L
Sbjct: 125 VTNLSNGRSVVVRINDRGPFHSSRVLDVSREAANKLGFLNAGTANVRVEAL 175


>gi|317401274|gb|EFV81914.1| rare lipoprotein A [Achromobacter xylosoxidans C54]
          Length = 222

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 77/114 (67%), Gaps = 1/114 (0%)

Query: 69  KPYQIMGRWYVPRQY-TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY + G+ YVP      Y   G+ASWYGK FHG  T+ GE Y    +TAAH TLP+PSY
Sbjct: 67  RPYVVFGQRYVPDTSGQPYKRQGIASWYGKKFHGNSTSIGEPYDMYAMTAAHTTLPIPSY 126

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
            RVT++ NG ++VVRVNDRGP+HS+R++DLS  AA  L +   G  +V VE +G
Sbjct: 127 ARVTSLVNGKTIVVRVNDRGPFHSDRIMDLSYVAAYKLGIIGPGSGQVVVESIG 180


>gi|257092331|ref|YP_003165972.1| rare lipoprotein A [Candidatus Accumulibacter phosphatis clade IIA
           str. UW-1]
 gi|257044855|gb|ACV34043.1| rare lipoprotein A [Candidatus Accumulibacter phosphatis clade IIA
           str. UW-1]
          Length = 357

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 79/116 (68%), Gaps = 1/116 (0%)

Query: 66  FLGKPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           F  +PY ++G+ Y P+     +   G+ASWYGK FHG+ T+ GE Y    +TAAHPTL +
Sbjct: 95  FANRPYIVLGKAYEPQTSLRPHQERGVASWYGKKFHGQKTSIGEPYDMFSMTAAHPTLAI 154

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           PSY RVTN+ NG S+VVRV DRGP+H++R+IDLS AAA  L   + G + V +E +
Sbjct: 155 PSYARVTNVSNGRSVVVRVTDRGPFHADRVIDLSYAAAYRLGYVDNGSTLVQLEAI 210


>gi|255321101|ref|ZP_05362268.1| conserved hypothetical protein [Acinetobacter radioresistens SK82]
 gi|262379489|ref|ZP_06072645.1| rare lipoprotein A family protein [Acinetobacter radioresistens
           SH164]
 gi|255301840|gb|EET81090.1| conserved hypothetical protein [Acinetobacter radioresistens SK82]
 gi|262298946|gb|EEY86859.1| rare lipoprotein A family protein [Acinetobacter radioresistens
           SH164]
          Length = 203

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 50/93 (53%), Positives = 68/93 (73%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           ++  G+ASWYG+ FHGR TA+GE +    +TAAH +LPL  Y+RVTN  NG S++V+VND
Sbjct: 104 FSQTGVASWYGRQFHGRKTASGETFDMNAMTAAHRSLPLNCYIRVTNRSNGKSVIVKVND 163

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           RGP+H NR++DLS  AAK + V   G +KV +E
Sbjct: 164 RGPFHGNRVLDLSYGAAKSIGVTNAGTAKVSIE 196


>gi|308062854|gb|ADO04742.1| rare lipoprotein A [Helicobacter pylori Cuz20]
          Length = 315

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 77/115 (66%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+  +WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 96  RPYQVGNKWYYPTKVDLGEKFDGIASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTV 155

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           V+V N+EN +S +VR+NDRGP+ S+R+IDLSNAAA+ + +  +G + V +  LG 
Sbjct: 156 VKVINVENHLSTIVRINDRGPFVSDRIIDLSNAAARDIDMVRKGTASVRLIVLGF 210


>gi|77918828|ref|YP_356643.1| lipoproteins [Pelobacter carbinolicus DSM 2380]
 gi|77544911|gb|ABA88473.1| lipoprotein [Pelobacter carbinolicus DSM 2380]
          Length = 254

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/119 (48%), Positives = 76/119 (63%), Gaps = 1/119 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY + G  Y P      +   G+ASWYG  FHG+ T+NGE+Y    +TAAH TLPL ++
Sbjct: 44  KPYTVNGNLYQPMSSCEGFVQEGLASWYGPKFHGKKTSNGEIYDMHAMTAAHKTLPLGTH 103

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLN 186
           VRV N  NG   +VR+NDRGP+  NR+IDLS  AA  L+V   G + V +E LGMA ++
Sbjct: 104 VRVVNKNNGHQEIVRINDRGPFVGNRIIDLSYEAAMRLQVVGPGTAPVRIEALGMAAVD 162


>gi|124268712|ref|YP_001022716.1| putative lipoprotein [Methylibium petroleiphilum PM1]
 gi|124261487|gb|ABM96481.1| putative lipoprotein [Methylibium petroleiphilum PM1]
          Length = 331

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 76/113 (67%), Gaps = 2/113 (1%)

Query: 69  KPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY+++GR Y P  +       G+ASWYG+ FHGR TA+GE+Y    +TAAH T+PLPSY
Sbjct: 75  KPYEVLGRNYTPETRDVPIKEKGLASWYGRKFHGRKTASGEIYNMHAMTAAHKTMPLPSY 134

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            RV N  NG  +VVR+NDRGP+ + R+IDLS  AA  L +  RGV  V VE +
Sbjct: 135 ARVRNPANGREVVVRINDRGPFVAGRVIDLSYTAALKLDL-LRGVGPVEVERI 186


>gi|239999820|ref|ZP_04719744.1| RlpA-like protein precursor [Neisseria gonorrhoeae 35/02]
 gi|240017424|ref|ZP_04723964.1| RlpA-like protein precursor [Neisseria gonorrhoeae FA6140]
 gi|240081566|ref|ZP_04726109.1| RlpA-like protein precursor [Neisseria gonorrhoeae FA19]
 gi|240124342|ref|ZP_04737298.1| RlpA-like protein precursor [Neisseria gonorrhoeae PID332]
 gi|254494602|ref|ZP_05107773.1| RlpA-like protein [Neisseria gonorrhoeae 1291]
 gi|268595630|ref|ZP_06129797.1| RlpA-like protein [Neisseria gonorrhoeae 35/02]
 gi|268597662|ref|ZP_06131829.1| RlpA-like protein [Neisseria gonorrhoeae FA19]
 gi|268682969|ref|ZP_06149831.1| RlpA-like protein [Neisseria gonorrhoeae PID332]
 gi|226513642|gb|EEH62987.1| RlpA-like protein [Neisseria gonorrhoeae 1291]
 gi|268549019|gb|EEZ44437.1| RlpA-like protein [Neisseria gonorrhoeae 35/02]
 gi|268551450|gb|EEZ46469.1| RlpA-like protein [Neisseria gonorrhoeae FA19]
 gi|268623253|gb|EEZ55653.1| RlpA-like protein [Neisseria gonorrhoeae PID332]
 gi|317165110|gb|ADV08651.1| hypothetical protein NGTW08_1694 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 228

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 51/95 (53%), Positives = 67/95 (70%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           +   G ASWYG  FHGR T+ G+ Y     TAAH TLP+PS+VRVTN +NG S++VRVND
Sbjct: 47  FTQTGNASWYGGRFHGRKTSGGDRYDMNAFTAAHKTLPIPSHVRVTNTKNGKSVIVRVND 106

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+H NR+ID+S AAA+ L    +G + V +E +
Sbjct: 107 RGPFHGNRIIDVSKAAAQKLGFVSQGTAHVKIEQI 141


>gi|59802049|ref|YP_208761.1| hypothetical protein NGO1728 [Neisseria gonorrhoeae FA 1090]
 gi|194099621|ref|YP_002002752.1| RlpA-like protein precursor [Neisseria gonorrhoeae NCCP11945]
 gi|240113845|ref|ZP_04728335.1| RlpA-like protein precursor [Neisseria gonorrhoeae MS11]
 gi|240116579|ref|ZP_04730641.1| RlpA-like protein precursor [Neisseria gonorrhoeae PID18]
 gi|240118803|ref|ZP_04732865.1| RlpA-like protein precursor [Neisseria gonorrhoeae PID1]
 gi|260439660|ref|ZP_05793476.1| RlpA-like protein precursor [Neisseria gonorrhoeae DGI2]
 gi|268599913|ref|ZP_06134080.1| RlpA-like protein [Neisseria gonorrhoeae MS11]
 gi|268602248|ref|ZP_06136415.1| RlpA-like protein [Neisseria gonorrhoeae PID18]
 gi|268604514|ref|ZP_06138681.1| RlpA-like protein [Neisseria gonorrhoeae PID1]
 gi|291042901|ref|ZP_06568642.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|293398089|ref|ZP_06642294.1| rare lipoprotein A [Neisseria gonorrhoeae F62]
 gi|59718944|gb|AAW90349.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090]
 gi|193934911|gb|ACF30735.1| RlpA-like protein precursor [Neisseria gonorrhoeae NCCP11945]
 gi|268584044|gb|EEZ48720.1| RlpA-like protein [Neisseria gonorrhoeae MS11]
 gi|268586379|gb|EEZ51055.1| RlpA-like protein [Neisseria gonorrhoeae PID18]
 gi|268588645|gb|EEZ53321.1| RlpA-like protein [Neisseria gonorrhoeae PID1]
 gi|291013335|gb|EFE05301.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|291611352|gb|EFF40422.1| rare lipoprotein A [Neisseria gonorrhoeae F62]
          Length = 228

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 72/112 (64%)

Query: 69  KPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           KP ++        +   +   G ASWYG  FHGR T+ G+ Y     TAAH TLP+PS+V
Sbjct: 30  KPEKLHASANRSYKVAEFTQTGNASWYGGRFHGRKTSGGDRYDMNAFTAAHKTLPIPSHV 89

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RVTN +NG S++VRVNDRGP+H NR+ID+S AAA+ L    +G + V +E +
Sbjct: 90  RVTNTKNGKSVIVRVNDRGPFHGNRIIDVSKAAAQKLGFVSQGTAHVKIEQI 141


>gi|226952728|ref|ZP_03823192.1| rare lipoprotein A family protein [Acinetobacter sp. ATCC 27244]
 gi|294650050|ref|ZP_06727437.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
 gi|226836519|gb|EEH68902.1| rare lipoprotein A family protein [Acinetobacter sp. ATCC 27244]
 gi|292824060|gb|EFF82876.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
          Length = 203

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 50/93 (53%), Positives = 69/93 (74%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           ++  G+ASWYG+ FHGR TA+GE +    +TAAH +LPL  Y+RVTN +NG S+VV+VND
Sbjct: 104 FSQTGVASWYGRQFHGRKTASGETFDMNAMTAAHRSLPLNCYIRVTNRDNGKSVVVKVND 163

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           RGP+H NR++DLS  AAK + +   G+ KV +E
Sbjct: 164 RGPFHGNRVLDLSYGAAKQIGLTNAGLGKVSIE 196


>gi|241784964|ref|XP_002414409.1| conserved hypothetical protein [Ixodes scapularis]
 gi|215508620|gb|EEC18074.1| conserved hypothetical protein [Ixodes scapularis]
          Length = 242

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 73/113 (64%), Gaps = 8/113 (7%)

Query: 83  YTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVR 142
           + A+   G ASWYG+ FHG+ TANGE Y    +TAAHPTLP+PSY RVT  + G S++VR
Sbjct: 3   HKAFTQTGTASWYGRKFHGKKTANGETYDMYAMTAAHPTLPIPSYARVTRPKTGKSVIVR 62

Query: 143 VNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRS 195
           +NDRGP+HS+R+IDLS  AA  L +   G   V VE +         QE +RS
Sbjct: 63  INDRGPFHSSRIIDLSYVAAAKLDLIAPGSGTVVVETI--------TQEEIRS 107


>gi|313672048|ref|YP_004050159.1| rare lipoprotein a [Calditerrivibrio nitroreducens DSM 19672]
 gi|312938804|gb|ADR17996.1| rare lipoprotein A [Calditerrivibrio nitroreducens DSM 19672]
          Length = 258

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 80/125 (64%), Gaps = 5/125 (4%)

Query: 68  GKPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
           GKPY + G  Y P  Y   Y   G+ASWYG  FHG+ T++ EVY    +TAAH TLPL S
Sbjct: 56  GKPYTVFGVTYYPMDYIHKYEEEGIASWYGADFHGKTTSSKEVYNMYDMTAAHKTLPLGS 115

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA--- 183
            V V ++EN   +VVR+NDRGP+  +R+IDLS  AAK L ++++G ++V V  L  +   
Sbjct: 116 TVLVKSLENDREVVVRINDRGPFVKDRIIDLSYKAAKELGIDQKGTARVRVTLLSESPNQ 175

Query: 184 -LLNG 187
            +LNG
Sbjct: 176 FVLNG 180


>gi|167564470|ref|ZP_02357386.1| rare lipoprotein A family protein [Burkholderia oklahomensis EO147]
 gi|167571620|ref|ZP_02364494.1| rare lipoprotein A family protein [Burkholderia oklahomensis C6786]
          Length = 210

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 71/109 (65%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWYGK FHGR TANGE +    +TAAH TLPL SYVRVTN  NG S+VV++NDRGP
Sbjct: 100 TGRASWYGKGFHGRRTANGERFNMNELTAAHRTLPLASYVRVTNQANGKSVVVKINDRGP 159

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTV 197
           +   R++DLS AAAK++ +   G ++V ++ L  A       E L S  
Sbjct: 160 FSRGRILDLSYAAAKVIGLVHAGTARVKIQGLSPAEARVARDETLASNA 208


>gi|240129016|ref|ZP_04741677.1| RlpA-like protein precursor [Neisseria gonorrhoeae SK-93-1035]
 gi|268687396|ref|ZP_06154258.1| periplasmic protein [Neisseria gonorrhoeae SK-93-1035]
 gi|268627680|gb|EEZ60080.1| periplasmic protein [Neisseria gonorrhoeae SK-93-1035]
          Length = 201

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 51/95 (53%), Positives = 67/95 (70%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           +   G ASWYG  FHGR T+ G+ Y     TAAH TLP+PS+VRVTN +NG S++VRVND
Sbjct: 20  FTQTGNASWYGGRFHGRKTSGGDRYDMNAFTAAHKTLPIPSHVRVTNTKNGKSVIVRVND 79

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+H NR+ID+S AAA+ L    +G + V +E +
Sbjct: 80  RGPFHGNRIIDVSKAAAQKLGFVSQGTAHVKIEQI 114


>gi|121600062|ref|YP_994678.1| rare lipoprotein A family protein [Burkholderia mallei SAVP1]
 gi|124384117|ref|YP_001027611.1| rare lipoprotein A family protein [Burkholderia mallei NCTC 10229]
 gi|251767400|ref|ZP_02267102.2| rare lipoprotein A family protein [Burkholderia mallei PRL-20]
 gi|254174887|ref|ZP_04881548.1| rare lipoprotein A family protein [Burkholderia mallei ATCC 10399]
 gi|254194578|ref|ZP_04901009.1| rare lipoprotein A family protein [Burkholderia pseudomallei S13]
 gi|254357140|ref|ZP_04973414.1| rare lipoprotein A family protein [Burkholderia mallei 2002721280]
 gi|121228872|gb|ABM51390.1| rare lipoprotein A family protein [Burkholderia mallei SAVP1]
 gi|124292137|gb|ABN01406.1| rare lipoprotein A family protein [Burkholderia mallei NCTC 10229]
 gi|148026204|gb|EDK84289.1| rare lipoprotein A family protein [Burkholderia mallei 2002721280]
 gi|160695932|gb|EDP85902.1| rare lipoprotein A family protein [Burkholderia mallei ATCC 10399]
 gi|169651328|gb|EDS84021.1| rare lipoprotein A family protein [Burkholderia pseudomallei S13]
 gi|243062919|gb|EES45105.1| rare lipoprotein A family protein [Burkholderia mallei PRL-20]
          Length = 242

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/92 (56%), Positives = 66/92 (71%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWYGK FHGR TANGE +     TAAH TLPL SYVRVTN  NG S+VV++NDRGP
Sbjct: 131 TGRASWYGKGFHGRRTANGERFNMNEFTAAHRTLPLASYVRVTNQANGKSVVVKINDRGP 190

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +   R++DLS AAAK++ +   G ++V ++ L
Sbjct: 191 FSRGRILDLSYAAAKVIGLVHAGTARVKIQGL 222


>gi|329298824|ref|ZP_08256160.1| rare lipoprotein A [Plautia stali symbiont]
          Length = 364

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 58/114 (50%), Positives = 77/114 (67%), Gaps = 3/114 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y I G+ Y V +  + Y+ VG+A+WYG+   G  TA GE Y  + ++AAHPTLPLPSYVR
Sbjct: 59  YSINGKTYRVIKDPSNYSEVGLATWYGEEAQGNRTALGETYDPDALSAAHPTLPLPSYVR 118

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VTN+ NG  +VVRVNDRGPY   R+IDLS AA   L +     ++V V+Y+ +A
Sbjct: 119 VTNLANGRQIVVRVNDRGPYTPGRIIDLSRAAGDRLNISNN--TRVRVDYIKVA 170


>gi|83720801|ref|YP_443644.1| rare lipoprotein A family protein [Burkholderia thailandensis E264]
 gi|167582677|ref|ZP_02375551.1| rare lipoprotein A family protein [Burkholderia thailandensis
           TXDOH]
 gi|167620791|ref|ZP_02389422.1| rare lipoprotein A family protein [Burkholderia thailandensis Bt4]
 gi|83654626|gb|ABC38689.1| rare lipoprotein A family protein [Burkholderia thailandensis E264]
          Length = 211

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/92 (56%), Positives = 67/92 (72%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWYGK FHGR TANGE +    +TAAH TLPL SYVRVTN  NG S+VV++NDRGP
Sbjct: 100 TGRASWYGKGFHGRRTANGERFNMNELTAAHRTLPLASYVRVTNQANGKSVVVKINDRGP 159

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +   R++DLS AAAK++ +   G ++V ++ L
Sbjct: 160 FSRGRILDLSYAAAKVIGLVRAGTARVKIQGL 191


>gi|254298824|ref|ZP_04966275.1| rare lipoprotein A family protein [Burkholderia pseudomallei 406e]
 gi|157808655|gb|EDO85825.1| rare lipoprotein A family protein [Burkholderia pseudomallei 406e]
          Length = 189

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/92 (56%), Positives = 66/92 (71%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWYGK FHGR TANGE +     TAAH TLPL SYVRVTN  NG S+VV++NDRGP
Sbjct: 78  TGRASWYGKGFHGRRTANGERFNMNEFTAAHRTLPLASYVRVTNQANGKSVVVKINDRGP 137

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +   R++DLS AAAK++ +   G ++V ++ L
Sbjct: 138 FSRGRILDLSYAAAKVIGLVRAGTARVKIQGL 169


>gi|224371985|ref|YP_002606151.1| RlpA-like lipoprotein precursor [Desulfobacterium autotrophicum
           HRM2]
 gi|223694704|gb|ACN17987.1| RlpA-like lipoprotein precursor [Desulfobacterium autotrophicum
           HRM2]
          Length = 264

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 60/116 (51%), Positives = 76/116 (65%), Gaps = 1/116 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY+I G+ Y P      +   G ASWYGK FHGR TANGE+Y    +TAAH TLPL ++
Sbjct: 53  KPYKIDGKTYRPIVSSKGFLQTGKASWYGKKFHGRKTANGEIYDMYAMTAAHKTLPLGTW 112

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VRV N+ N  S++VRVNDRGP+ + R+IDLS  AA+ + V   G + V V  LG A
Sbjct: 113 VRVENLSNQKSVIVRVNDRGPFVTGRIIDLSYTAAEKIGVVGPGTAPVKVTALGRA 168


>gi|238758037|ref|ZP_04619218.1| Rare lipoprotein A [Yersinia aldovae ATCC 35236]
 gi|238703791|gb|EEP96327.1| Rare lipoprotein A [Yersinia aldovae ATCC 35236]
          Length = 370

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 54/121 (44%), Positives = 77/121 (63%), Gaps = 2/121 (1%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           +  VG+A+WYG+  +G  TA GE++    +TAAHPTLP+PSYVRVTN+ NG  +VVRVND
Sbjct: 74  FTQVGLAAWYGEEANGNATATGEIFDPNALTAAHPTLPIPSYVRVTNVSNGRQIVVRVND 133

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNSATVL 205
           RGPY   R+IDLS AAA  L +     +KV ++++ +A    +    +  T +   +  L
Sbjct: 134 RGPYTPGRVIDLSKAAADRLNISNN--TKVKIDFINVAPDGSLSGPGMVGTTIAKQSYAL 191

Query: 206 P 206
           P
Sbjct: 192 P 192


>gi|238790458|ref|ZP_04634228.1| Rare lipoprotein A [Yersinia frederiksenii ATCC 33641]
 gi|238721484|gb|EEQ13154.1| Rare lipoprotein A [Yersinia frederiksenii ATCC 33641]
          Length = 372

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 85/140 (60%), Gaps = 9/140 (6%)

Query: 71  YQIMGRWYV----PRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
           Y+  G+ Y     P+ +T    VG+A+WYG+  +G  TA GE++    +TAAHPTLP+PS
Sbjct: 58  YKANGQSYTIVKDPQNFTQ---VGLAAWYGEEANGNATATGEIFDPNALTAAHPTLPIPS 114

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLN 186
           YVRVTN+ NG  +VVRVNDRGPY   R+IDLS AAA  L +     +KV ++++ +A   
Sbjct: 115 YVRVTNVSNGRQIVVRVNDRGPYTPGRVIDLSKAAADRLNISNN--TKVKIDFINVAPDG 172

Query: 187 GMDQEYLRSTVMVNSATVLP 206
            +    +  T +   +  LP
Sbjct: 173 SLSGPGMVGTTIAKQSYALP 192


>gi|254186331|ref|ZP_04892848.1| rare lipoprotein A family protein [Burkholderia pseudomallei
           Pasteur 52237]
 gi|157934016|gb|EDO89686.1| rare lipoprotein A family protein [Burkholderia pseudomallei
           Pasteur 52237]
          Length = 230

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/92 (56%), Positives = 66/92 (71%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWYGK FHGR TANGE +     TAAH TLPL SYVRVTN  NG S+VV++NDRGP
Sbjct: 119 TGRASWYGKGFHGRRTANGERFNMNEFTAAHRTLPLASYVRVTNQANGKSVVVKINDRGP 178

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +   R++DLS AAAK++ +   G ++V ++ L
Sbjct: 179 FSRGRILDLSYAAAKVIGLVRAGTARVKIQGL 210


>gi|126440537|ref|YP_001060815.1| rare lipoprotein A family protein [Burkholderia pseudomallei 668]
 gi|134281593|ref|ZP_01768301.1| rare lipoprotein A family protein [Burkholderia pseudomallei 305]
 gi|217424035|ref|ZP_03455535.1| rare lipoprotein A family protein [Burkholderia pseudomallei 576]
 gi|126220030|gb|ABN83536.1| rare lipoprotein A family protein [Burkholderia pseudomallei 668]
 gi|134247260|gb|EBA47346.1| rare lipoprotein A family protein [Burkholderia pseudomallei 305]
 gi|217393098|gb|EEC33120.1| rare lipoprotein A family protein [Burkholderia pseudomallei 576]
          Length = 230

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/92 (56%), Positives = 66/92 (71%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWYGK FHGR TANGE +     TAAH TLPL SYVRVTN  NG S+VV++NDRGP
Sbjct: 119 TGRASWYGKGFHGRRTANGERFNMNEFTAAHRTLPLASYVRVTNQANGKSVVVKINDRGP 178

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +   R++DLS AAAK++ +   G ++V ++ L
Sbjct: 179 FSRGRILDLSYAAAKVIGLVHAGTARVKIQGL 210


>gi|53723973|ref|YP_104418.1| rare lipoprotein A family protein [Burkholderia mallei ATCC 23344]
 gi|237814212|ref|YP_002898663.1| rare lipoprotein A family protein [Burkholderia pseudomallei
           MSHR346]
 gi|254260326|ref|ZP_04951380.1| rare lipoprotein A family protein [Burkholderia pseudomallei 1710a]
 gi|52427396|gb|AAU47989.1| rare lipoprotein A family protein [Burkholderia mallei ATCC 23344]
 gi|237505428|gb|ACQ97746.1| rare lipoprotein A family protein [Burkholderia pseudomallei
           MSHR346]
 gi|254219015|gb|EET08399.1| rare lipoprotein A family protein [Burkholderia pseudomallei 1710a]
          Length = 230

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/92 (56%), Positives = 66/92 (71%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWYGK FHGR TANGE +     TAAH TLPL SYVRVTN  NG S+VV++NDRGP
Sbjct: 119 TGRASWYGKGFHGRRTANGERFNMNEFTAAHRTLPLASYVRVTNQANGKSVVVKINDRGP 178

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +   R++DLS AAAK++ +   G ++V ++ L
Sbjct: 179 FSRGRILDLSYAAAKVIGLVHAGTARVKIQGL 210


>gi|226193099|ref|ZP_03788709.1| rare lipoprotein A family protein [Burkholderia pseudomallei
           Pakistan 9]
 gi|225934699|gb|EEH30676.1| rare lipoprotein A family protein [Burkholderia pseudomallei
           Pakistan 9]
          Length = 230

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/92 (56%), Positives = 66/92 (71%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWYGK FHGR TANGE +     TAAH TLPL SYVRVTN  NG S+VV++NDRGP
Sbjct: 119 TGRASWYGKGFHGRRTANGERFNMNEFTAAHRTLPLASYVRVTNQANGKSVVVKINDRGP 178

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +   R++DLS AAAK++ +   G ++V ++ L
Sbjct: 179 FSRGRILDLSYAAAKVIGLVHAGTARVKIQGL 210


>gi|167912966|ref|ZP_02500057.1| rare lipoprotein A family protein [Burkholderia pseudomallei 112]
          Length = 211

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/92 (56%), Positives = 66/92 (71%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWYGK FHGR TANGE +     TAAH TLPL SYVRVTN  NG S+VV++NDRGP
Sbjct: 100 TGRASWYGKGFHGRRTANGERFNMNEFTAAHRTLPLASYVRVTNQANGKSVVVKINDRGP 159

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +   R++DLS AAAK++ +   G ++V ++ L
Sbjct: 160 FSRGRILDLSYAAAKVIGLVRAGTARVKIQGL 191


>gi|66767043|ref|YP_241805.1| rare lipoprotein A [Xanthomonas campestris pv. campestris str.
           8004]
 gi|66572375|gb|AAY47785.1| rare lipoprotein A [Xanthomonas campestris pv. campestris str.
           8004]
          Length = 451

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/112 (52%), Positives = 73/112 (65%), Gaps = 1/112 (0%)

Query: 70  PYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY+++G+ YV       Y   G AS+YG  FHGRLT+N EVY     +AAH TLPLPS+ 
Sbjct: 119 PYEVLGKRYVVMDNPGDYVERGTASYYGSKFHGRLTSNKEVYDMYAFSAAHKTLPLPSFA 178

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            VTN +NG S+VVRVNDRGP+H  R+IDLS AAA  L +  +G   V V  L
Sbjct: 179 LVTNTDNGQSVVVRVNDRGPFHDGRVIDLSYAAAVKLGITGKGTGNVEVRGL 230


>gi|317010262|gb|ADU80842.1| rare lipoprotein A [Helicobacter pylori India7]
          Length = 315

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 78/115 (67%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+  +WY P +        G+ASWYG  FH + T+NGE+Y     TAAH TLP+ + 
Sbjct: 96  RPYQVGRKWYYPTKVDLGEKFDGVASWYGPNFHAKKTSNGEIYNMYAHTAAHKTLPMNTV 155

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           V+V N++N +S +VR+NDRGP+ S+R+IDLSNAAA+ + + ++G + V +  LG 
Sbjct: 156 VKVINVDNNLSTIVRINDRGPFVSDRIIDLSNAAARDIDMVKKGTASVRLIVLGF 210


>gi|254183852|ref|ZP_04890443.1| rare lipoprotein A family protein [Burkholderia pseudomallei 1655]
 gi|184214384|gb|EDU11427.1| rare lipoprotein A family protein [Burkholderia pseudomallei 1655]
          Length = 189

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/92 (56%), Positives = 66/92 (71%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWYGK FHGR TANGE +     TAAH TLPL SYVRVTN  NG S+VV++NDRGP
Sbjct: 78  TGRASWYGKGFHGRRTANGERFNMNEFTAAHRTLPLASYVRVTNQANGKSVVVKINDRGP 137

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +   R++DLS AAAK++ +   G ++V ++ L
Sbjct: 138 FSRGRILDLSYAAAKVIGLVHAGTARVKIQGL 169


>gi|167838270|ref|ZP_02465129.1| rare lipoprotein A family protein [Burkholderia thailandensis
           MSMB43]
          Length = 210

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/92 (56%), Positives = 67/92 (72%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWYGK FHGR TANGE +    +TAAH TLPL SYVRVTN  NG S+VV++NDRGP
Sbjct: 100 TGRASWYGKGFHGRRTANGERFNMNELTAAHRTLPLASYVRVTNQANGKSVVVKINDRGP 159

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +   R++DLS AAAK++ +   G ++V ++ L
Sbjct: 160 FSRGRILDLSYAAAKVIGLVHAGTARVKIQGL 191


>gi|167744644|ref|ZP_02417418.1| rare lipoprotein A family protein [Burkholderia pseudomallei 14]
 gi|167851627|ref|ZP_02477135.1| rare lipoprotein A family protein [Burkholderia pseudomallei B7210]
          Length = 211

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 52/92 (56%), Positives = 66/92 (71%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWYGK FHGR TANGE +     TAAH TLPL SYVRVTN  NG S+VV++NDRGP
Sbjct: 100 TGRASWYGKGFHGRRTANGERFNMNEFTAAHRTLPLASYVRVTNQANGKSVVVKINDRGP 159

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +   R++DLS AAAK++ +   G ++V ++ L
Sbjct: 160 FSRGRILDLSYAAAKVIGLVRAGTARVKIQGL 191


>gi|67643051|ref|ZP_00441800.1| rare lipoprotein A family protein [Burkholderia mallei GB8 horse 4]
 gi|242315990|ref|ZP_04815006.1| rare lipoprotein A family protein [Burkholderia pseudomallei 1106b]
 gi|254201493|ref|ZP_04907857.1| rare lipoprotein A family protein [Burkholderia mallei FMH]
 gi|254206832|ref|ZP_04913183.1| rare lipoprotein A family protein [Burkholderia mallei JHU]
 gi|147747387|gb|EDK54463.1| rare lipoprotein A family protein [Burkholderia mallei FMH]
 gi|147752374|gb|EDK59440.1| rare lipoprotein A family protein [Burkholderia mallei JHU]
 gi|238524295|gb|EEP87728.1| rare lipoprotein A family protein [Burkholderia mallei GB8 horse 4]
 gi|242139229|gb|EES25631.1| rare lipoprotein A family protein [Burkholderia pseudomallei 1106b]
          Length = 189

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 52/92 (56%), Positives = 66/92 (71%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWYGK FHGR TANGE +     TAAH TLPL SYVRVTN  NG S+VV++NDRGP
Sbjct: 78  TGRASWYGKGFHGRRTANGERFNMNEFTAAHRTLPLASYVRVTNQANGKSVVVKINDRGP 137

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +   R++DLS AAAK++ +   G ++V ++ L
Sbjct: 138 FSRGRILDLSYAAAKVIGLVHAGTARVKIQGL 169


>gi|167826214|ref|ZP_02457685.1| rare lipoprotein A family protein [Burkholderia pseudomallei 9]
          Length = 211

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 52/92 (56%), Positives = 66/92 (71%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWYGK FHGR TANGE +     TAAH TLPL SYVRVTN  NG S+VV++NDRGP
Sbjct: 100 TGRASWYGKGFHGRRTANGERFNMNEFTAAHRTLPLASYVRVTNQANGKSVVVKINDRGP 159

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +   R++DLS AAAK++ +   G ++V ++ L
Sbjct: 160 FSRGRILDLSYAAAKVIGLVHAGTARVKIQGL 191


>gi|167721645|ref|ZP_02404881.1| rare lipoprotein A family protein [Burkholderia pseudomallei DM98]
 gi|167896311|ref|ZP_02483713.1| rare lipoprotein A family protein [Burkholderia pseudomallei 7894]
 gi|167904685|ref|ZP_02491890.1| rare lipoprotein A family protein [Burkholderia pseudomallei NCTC
           13177]
 gi|167924645|ref|ZP_02511736.1| rare lipoprotein A family protein [Burkholderia pseudomallei
           BCC215]
          Length = 211

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 52/92 (56%), Positives = 66/92 (71%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWYGK FHGR TANGE +     TAAH TLPL SYVRVTN  NG S+VV++NDRGP
Sbjct: 100 TGRASWYGKGFHGRRTANGERFNMNEFTAAHRTLPLASYVRVTNQANGKSVVVKINDRGP 159

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +   R++DLS AAAK++ +   G ++V ++ L
Sbjct: 160 FSRGRILDLSYAAAKVIGLVHAGTARVKIQGL 191


>gi|53720886|ref|YP_109872.1| putative RlpA-like lipoprotein [Burkholderia pseudomallei K96243]
 gi|76810357|ref|YP_331460.1| rare lipoprotein A family protein [Burkholderia pseudomallei 1710b]
 gi|126448745|ref|YP_001082490.1| rare lipoprotein A family protein [Burkholderia mallei NCTC 10247]
 gi|126451953|ref|YP_001068122.1| rare lipoprotein A family protein [Burkholderia pseudomallei 1106a]
 gi|167817836|ref|ZP_02449516.1| rare lipoprotein A family protein [Burkholderia pseudomallei 91]
 gi|52211300|emb|CAH37289.1| putative RlpA-like lipoprotein [Burkholderia pseudomallei K96243]
 gi|76579810|gb|ABA49285.1| rare lipoprotein A family protein [Burkholderia pseudomallei 1710b]
 gi|126225595|gb|ABN89135.1| rare lipoprotein A family protein [Burkholderia pseudomallei 1106a]
 gi|126241615|gb|ABO04708.1| rare lipoprotein A family protein [Burkholderia mallei NCTC 10247]
          Length = 211

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 52/92 (56%), Positives = 66/92 (71%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWYGK FHGR TANGE +     TAAH TLPL SYVRVTN  NG S+VV++NDRGP
Sbjct: 100 TGRASWYGKGFHGRRTANGERFNMNEFTAAHRTLPLASYVRVTNQANGKSVVVKINDRGP 159

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +   R++DLS AAAK++ +   G ++V ++ L
Sbjct: 160 FSRGRILDLSYAAAKVIGLVHAGTARVKIQGL 191


>gi|114319337|ref|YP_741020.1| rare lipoprotein A [Alkalilimnicola ehrlichii MLHE-1]
 gi|114225731|gb|ABI55530.1| rare lipoprotein A [Alkalilimnicola ehrlichii MLHE-1]
          Length = 324

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 81/129 (62%), Gaps = 3/129 (2%)

Query: 58  VPRGGGRYFLGKP--YQIMGR-WYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEY 114
           VPR   R   G P  Y++ G+ +YV      Y   G+ASWYG  FHGR T++GE Y    
Sbjct: 54  VPRDEPRARYGNPARYEVFGQTYYVKDSAEGYDQEGIASWYGTKFHGRRTSSGEPYDMYA 113

Query: 115 ITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSK 174
           +TAAH +LPLP+Y  VTN++NG  +VVR+NDRGP+  NR+IDLS AAA  L + + G + 
Sbjct: 114 MTAAHRSLPLPTYAEVTNLDNGKRVVVRINDRGPFVDNRIIDLSYAAATRLDMVDAGTAP 173

Query: 175 VHVEYLGMA 183
           V V  +  A
Sbjct: 174 VRVRTVTAA 182


>gi|32266823|ref|NP_860855.1| rare lipoprotein A [Helicobacter hepaticus ATCC 51449]
 gi|32262875|gb|AAP77921.1| rare lipoprotein A [Helicobacter hepaticus ATCC 51449]
          Length = 298

 Score =  112 bits (281), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 53/116 (45%), Positives = 75/116 (64%), Gaps = 1/116 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+ G+WY P + +      G ASWYG  FH + T+NGE Y     TAAH T P+ + 
Sbjct: 75  RPYQVAGKWYYPEKVSLGDKFDGYASWYGPDFHSKKTSNGETYNMYAHTAAHKTFPMNTV 134

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           V+V N+ENG S +VR+NDRGP+   R+IDLS+AAA  + + + G +KV +E +G  
Sbjct: 135 VKVLNVENGKSTIVRINDRGPFVEGRIIDLSSAAAHDIDMVKVGTAKVRLEVIGFG 190


>gi|238785718|ref|ZP_04629692.1| Rare lipoprotein A [Yersinia bercovieri ATCC 43970]
 gi|238713358|gb|EEQ05396.1| Rare lipoprotein A [Yersinia bercovieri ATCC 43970]
          Length = 342

 Score =  112 bits (281), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 56/137 (40%), Positives = 83/137 (60%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G  Y + +    ++  G+A+WYG+  +G  TA GE +    +TAAHPTLP+PSYVR
Sbjct: 30  YKVNGHSYSIIKDPQNFSQTGLAAWYGEEANGNTTATGETFDPNALTAAHPTLPIPSYVR 89

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN+ NG  +VVRVNDRGPY   R+IDLS AAA  L +     +KV ++++ +A    + 
Sbjct: 90  VTNISNGRQIVVRVNDRGPYTPGRVIDLSKAAADRLNISNN--TKVKIDFINVAPDGSLS 147

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +   +  LP
Sbjct: 148 GPGMVGTTIAKQSYALP 164


>gi|238752595|ref|ZP_04614068.1| Rare lipoprotein A [Yersinia rohdei ATCC 43380]
 gi|238709186|gb|EEQ01431.1| Rare lipoprotein A [Yersinia rohdei ATCC 43380]
          Length = 370

 Score =  112 bits (281), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 78/121 (64%), Gaps = 2/121 (1%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           ++ +G+A+WYG+  +G  TA GE++    +TAAHPTLP+PSYVRVTN+ NG  +VVRVND
Sbjct: 74  FSQIGLAAWYGEEANGNSTATGEIFDPNALTAAHPTLPIPSYVRVTNVSNGRQIVVRVND 133

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNSATVL 205
           RGPY   R+IDLS AAA  L +     +KV ++++ +A    +    +  T +   +  L
Sbjct: 134 RGPYTPGRVIDLSKAAADRLNISNN--TKVKIDFINVAPDGSLSGPGMVGTTIAKQSYAL 191

Query: 206 P 206
           P
Sbjct: 192 P 192


>gi|117617610|ref|YP_857749.1| rare lipoprotein A [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|117559017|gb|ABK35965.1| rare lipoprotein A [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
          Length = 321

 Score =  112 bits (281), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 79/120 (65%), Gaps = 5/120 (4%)

Query: 61  GGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHP 120
           G   Y++GK  Q    W   R    Y+  G ASW  +   G+ TANG+V  ++  +AAH 
Sbjct: 60  GNRDYWIGK--QKNEVW---RDIKHYSEEGTASWLAQDLDGQKTANGDVQDSKLFSAAHR 114

Query: 121 TLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            LPLPSYVRVTN++NG+  +VRVNDRGP+ S+RLIDLS+AAAK L + E G ++V VE +
Sbjct: 115 NLPLPSYVRVTNLDNGLETIVRVNDRGPFGSDRLIDLSHAAAKQLEMVEGGEARVRVELI 174


>gi|325929506|ref|ZP_08190626.1| rare lipoprotein A [Xanthomonas perforans 91-118]
 gi|325540126|gb|EGD11748.1| rare lipoprotein A [Xanthomonas perforans 91-118]
          Length = 291

 Score =  112 bits (280), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 59/112 (52%), Positives = 72/112 (64%), Gaps = 1/112 (0%)

Query: 70  PYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY+++G+ YV       Y   G AS+YG  FHGRLT+N EVY     TAAH TLPLPS+ 
Sbjct: 116 PYEVLGKRYVVMDNPGDYVERGTASYYGNKFHGRLTSNKEVYDMYAFTAAHKTLPLPSFA 175

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            VTN + G S+VVRVNDRGP+H  R+IDLS AAA  L +  +G   V V  L
Sbjct: 176 LVTNTDTGQSVVVRVNDRGPFHDGRVIDLSYAAAVKLGITGKGTGNVEVRGL 227


>gi|94312363|ref|YP_585573.1| rare lipoprotein A [Cupriavidus metallidurans CH34]
 gi|93356215|gb|ABF10304.1| rare lipoprotein A-family protein [Cupriavidus metallidurans CH34]
          Length = 251

 Score =  112 bits (280), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 63/91 (69%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYGK FHGR TANGE +    +TAAHPTLPL S+V V N+ N    VVR+NDRGPY
Sbjct: 109 GTASWYGKGFHGRKTANGERFDMRAMTAAHPTLPLDSWVLVRNLSNNKVAVVRINDRGPY 168

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           H NR++DLS AAAK L     G +KV +  L
Sbjct: 169 HGNRILDLSYAAAKRLSFVNSGSTKVEIRRL 199


>gi|332701991|ref|ZP_08422079.1| rare lipoprotein A [Desulfovibrio africanus str. Walvis Bay]
 gi|332552140|gb|EGJ49184.1| rare lipoprotein A [Desulfovibrio africanus str. Walvis Bay]
          Length = 259

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 76/114 (66%), Gaps = 1/114 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY +MG  Y P +    YA  G+ASWYG+ FHG+ TANGE+Y     +AAH  LPL + 
Sbjct: 59  RPYTVMGETYHPLKSADGYAEEGLASWYGRDFHGKATANGEMYDMYKPSAAHKLLPLGTR 118

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           VRVTN+ENG S+ + +NDRGP+   R+IDLS  AA  L   ++GV+ V VE +G
Sbjct: 119 VRVTNLENGKSIYLTINDRGPFVKGRIIDLSYEAANRLGSLDKGVAMVRVESVG 172


>gi|303325980|ref|ZP_07356423.1| rare lipoprotein A [Desulfovibrio sp. 3_1_syn3]
 gi|302863896|gb|EFL86827.1| rare lipoprotein A [Desulfovibrio sp. 3_1_syn3]
          Length = 236

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 76/114 (66%), Gaps = 1/114 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY + G+ Y P +    +  VG ASWYG  FHG+ TANGE Y    +TAAH  LPL + 
Sbjct: 38  KPYTVRGKTYYPLKSAHGFVEVGTASWYGPGFHGKKTANGERYNQYAMTAAHKILPLGTK 97

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           VRVT++ NG S++VRVNDRGP+  +R+IDLS +AA  L +   G ++V V+ LG
Sbjct: 98  VRVTHLGNGRSIIVRVNDRGPFVDDRVIDLSRSAATRLNMMGTGTARVRVQSLG 151


>gi|157737222|ref|YP_001489905.1| rare lipoprotein A [Arcobacter butzleri RM4018]
 gi|157699076|gb|ABV67236.1| rare lipoprotein A [Arcobacter butzleri RM4018]
          Length = 314

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 61/149 (40%), Positives = 86/149 (57%), Gaps = 11/149 (7%)

Query: 69  KPYQIMGRWYVPRQYTAYAAVG-----MASWYGKAFHGRLTANGEVYGTEYITAAHPTLP 123
           +PY + G  Y P      A VG     +ASWYG  FH + T+NGE+Y    +TAAH TLP
Sbjct: 57  RPYTVFGIKYYPE----IAKVGERFNGIASWYGPDFHAKKTSNGEIYNMYAMTAAHKTLP 112

Query: 124 LPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM- 182
           + + VRV N++NG S +VR+NDRGP+ S R+IDLSN AA  + +  +G +KV +  LG  
Sbjct: 113 MNTVVRVDNLDNGRSTIVRINDRGPFVSGRIIDLSNKAAHEIDMVRKGTAKVQITVLGYN 172

Query: 183 -ALLNGMDQEYLRSTVMVNSATVLPLGCQ 210
             + N    + L     +NS+T    G +
Sbjct: 173 GEINNNEAPDVLTEKSPINSSTAFSGGTE 201


>gi|258544104|ref|ZP_05704338.1| rare lipoprotein A [Cardiobacterium hominis ATCC 15826]
 gi|258520657|gb|EEV89516.1| rare lipoprotein A [Cardiobacterium hominis ATCC 15826]
          Length = 223

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 70/114 (61%), Gaps = 6/114 (5%)

Query: 67  LGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
           LGK YQ +           +   G ASWYG  FHGR TANGE Y    +TAAH  LPL +
Sbjct: 115 LGKRYQTLA------DSKGFEQQGPASWYGNPFHGRKTANGETYDMNELTAAHKELPLGT 168

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            V VTN+ NG  +VVR+NDRGP+H NR++DLS AAA+ L     GV++V +  L
Sbjct: 169 KVEVTNLSNGRKVVVRINDRGPFHGNRVLDLSRAAAQELGTLNAGVAQVQIRAL 222


>gi|50120240|ref|YP_049407.1| rare lipoprotein A [Pectobacterium atrosepticum SCRI1043]
 gi|49610766|emb|CAG74211.1| rare lipoprotein A [Pectobacterium atrosepticum SCRI1043]
          Length = 371

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 89/160 (55%), Gaps = 3/160 (1%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y I G+ Y + +    ++  G+A+WYG+   G  T+ GEV+    ITAAHPTLPLPSYVR
Sbjct: 59  YSIKGKTYKIVKNPQNFSEAGLATWYGEEASGNRTSIGEVFDPNAITAAHPTLPLPSYVR 118

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN+ NG  LVVRVNDRGPY   R+IDLS AA   L +     +KV V+++ +A    + 
Sbjct: 119 VTNLSNGRRLVVRVNDRGPYTPGRIIDLSKAAGDRLNISNN--TKVKVDFINVAPDGTLS 176

Query: 190 QEYLRSTVMVNSATVLPLGCQYREEIVVIPYLLTRSRTVH 229
                 T +   +  LP    +    +  P + T S T +
Sbjct: 177 GPGTAGTTVAKQSFSLPERPSFGASGLGTPMMETTSPTSN 216


>gi|307822227|ref|ZP_07652459.1| rare lipoprotein A [Methylobacter tundripaludum SV96]
 gi|307736793|gb|EFO07638.1| rare lipoprotein A [Methylobacter tundripaludum SV96]
          Length = 208

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 48/93 (51%), Positives = 68/93 (73%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           +  VG ASWYG  F G+ T+NGE +  + +TAAHP+LP+ +  +VTN+ENG  + VR+ND
Sbjct: 87  HKEVGEASWYGPGFQGQETSNGETFDQKKMTAAHPSLPMGTEAKVTNLENGKKVEVRIND 146

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           RGPY  NR+IDLS+AAA  L ++E G ++V +E
Sbjct: 147 RGPYAENRVIDLSSAAANKLEMKEGGTTQVKIE 179


>gi|78046280|ref|YP_362455.1| rare lipoprotein A [Xanthomonas campestris pv. vesicatoria str.
           85-10]
 gi|78034710|emb|CAJ22355.1| rare lipoprotein A [Xanthomonas campestris pv. vesicatoria str.
           85-10]
          Length = 470

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 59/112 (52%), Positives = 72/112 (64%), Gaps = 1/112 (0%)

Query: 70  PYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY+++G+ YV       Y   G AS+YG  FHGRLT+N EVY     TAAH TLPLPS+ 
Sbjct: 116 PYEVLGKRYVVMDNPGDYVERGTASYYGNKFHGRLTSNKEVYDMYAFTAAHKTLPLPSFA 175

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            VTN + G S+VVRVNDRGP+H  R+IDLS AAA  L +  +G   V V  L
Sbjct: 176 LVTNTDTGQSVVVRVNDRGPFHDGRVIDLSYAAAVKLGITGKGTGNVEVRGL 227


>gi|146329100|ref|YP_001209850.1| lipoprotein A domain-containing protein [Dichelobacter nodosus
           VCS1703A]
 gi|146232570|gb|ABQ13548.1| rare lipoprotein A domain protein [Dichelobacter nodosus VCS1703A]
          Length = 200

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 74/110 (67%), Gaps = 6/110 (5%)

Query: 68  GKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           GK YQ +      +Q       G ASWYG  FHG+ TA+GE++    +TAAH  LPL + 
Sbjct: 93  GKTYQTLAHANDFKQE------GTASWYGPGFHGKKTASGEIFNQNELTAAHKRLPLGTK 146

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           +RVTN++NG S+VV++NDRGP+HSNR++DLS AAA+ + +   GV+ V +
Sbjct: 147 IRVTNLKNGKSVVVKINDRGPFHSNRVLDLSQAAAQKIGLLHSGVTNVSI 196


>gi|170693935|ref|ZP_02885091.1| rare lipoprotein A [Burkholderia graminis C4D1M]
 gi|170141007|gb|EDT09179.1| rare lipoprotein A [Burkholderia graminis C4D1M]
          Length = 210

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 70/107 (65%), Gaps = 8/107 (7%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
           +G ASWYG+ FHGR TANGE Y    +TAAH TLPL SYVRVTN     S+VVR+NDRGP
Sbjct: 96  IGRASWYGRGFHGRRTANGERYDMHALTAAHRTLPLGSYVRVTNPATSRSVVVRINDRGP 155

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRS 195
           Y   R+IDLS AAA +L +   G ++V +E        G+ QE  R+
Sbjct: 156 YARGRVIDLSMAAANVLDMRHAGTARVKIE--------GLTQEEARA 194


>gi|58583580|ref|YP_202596.1| rare lipoprotein A [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84625392|ref|YP_452764.1| rare lipoprotein A [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188575163|ref|YP_001912092.1| rare lipoprotein A [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|58428174|gb|AAW77211.1| rare lipoprotein A [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84369332|dbj|BAE70490.1| rare lipoprotein A [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188519615|gb|ACD57560.1| rare lipoprotein A [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 471

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 59/112 (52%), Positives = 72/112 (64%), Gaps = 1/112 (0%)

Query: 70  PYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY+++G+ YV       Y   G AS+YG  FHGRLT+N EVY     TAAH TLPLPS+ 
Sbjct: 116 PYEVLGKRYVVMDNPGDYVERGTASYYGNKFHGRLTSNKEVYDMYAFTAAHKTLPLPSFA 175

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            VTN + G S+VVRVNDRGP+H  R+IDLS AAA  L +  +G   V V  L
Sbjct: 176 LVTNTDTGQSVVVRVNDRGPFHDGRVIDLSYAAAVKLGITGKGTGNVEVRGL 227


>gi|283852457|ref|ZP_06369726.1| rare lipoprotein A [Desulfovibrio sp. FW1012B]
 gi|283572195|gb|EFC20186.1| rare lipoprotein A [Desulfovibrio sp. FW1012B]
          Length = 248

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 78/126 (61%), Gaps = 2/126 (1%)

Query: 58  VPRGGGRYFLG-KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYI 115
           +PR  GR     +PY I G  Y P R    Y   G+ASWYG  FHG  T+NGE+Y     
Sbjct: 35  IPRATGREPATLRPYTIKGVTYTPLRSARGYREEGIASWYGPGFHGHSTSNGEIYDQYQA 94

Query: 116 TAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKV 175
           T AH  LP+ + VRVTN+ENG S+ +RVNDRGP+ + R+IDLS A A+ L V  RG ++V
Sbjct: 95  TCAHKLLPMHTMVRVTNLENGRSMTLRVNDRGPFVAGRIIDLSLAGARELGVHGRGTARV 154

Query: 176 HVEYLG 181
            VE  G
Sbjct: 155 RVEVEG 160


>gi|220905559|ref|YP_002480871.1| rare lipoprotein A [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219869858|gb|ACL50193.1| rare lipoprotein A [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 238

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 76/114 (66%), Gaps = 1/114 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY + G+ Y P +    +  VG+ASWYG  FHG+ TANGE Y    +TAAH  LPL + 
Sbjct: 41  KPYTVRGKTYYPLKSAHGFVEVGVASWYGPGFHGKKTANGERYNQYAMTAAHKLLPLGTK 100

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           VRVT++ NG S++VR+NDRGP+  +R+IDLS AAA  L +   G  +V ++ LG
Sbjct: 101 VRVTHLGNGRSIIVRINDRGPFVGDRVIDLSRAAATRLNIVGPGTGRVRIQSLG 154


>gi|116329529|ref|YP_799249.1| RlpA-like lipoprotein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116329844|ref|YP_799562.1| RlpA-like lipoprotein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116122273|gb|ABJ80316.1| RlpA-like lipoprotein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116123533|gb|ABJ74804.1| RlpA-like lipoprotein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 303

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 74/110 (67%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           +  +GM+SWYG  FHG+ TA+GE +    +TAAHPTLPL S +RV N+EN   ++VRVND
Sbjct: 83  FDEIGMSSWYGAKFHGKPTASGEKFDKTKLTAAHPTLPLGSIIRVQNLENQKEVLVRVND 142

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRS 195
           RGP+  +R+IDLS  AA  L  ++ G++KV ++ + +    G + E L +
Sbjct: 143 RGPFVKDRIIDLSEKAADTLDFKDIGIAKVGIKVVKLGGAAGEESEDLEN 192


>gi|315636937|ref|ZP_07892161.1| rare lipoprotein A [Arcobacter butzleri JV22]
 gi|315478767|gb|EFU69476.1| rare lipoprotein A [Arcobacter butzleri JV22]
          Length = 314

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 59/145 (40%), Positives = 84/145 (57%), Gaps = 3/145 (2%)

Query: 69  KPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY + G  Y P          G+ASWYG  FH + T+NGE+Y    +TAAH TLP+ + 
Sbjct: 57  RPYTVFGIKYYPEIARVGERFNGIASWYGPDFHAKKTSNGEIYNMYAMTAAHKTLPMNTV 116

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM--ALL 185
           VRV N++NG S +VR+NDRGP+ S R+IDLSN AA  + +  +G +KV +  LG    + 
Sbjct: 117 VRVDNLDNGRSTIVRINDRGPFVSGRIIDLSNKAAHEIDMVRKGTAKVQITVLGYNGEIN 176

Query: 186 NGMDQEYLRSTVMVNSATVLPLGCQ 210
           N    + L     +NS+T    G +
Sbjct: 177 NNEAPDVLTEKSPINSSTAFSGGTE 201


>gi|21241434|ref|NP_641016.1| rare lipoprotein A [Xanthomonas axonopodis pv. citri str. 306]
 gi|21106772|gb|AAM35552.1| rare lipoprotein A [Xanthomonas axonopodis pv. citri str. 306]
          Length = 475

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 59/112 (52%), Positives = 72/112 (64%), Gaps = 1/112 (0%)

Query: 70  PYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY+++G+ YV       Y   G AS+YG  FHGRLT+N EVY     TAAH TLPLPS+ 
Sbjct: 116 PYEVLGKRYVVMDNPGDYVERGTASYYGNKFHGRLTSNKEVYDMYAFTAAHKTLPLPSFA 175

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            VTN + G S+VVRVNDRGP+H  R+IDLS AAA  L +  +G   V V  L
Sbjct: 176 LVTNTDTGQSVVVRVNDRGPFHDGRVIDLSYAAAVKLGITGKGTGNVEVRGL 227


>gi|166710540|ref|ZP_02241747.1| rare lipoprotein A [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 471

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 59/112 (52%), Positives = 72/112 (64%), Gaps = 1/112 (0%)

Query: 70  PYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY+++G+ YV       Y   G AS+YG  FHGRLT+N EVY     TAAH TLPLPS+ 
Sbjct: 116 PYEVLGKRYVVMDNPGDYVERGTASYYGNKFHGRLTSNKEVYDMYAFTAAHKTLPLPSFA 175

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            VTN + G S+VVRVNDRGP+H  R+IDLS AAA  L +  +G   V V  L
Sbjct: 176 LVTNTDTGQSVVVRVNDRGPFHDGRVIDLSYAAAVKLGITGKGTGNVEVRGL 227


>gi|325915033|ref|ZP_08177362.1| rare lipoprotein A [Xanthomonas vesicatoria ATCC 35937]
 gi|325538731|gb|EGD10398.1| rare lipoprotein A [Xanthomonas vesicatoria ATCC 35937]
          Length = 466

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 73/115 (63%), Gaps = 1/115 (0%)

Query: 70  PYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY+++G+ YV       Y   G AS+YG  FHGRLT+N EVY     TAAH TLPLPS+ 
Sbjct: 116 PYEVLGKRYVVMDNPGDYVERGTASYYGSKFHGRLTSNKEVYDMYAFTAAHKTLPLPSFA 175

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
            VTN + G S+VVRVNDRGP+H  R+IDLS AAA  L +  +G   V V  L  A
Sbjct: 176 LVTNTDTGDSVVVRVNDRGPFHDGRVIDLSYAAAVKLGITGKGTGNVEVRGLTEA 230


>gi|218886643|ref|YP_002435964.1| lipoprotein A [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218757597|gb|ACL08496.1| rare lipoprotein A [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 259

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 82/126 (65%), Gaps = 1/126 (0%)

Query: 57  RVPRGGGRYFLGKPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYI 115
           + P+G  +    KPY ++G+ Y P      ++  G+ASWYGK FHGR TANGE+Y    +
Sbjct: 50  KYPKGQPQGPRAKPYTVLGKTYHPLLSAHGFSEEGIASWYGKDFHGRKTANGEIYDMYGL 109

Query: 116 TAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKV 175
           TAAH  LP  + V+VTN+++G S  VRVNDRGP+  +R+IDL+N AA  + +   G ++V
Sbjct: 110 TAAHKLLPFNTVVKVTNLQSGRSTTVRVNDRGPFVGDRIIDLTNTAANQIGMLGPGTARV 169

Query: 176 HVEYLG 181
            VE +G
Sbjct: 170 RVETVG 175


>gi|294666895|ref|ZP_06732126.1| rare lipoprotein A [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
 gi|292603343|gb|EFF46763.1| rare lipoprotein A [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
          Length = 472

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 59/112 (52%), Positives = 72/112 (64%), Gaps = 1/112 (0%)

Query: 70  PYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY+++G+ YV       Y   G AS+YG  FHGRLT+N EVY     TAAH TLPLPS+ 
Sbjct: 116 PYEVLGKRYVVMDNPGDYVERGTASYYGNKFHGRLTSNKEVYDMYAFTAAHKTLPLPSFA 175

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            VTN + G S+VVRVNDRGP+H  R+IDLS AAA  L +  +G   V V  L
Sbjct: 176 LVTNTDTGQSVVVRVNDRGPFHDGRVIDLSYAAAVKLGITGKGTGNVEVRGL 227


>gi|294627616|ref|ZP_06706198.1| rare lipoprotein A [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
 gi|292597968|gb|EFF42123.1| rare lipoprotein A [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 11122]
          Length = 472

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 59/112 (52%), Positives = 72/112 (64%), Gaps = 1/112 (0%)

Query: 70  PYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY+++G+ YV       Y   G AS+YG  FHGRLT+N EVY     TAAH TLPLPS+ 
Sbjct: 116 PYEVLGKRYVVMDNPGDYVERGTASYYGNKFHGRLTSNKEVYDMYAFTAAHKTLPLPSFA 175

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            VTN + G S+VVRVNDRGP+H  R+IDLS AAA  L +  +G   V V  L
Sbjct: 176 LVTNTDTGQSVVVRVNDRGPFHDGRVIDLSYAAAVKLGITGKGTGNVEVRGL 227


>gi|145220530|ref|YP_001131239.1| rare lipoprotein A [Prosthecochloris vibrioformis DSM 265]
 gi|145206694|gb|ABP37737.1| rare lipoprotein A [Chlorobium phaeovibrioides DSM 265]
          Length = 174

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 80/127 (62%), Gaps = 11/127 (8%)

Query: 65  YFLGK----PYQIMGRWYVPRQYT---AYAAVGMASWYG----KAFHGRLTANGEVYGTE 113
           Y LGK    PY I GR YVP  Y    AY  VGMASWYG    K  +G+ TA GE +   
Sbjct: 46  YRLGKLKNTPYSINGRVYVPMSYEQALAYEEVGMASWYGHETLKKNNGQPTAYGEQFDPS 105

Query: 114 YITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVS 173
             +AAH  LPLPS VRVTN+EN  S+VVRVNDRGP+  +R+IDLS   A+ L   ++G +
Sbjct: 106 APSAAHKYLPLPSVVRVTNLENSQSIVVRVNDRGPFVDDRIIDLSAEGARQLGFYQKGTA 165

Query: 174 KVHVEYL 180
           +V VE +
Sbjct: 166 RVRVEVI 172


>gi|325920073|ref|ZP_08182045.1| rare lipoprotein A [Xanthomonas gardneri ATCC 19865]
 gi|325549443|gb|EGD20325.1| rare lipoprotein A [Xanthomonas gardneri ATCC 19865]
          Length = 466

 Score =  112 bits (279), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 59/112 (52%), Positives = 72/112 (64%), Gaps = 1/112 (0%)

Query: 70  PYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY+++G+ YV       Y   G AS+YG  FHGRLT+N EVY     TAAH TLPLPS+ 
Sbjct: 116 PYEVLGKRYVVMDNPGDYVERGTASYYGSKFHGRLTSNKEVYDMYAFTAAHKTLPLPSFA 175

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            VTN + G S+VVRVNDRGP+H  R+IDLS AAA  L +  +G   V V  L
Sbjct: 176 LVTNTDTGDSVVVRVNDRGPFHDGRVIDLSYAAAVKLGITGKGTGNVEVRGL 227


>gi|95930419|ref|ZP_01313155.1| rare lipoprotein A [Desulfuromonas acetoxidans DSM 684]
 gi|95133459|gb|EAT15122.1| rare lipoprotein A [Desulfuromonas acetoxidans DSM 684]
          Length = 253

 Score =  112 bits (279), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 79/125 (63%), Gaps = 1/125 (0%)

Query: 69  KPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY++ G  Y P   +  ++  G+ASWYGK FHGR T+NGE+Y    +TAAH TLPL  +
Sbjct: 43  KPYEVYGVSYTPLLDHQGFSEEGIASWYGKKFHGRKTSNGEIYDMYAMTAAHKTLPLGVF 102

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
           V+V N+ NG ++VVRVNDRGP+ + R+IDLS  AA  L V   G + V +  LG    + 
Sbjct: 103 VQVDNLNNGKTVVVRVNDRGPFVAGRIIDLSYTAASRLGVVGPGTAPVRITALGYQQWDN 162

Query: 188 MDQEY 192
             Q +
Sbjct: 163 SGQPH 167


>gi|83858299|ref|ZP_00951821.1| rare lipoprotein A [Oceanicaulis alexandrii HTCC2633]
 gi|83853122|gb|EAP90974.1| rare lipoprotein A [Oceanicaulis alexandrii HTCC2633]
          Length = 197

 Score =  112 bits (279), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 73/107 (68%), Gaps = 1/107 (0%)

Query: 78  YVPRQYTAYAA-VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENG 136
           + P + T  +   G+ASWYG  F GR TANGE++ +  +TAAH T+ LPS  RVT ++ G
Sbjct: 50  FTPDEDTPRSVETGLASWYGPGFEGRQTANGEIFDSTQLTAAHRTMRLPSRARVTRLDTG 109

Query: 137 ISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
            S++VRVNDRGPY   RLIDLS+AAA+ L   + G+ +V VE LG A
Sbjct: 110 ASIIVRVNDRGPYIDGRLIDLSHAAAQALGFTDDGLVEVRVEGLGPA 156


>gi|78777279|ref|YP_393594.1| rare lipoprotein A [Sulfurimonas denitrificans DSM 1251]
 gi|78497819|gb|ABB44359.1| Rare lipoprotein A [Sulfurimonas denitrificans DSM 1251]
          Length = 270

 Score =  111 bits (278), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 72/115 (62%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY+I G  Y P          G ASWYG  FHG+LT+NGE Y    +TAAH TLP+ + 
Sbjct: 58  RPYEIRGIKYYPTVVNVGDVFDGFASWYGPDFHGKLTSNGETYNMYDMTAAHKTLPMNTI 117

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           V+VTN  N  S+VVR+NDRGP+   R+IDLSN AAK + +   G + V VE LG 
Sbjct: 118 VKVTNQRNNKSVVVRINDRGPFIERRIIDLSNTAAKKIDMLNAGTAPVKVEVLGF 172


>gi|293602390|ref|ZP_06684836.1| rare lipoprotein A [Achromobacter piechaudii ATCC 43553]
 gi|292819152|gb|EFF78187.1| rare lipoprotein A [Achromobacter piechaudii ATCC 43553]
          Length = 320

 Score =  111 bits (278), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 76/113 (67%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWYVPRQY-TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY + G+ YVP      Y   G+ASWYGK FHG  T+ GE Y    +TAAH TLP+PSY
Sbjct: 67  RPYVVFGQRYVPDTSGQPYKQRGIASWYGKKFHGNSTSIGESYDMYAMTAAHTTLPIPSY 126

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            RVT++ NG +++VRVNDRGP+HS+R++DLS  AA  L +   G  +V VE +
Sbjct: 127 ARVTSLVNGKTIIVRVNDRGPFHSDRIMDLSYVAAYKLGIIGPGSGQVVVESI 179


>gi|297624550|ref|YP_003705984.1| rare lipoprotein A [Truepera radiovictrix DSM 17093]
 gi|297165730|gb|ADI15441.1| rare lipoprotein A [Truepera radiovictrix DSM 17093]
          Length = 198

 Score =  111 bits (278), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 69/94 (73%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
           AA G+ASWYG  F GRLTANGEV+ +  +TAAH TLP  + VRVTN+ NG+++VVR+NDR
Sbjct: 24  AAEGIASWYGPGFEGRLTANGEVFDSSLLTAAHQTLPFDTLVRVTNLNNGLAVVVRINDR 83

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           GP+   R+IDLS AAA+ + +   G + V +E L
Sbjct: 84  GPFVGGRIIDLSRAAAERIDMIGSGTAPVRLELL 117


>gi|312797500|ref|YP_004030422.1| lipoprotein [Burkholderia rhizoxinica HKI 454]
 gi|312169275|emb|CBW76278.1| Lipoprotein [Burkholderia rhizoxinica HKI 454]
          Length = 316

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 66/91 (72%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  FHGR TANGE +    +TAAH  LPL S+VRVTN+ N  S+VVR+NDRGPY
Sbjct: 209 GRASWYGPRFHGRHTANGERFDKNALTAAHRRLPLSSFVRVTNVANKRSVVVRINDRGPY 268

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           HS R+IDLS AAA  L ++  G ++V ++ L
Sbjct: 269 HSGRIIDLSQAAASALGLQHSGTARVRLQGL 299


>gi|289209132|ref|YP_003461198.1| lipoprotein A [Thioalkalivibrio sp. K90mix]
 gi|288944763|gb|ADC72462.1| rare lipoprotein A [Thioalkalivibrio sp. K90mix]
          Length = 323

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/119 (47%), Positives = 76/119 (63%), Gaps = 1/119 (0%)

Query: 64  RYFLGKPYQIMG-RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTL 122
           RY     Y++ G R+   R  T +   G+ASWYG  FHGR T++GE Y    +TAAH TL
Sbjct: 73  RYGNPPEYEVFGQRYRTLRTSTGFEEEGLASWYGTKFHGRRTSSGEPYDMYAMTAAHKTL 132

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           PLP+YV V N+EN   ++VRVNDRGP+   R+IDLS AAA  L + + GV+ V +  +G
Sbjct: 133 PLPTYVEVVNLENDRRVIVRVNDRGPFVDERIIDLSYAAAHRLDMTDAGVAPVRIRAVG 191


>gi|261884708|ref|ZP_06008747.1| rare lipoprotein a rlpa [Campylobacter fetus subsp. venerealis str.
           Azul-94]
          Length = 222

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/115 (47%), Positives = 75/115 (65%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQY-TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY I G+ Y P        A G+ASWYG  FHG+ T+NGE Y    +TAAH TLP+ + 
Sbjct: 52  RPYTINGKTYYPTVVEVGDTASGIASWYGPNFHGKKTSNGESYNMNAMTAAHKTLPMNTM 111

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           V+V+N++NG S VVR+NDRGP+ + R+IDLS AAA  + +   G + V +E LG 
Sbjct: 112 VKVSNLKNGKSTVVRINDRGPFVAGRIIDLSKAAANDISMIAAGTAPVRLEVLGF 166


>gi|90421161|ref|ZP_01229063.1| putative rare lipoprotein A [Aurantimonas manganoxydans SI85-9A1]
 gi|90334653|gb|EAS48433.1| putative rare lipoprotein A [Aurantimonas manganoxydans SI85-9A1]
          Length = 146

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/97 (56%), Positives = 67/97 (69%)

Query: 84  TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRV 143
           T  AA G AS+YGK FHGR TANGE +    +TAAH TLP  + VRVTN  NG S+VVR+
Sbjct: 50  TKSAASGSASYYGKRFHGRRTANGESFNMNSMTAAHKTLPFGTKVRVTNRRNGKSVVVRI 109

Query: 144 NDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           NDRGPYH  R+IDLS AAA  + +   G +KV ++ L
Sbjct: 110 NDRGPYHGGRIIDLSRAAASKIGMIHSGTAKVSLDIL 146


>gi|296160813|ref|ZP_06843626.1| rare lipoprotein A [Burkholderia sp. Ch1-1]
 gi|295888905|gb|EFG68710.1| rare lipoprotein A [Burkholderia sp. Ch1-1]
          Length = 243

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/92 (58%), Positives = 64/92 (69%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWYG+ FHGR TANGE Y    +TAAH TLPL SYVRVTN     S+VVR+NDRGP
Sbjct: 129 TGRASWYGRGFHGRRTANGERYDMHALTAAHRTLPLGSYVRVTNPATSRSVVVRINDRGP 188

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           Y   R+IDLS AAA +L +   G ++V +E L
Sbjct: 189 YARGRVIDLSMAAAAVLDMRHAGTARVQIEGL 220


>gi|289663964|ref|ZP_06485545.1| rare lipoprotein A [Xanthomonas campestris pv. vasculorum NCPPB702]
          Length = 470

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 58/112 (51%), Positives = 72/112 (64%), Gaps = 1/112 (0%)

Query: 70  PYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY+++G+ YV       Y   G AS+YG  FHGRLT+N EVY     TAAH TLPLPS+ 
Sbjct: 116 PYEVLGKRYVVMDNPGDYVERGTASYYGNKFHGRLTSNKEVYDMYAFTAAHKTLPLPSFA 175

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            VTN + G S+VVR+NDRGP+H  R+IDLS AAA  L +  +G   V V  L
Sbjct: 176 LVTNTDTGQSVVVRINDRGPFHDGRVIDLSYAAAVKLGITGKGTGNVEVRGL 227


>gi|302337085|ref|YP_003802291.1| lipoprotein A [Spirochaeta smaragdinae DSM 11293]
 gi|301634270|gb|ADK79697.1| rare lipoprotein A [Spirochaeta smaragdinae DSM 11293]
          Length = 215

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 52/93 (55%), Positives = 68/93 (73%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
           VG ASWYG  F GR TANGEV+ T  +TAAH TLP  + VRVTN++N  S+ VR+NDRGP
Sbjct: 35  VGFASWYGGKFQGRKTANGEVFDTNKLTAAHKTLPFGTLVRVTNLDNDKSVEVRINDRGP 94

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           +   R+IDLS AAA+ + +  RG++KV +E +G
Sbjct: 95  FVEGRIIDLSRAAAEAIDMVGRGIAKVSLEVIG 127


>gi|307728227|ref|YP_003905451.1| rare lipoprotein A [Burkholderia sp. CCGE1003]
 gi|307582762|gb|ADN56160.1| rare lipoprotein A [Burkholderia sp. CCGE1003]
          Length = 210

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 68/107 (63%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWYG+ FHGR TANGE Y    +TAAH TLPL SYVRVTN     S+VVR+NDRGP
Sbjct: 96  TGRASWYGRGFHGRRTANGERYDMHALTAAHRTLPLGSYVRVTNPATSRSVVVRINDRGP 155

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRS 195
           Y   R+IDLS AAA +L +   G ++V +E L         +E L S
Sbjct: 156 YARGRVIDLSMAAANMLEMRHAGTARVKIEGLTQEEARAAREEMLAS 202


>gi|238755057|ref|ZP_04616405.1| Rare lipoprotein A [Yersinia ruckeri ATCC 29473]
 gi|238706761|gb|EEP99130.1| Rare lipoprotein A [Yersinia ruckeri ATCC 29473]
          Length = 358

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/137 (41%), Positives = 85/137 (62%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G+ Y V +    ++ +G+AS YG+  +G  TA GE++    +TAAHPTLP+PSYVR
Sbjct: 58  YKVNGQSYSVIKDAQNFSQIGLASSYGEEANGNTTATGEIFDPNALTAAHPTLPIPSYVR 117

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN+ NG  +VVRVNDRGPY   R+IDLS AAA  L +     +KV ++++ +A    + 
Sbjct: 118 VTNVSNGRQIVVRVNDRGPYTPGRVIDLSKAAADRLNISNN--TKVKIDFINVAPDGSLS 175

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +   +  LP
Sbjct: 176 GPGMVGTTIAKQSYALP 192


>gi|56460064|ref|YP_155345.1| rare lipoprotein A [Idiomarina loihiensis L2TR]
 gi|56179074|gb|AAV81796.1| Rare lipoprotein A [Idiomarina loihiensis L2TR]
          Length = 275

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 76/125 (60%), Gaps = 7/125 (5%)

Query: 59  PRGGGRY-FLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITA 117
           P+G   Y  LG  Y++M           Y   G ASWYG  FHG LT+NGE Y    ++A
Sbjct: 56  PQGNRDYRVLGNNYEVMDSA------VGYVEEGYASWYGNKFHGHLTSNGEYYDMYSMSA 109

Query: 118 AHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           AH  LPLP+YV+VTN+ N  ++ VRVNDRGP+H  R+IDLS AAA  L + + G + V V
Sbjct: 110 AHTRLPLPTYVKVTNLNNDRTVTVRVNDRGPFHPERIIDLSFAAAYKLGMLDSGTAPVRV 169

Query: 178 EYLGM 182
           E + +
Sbjct: 170 EAINL 174


>gi|294789640|ref|ZP_06754874.1| rare lipoprotein A [Simonsiella muelleri ATCC 29453]
 gi|294482441|gb|EFG30134.1| rare lipoprotein A [Simonsiella muelleri ATCC 29453]
          Length = 268

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 51/95 (53%), Positives = 66/95 (69%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           ++  G ASWYG  FHGR T+NGE +    +TAAH TLPLPSYVRVTN+ N  S++VRVND
Sbjct: 37  FSQSGKASWYGPGFHGRKTSNGERFNMNALTAAHRTLPLPSYVRVTNLSNNKSIIVRVND 96

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+  NR++DLS  AAK L     G++ + +  L
Sbjct: 97  RGPFRGNRVMDLSKGAAKQLGFLGAGMANILISSL 131


>gi|303249427|ref|ZP_07335648.1| rare lipoprotein A [Desulfovibrio fructosovorans JJ]
 gi|302489169|gb|EFL49140.1| rare lipoprotein A [Desulfovibrio fructosovorans JJ]
          Length = 248

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 79/126 (62%), Gaps = 2/126 (1%)

Query: 58  VPRGGGRY-FLGKPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYI 115
           +PR  GR     +PY I G  Y P      Y   G+ASWYG  FHG +T++GE+Y    +
Sbjct: 35  IPRSSGRTPATMRPYTIKGVTYRPLHTAKGYDEKGIASWYGPGFHGHMTSSGEIYDQYQM 94

Query: 116 TAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKV 175
           T AH  LP+ + VRVTN+ENG S V+RVNDRGP+ S R+IDLS A AK L V  +G +KV
Sbjct: 95  TCAHKLLPMHTNVRVTNLENGRSCVLRVNDRGPFVSGRIIDLSLAGAKNLGVYGKGTAKV 154

Query: 176 HVEYLG 181
            V+  G
Sbjct: 155 RVQVEG 160


>gi|295675209|ref|YP_003603733.1| rare lipoprotein A [Burkholderia sp. CCGE1002]
 gi|295435052|gb|ADG14222.1| rare lipoprotein A [Burkholderia sp. CCGE1002]
          Length = 201

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/95 (56%), Positives = 67/95 (70%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           +  +G ASWYG+ FHGR TANGE Y    +TAAH TLPL SYVRVTN  N  S++VR+ND
Sbjct: 86  FHQIGRASWYGRFFHGRRTANGERYDMHAMTAAHRTLPLGSYVRVTNPANSRSVIVRIND 145

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGPY   R+IDLS AAA +L +   G ++V +E L
Sbjct: 146 RGPYARGRVIDLSMAAAGMLDMRHSGTARVKIEGL 180


>gi|116750721|ref|YP_847408.1| rare lipoprotein A [Syntrophobacter fumaroxidans MPOB]
 gi|116699785|gb|ABK18973.1| rare lipoprotein A [Syntrophobacter fumaroxidans MPOB]
          Length = 259

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 72/111 (64%), Gaps = 1/111 (0%)

Query: 69  KPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQI G WY P      Y   G ASWYG  FHGR TA GE Y    +TAAH TLPL +Y
Sbjct: 44  RPYQINGIWYYPLPSAEGYVEEGTASWYGSDFHGRPTACGERYDMFAMTAAHKTLPLGTY 103

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           V+VTN+EN  S ++R+NDRGP+ + R+IDLS   A+ L    +G ++V VE
Sbjct: 104 VKVTNLENHRSTILRINDRGPFVAGRIIDLSCRGAQELDSYRKGTARVRVE 154


>gi|323524503|ref|YP_004226656.1| rare lipoprotein A [Burkholderia sp. CCGE1001]
 gi|323381505|gb|ADX53596.1| rare lipoprotein A [Burkholderia sp. CCGE1001]
          Length = 210

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 68/107 (63%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWYG+ FHGR TANGE Y    +TAAH TLPL SYVRVTN     S+VVR+NDRGP
Sbjct: 96  TGRASWYGRGFHGRRTANGERYDMHALTAAHRTLPLGSYVRVTNPATSRSVVVRINDRGP 155

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRS 195
           Y   R+IDLS AAA +L +   G ++V +E L         +E L S
Sbjct: 156 YARGRVIDLSMAAATMLDMRHAGTARVKIEGLTQEEARAAREEMLAS 202


>gi|24212761|ref|NP_710242.1| RlpA-like lipoprotein [Leptospira interrogans serovar Lai str.
           56601]
 gi|45655968|ref|YP_000054.1| putative lipoprotein [Leptospira interrogans serovar Copenhageni
           str. Fiocruz L1-130]
 gi|24193402|gb|AAN47260.1| RlpA-like lipoprotein [Leptospira interrogans serovar Lai str.
           56601]
 gi|45599201|gb|AAS68691.1| putative lipoprotein [Leptospira interrogans serovar Copenhageni
           str. Fiocruz L1-130]
          Length = 321

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 76/117 (64%), Gaps = 9/117 (7%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           +  VGM+SWYG  FHG+ TA+GE +    +TAAHPTLPL S +RV N+EN   ++VRVND
Sbjct: 102 FDEVGMSSWYGAKFHGKPTASGEKFDKTKLTAAHPTLPLGSIIRVQNLENQKEVIVRVND 161

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL---GMA------LLNGMDQEYL 193
           RGP+  +R+IDLS  AA  L  ++ G++KV ++ +   G A      L N  D+E L
Sbjct: 162 RGPFVKDRIIDLSEKAADTLDFKDVGIAKVGIKVVKRGGAANEESEDLENSDDEEAL 218


>gi|289667538|ref|ZP_06488613.1| rare lipoprotein A [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 354

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 58/112 (51%), Positives = 72/112 (64%), Gaps = 1/112 (0%)

Query: 70  PYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY+++G+ YV       Y   G AS+YG  FHGRLT+N EVY     TAAH TLPLPS+ 
Sbjct: 116 PYEVLGKRYVVMDNPGDYVERGTASYYGNKFHGRLTSNKEVYDMYAFTAAHKTLPLPSFA 175

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            VTN + G S+VVR+NDRGP+H  R+IDLS AAA  L +  +G   V V  L
Sbjct: 176 LVTNTDTGQSVVVRINDRGPFHDGRVIDLSYAAAVKLGITGKGTGNVEVRGL 227


>gi|261822395|ref|YP_003260501.1| lipoprotein A [Pectobacterium wasabiae WPP163]
 gi|261606408|gb|ACX88894.1| rare lipoprotein A [Pectobacterium wasabiae WPP163]
          Length = 370

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 75/114 (65%), Gaps = 3/114 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y I G+ Y + +    ++  G+A+WYG+   G  T+ GE++    ITAAHPTLPLPSYVR
Sbjct: 59  YSIKGKSYKIVKNPQNFSEAGLATWYGEEASGNRTSIGEIFDPNAITAAHPTLPLPSYVR 118

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VTN+ NG  LVVRVNDRGPY   R+IDLS AA   L +     +KV V+++ +A
Sbjct: 119 VTNLSNGRRLVVRVNDRGPYTPGRIIDLSKAAGDRLNISNN--TKVKVDFISVA 170


>gi|240126554|ref|ZP_04739440.1| RlpA-like protein precursor [Neisseria gonorrhoeae SK-92-679]
 gi|268685134|ref|ZP_06151996.1| RlpA-like protein [Neisseria gonorrhoeae SK-92-679]
 gi|268625418|gb|EEZ57818.1| RlpA-like protein [Neisseria gonorrhoeae SK-92-679]
          Length = 228

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 50/95 (52%), Positives = 66/95 (69%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           +   G ASWYG  FHGR T+ G+ Y     TAAH TLP+PS+VRVTN +NG S++VRVND
Sbjct: 47  FTQTGNASWYGGRFHGRKTSGGDRYDMNAFTAAHKTLPIPSHVRVTNTKNGKSVIVRVND 106

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           R P+H NR+ID+S AAA+ L    +G + V +E +
Sbjct: 107 RDPFHGNRIIDVSKAAAQKLGFVSQGTAHVKIEQI 141


>gi|238791638|ref|ZP_04635276.1| Rare lipoprotein A [Yersinia intermedia ATCC 29909]
 gi|238729254|gb|EEQ20770.1| Rare lipoprotein A [Yersinia intermedia ATCC 29909]
          Length = 367

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 53/121 (43%), Positives = 76/121 (62%), Gaps = 2/121 (1%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           +  VG+A+WYG+  +G  T+ GE +    +TAAHPTLP+PSYVRVTN+ NG  +VVRVND
Sbjct: 74  FTQVGLAAWYGEEANGNTTSTGETFDPNALTAAHPTLPIPSYVRVTNVSNGRQIVVRVND 133

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNSATVL 205
           RGPY   R+IDLS AAA  L +     +KV ++++ +A    +    +  T +   +  L
Sbjct: 134 RGPYTPGRVIDLSKAAADRLNISNN--TKVKIDFINVAPDGSLSGPGMVGTTIAKQSYAL 191

Query: 206 P 206
           P
Sbjct: 192 P 192


>gi|91781531|ref|YP_556737.1| rare lipoprotein A [Burkholderia xenovorans LB400]
 gi|91685485|gb|ABE28685.1| Rare lipoprotein A [Burkholderia xenovorans LB400]
          Length = 200

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 67/107 (62%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWYG+ FHGR TANGE Y    +TAAH TLPL SYVRVTN     S+VVR+NDRGP
Sbjct: 86  TGRASWYGRGFHGRRTANGERYDMHALTAAHRTLPLGSYVRVTNPATSRSVVVRINDRGP 145

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRS 195
           Y   R+IDLS AAA +L +   G ++V +E L          E L S
Sbjct: 146 YARGRVIDLSMAAAAVLDMRHAGTARVEIEGLTQQEARAARDEMLAS 192


>gi|315638539|ref|ZP_07893715.1| rare lipoprotein A [Campylobacter upsaliensis JV21]
 gi|315481383|gb|EFU72011.1| rare lipoprotein A [Campylobacter upsaliensis JV21]
          Length = 276

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 97/187 (51%), Gaps = 16/187 (8%)

Query: 9   LLKGSVVCVVVLGMSSCFFSSTYKDD----KLEYFPESMYGVTASDRIVSGKRVPRGGGR 64
           +LK ++    +L +S C  +S  +D+       Y+P + +           K  P   G 
Sbjct: 6   MLKLALASSTLLFLSGCGVTSYIRDNFNGNAQVYYPTNDF-----------KSDPSKSGS 54

Query: 65  YFLGKPYQIMGRWYVPRQY-TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLP 123
               KPY I G+ Y P        A G+ASWYG  FHG+ T+NGE Y    +TAAH TLP
Sbjct: 55  KGTMKPYTINGKTYYPTVVEVGETADGIASWYGPGFHGKKTSNGETYDQNGLTAAHKTLP 114

Query: 124 LPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           + + ++VTN+ N   + VRVNDRGP+  NR+IDLS  AA  + +   G + V +E +G  
Sbjct: 115 MNTILKVTNLNNNRQVTVRVNDRGPFAHNRIIDLSKGAAGKIDMIHAGTAPVRLEVIGFG 174

Query: 184 LLNGMDQ 190
             N  ++
Sbjct: 175 NKNSGNE 181


>gi|118475642|ref|YP_892348.1| rare lipoprotein a rlpa [Campylobacter fetus subsp. fetus 82-40]
 gi|118414868|gb|ABK83288.1| rAre lipoprotein a rlpa [Campylobacter fetus subsp. fetus 82-40]
          Length = 239

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/115 (47%), Positives = 75/115 (65%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQY-TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY I G+ Y P        A G+ASWYG  FHG+ T+NGE Y    +TAAH TLP+ + 
Sbjct: 31  RPYTINGKTYYPTVVEVGDTASGIASWYGPNFHGKKTSNGESYNMNAMTAAHKTLPMNTM 90

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           V+V+N++NG S VVR+NDRGP+ + R+IDLS AAA  + +   G + V +E LG 
Sbjct: 91  VKVSNLKNGKSTVVRINDRGPFVAGRIIDLSKAAANDISMIAAGTAPVRLEVLGF 145


>gi|170718199|ref|YP_001783542.1| lipoprotein A [Haemophilus somnus 2336]
 gi|168826328|gb|ACA31699.1| rare lipoprotein A [Haemophilus somnus 2336]
          Length = 186

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/95 (56%), Positives = 67/95 (70%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           Y+  GMAS+Y K FHGR TANGE++     TAAH TLPL SYV VTN+ N   ++VR+ND
Sbjct: 67  YSQKGMASFYHKKFHGRKTANGEIFNNNAYTAAHKTLPLNSYVVVTNLRNNRKVIVRIND 126

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+   R+IDLS AAAK L +   G++KV VE L
Sbjct: 127 RGPFSKARIIDLSEAAAKELGMIHAGIAKVKVESL 161


>gi|227327372|ref|ZP_03831396.1| rare lipoprotein A [Pectobacterium carotovorum subsp. carotovorum
           WPP14]
          Length = 373

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/158 (39%), Positives = 87/158 (55%), Gaps = 3/158 (1%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y I G+ Y + +    ++  G+A+WYG+   G  T+ GE +    ITAAHPTLPLPSYVR
Sbjct: 59  YNIKGKTYKIVKNPQNFSETGLAAWYGEEASGNRTSIGETFDPNAITAAHPTLPLPSYVR 118

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN+ NG  LVVRVNDRGPY   R+IDLS AA   L +     +KV V+++ +A    + 
Sbjct: 119 VTNLSNGRRLVVRVNDRGPYTPGRIIDLSKAAGDRLNISNN--TKVKVDFINVAPDGTLS 176

Query: 190 QEYLRSTVMVNSATVLPLGCQYREEIVVIPYLLTRSRT 227
                 T +   +  LP    +    +  P + T S T
Sbjct: 177 GPGTVGTTVAKQSFALPERPSFGASGLGTPMMETTSPT 214


>gi|187922410|ref|YP_001894052.1| lipoprotein A [Burkholderia phytofirmans PsJN]
 gi|187713604|gb|ACD14828.1| rare lipoprotein A [Burkholderia phytofirmans PsJN]
          Length = 200

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/92 (58%), Positives = 63/92 (68%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWYG+ FHGR TANGE Y    +TAAH TLPL SYVRVTN     S+VVR+NDRGP
Sbjct: 86  TGRASWYGRGFHGRRTANGERYDMHALTAAHRTLPLGSYVRVTNPATSRSVVVRINDRGP 145

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           Y   R+IDLS AAA  L +   G ++V +E L
Sbjct: 146 YARGRVIDLSMAAASALNMRHAGTARVQIEGL 177


>gi|212703870|ref|ZP_03311998.1| hypothetical protein DESPIG_01922 [Desulfovibrio piger ATCC 29098]
 gi|212672687|gb|EEB33170.1| hypothetical protein DESPIG_01922 [Desulfovibrio piger ATCC 29098]
          Length = 245

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 77/114 (67%), Gaps = 1/114 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY + G+ Y P +    +   G+ASWYG  FHG+ TA+GE +    I+AAH  LPL + 
Sbjct: 44  KPYTVRGKTYYPLKSAHGFVEEGVASWYGPGFHGKKTASGERFNQYNISAAHKILPLGTE 103

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           VRVTN+EN  SL++R+NDRGP+  +R+IDLS  AA+ L V  +G ++V ++ LG
Sbjct: 104 VRVTNLENHRSLILRINDRGPFVDDRVIDLSRGAAQRLGVIGKGTARVRIQSLG 157


>gi|154175501|ref|YP_001407903.1| 30S ribosomal protein S16 (BS17) [Campylobacter curvus 525.92]
 gi|112803361|gb|EAU00705.1| 30S ribosomal protein S16 (BS17) [Campylobacter curvus 525.92]
          Length = 270

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/119 (44%), Positives = 80/119 (67%), Gaps = 1/119 (0%)

Query: 69  KPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY I G+ Y P   +    A G+ASWYG  FHG+ T+NGE+Y    +TAAH TLP+ + 
Sbjct: 41  RPYTINGKTYYPTVVSVGDRASGIASWYGPNFHGKTTSNGEIYNMHNMTAAHKTLPMNTV 100

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLN 186
           ++VTN++N  S++VR+NDRGP+ ++R++DLS AAA  L +   G + V++E +G    N
Sbjct: 101 LKVTNLKNQKSVIVRINDRGPFVADRVLDLSKAAATKLDIIGTGTAPVNMEVIGFNAEN 159


>gi|227114415|ref|ZP_03828071.1| rare lipoprotein A [Pectobacterium carotovorum subsp. brasiliensis
           PBR1692]
          Length = 372

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/158 (39%), Positives = 87/158 (55%), Gaps = 3/158 (1%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y I G+ Y + +    ++  G+A+WYG+   G  T+ GE +    ITAAHPTLPLPSYVR
Sbjct: 59  YSIKGKSYKIVKNPQNFSETGLATWYGEEASGNRTSIGETFDPNAITAAHPTLPLPSYVR 118

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN+ NG  LVVRVNDRGPY   R+IDLS AA   L +     +KV V+++ +A    + 
Sbjct: 119 VTNLSNGRRLVVRVNDRGPYTPGRIIDLSKAAGDRLNISNN--TKVKVDFINVAPDGTLS 176

Query: 190 QEYLRSTVMVNSATVLPLGCQYREEIVVIPYLLTRSRT 227
                 T +   +  LP    +    +  P + T S T
Sbjct: 177 GPGTVGTTVAKQSFALPERPSFGASGLGTPMMETTSPT 214


>gi|257460365|ref|ZP_05625466.1| rAre lipoprotein A rlpa [Campylobacter gracilis RM3268]
 gi|257441696|gb|EEV16838.1| rAre lipoprotein A rlpa [Campylobacter gracilis RM3268]
          Length = 251

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 75/115 (65%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY+I G+ Y P Q +     +G+ASWYG  FHG+ T+NGE+Y    +TAAH T P+ + 
Sbjct: 47  RPYKINGKTYYPEQVSVGDTQIGIASWYGPNFHGKYTSNGEIYDMNGMTAAHKTYPMNTM 106

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           V+VTN + G +  VR+NDRGP+   R+IDLS  AA ++ V  +G + V +E +G 
Sbjct: 107 VKVTNRDTGATATVRINDRGPFVDGRIIDLSKTAANLVGVFAKGTAPVKLEVVGF 161


>gi|149194645|ref|ZP_01871741.1| Rare lipoprotein A [Caminibacter mediatlanticus TB-2]
 gi|149135389|gb|EDM23869.1| Rare lipoprotein A [Caminibacter mediatlanticus TB-2]
          Length = 225

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 85/147 (57%), Gaps = 2/147 (1%)

Query: 69  KPYQIMGRWYVPRQYT--AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
           KPY I G+ Y P       +   G+ASWYG  FHGR T+NGE+Y     TAAH TLP+ +
Sbjct: 36  KPYSINGQMYFPMNSVNIGWTQRGIASWYGPDFHGRYTSNGEIYNMYAYTAAHKTLPMNT 95

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLN 186
            V+VTN+ N  S++VR+NDRGP+   R+IDLS AA K + ++  G + V ++ +G    N
Sbjct: 96  IVKVTNLNNNKSVIVRINDRGPFIKGRIIDLSYAAGKKIGLDVTGTAPVIIKVIGFKGKN 155

Query: 187 GMDQEYLRSTVMVNSATVLPLGCQYRE 213
            +    ++    +N    + L  +Y+ 
Sbjct: 156 YVTGFKVQIGAFINKNGAIVLSNRYKN 182


>gi|294504406|ref|YP_003568468.1| rare lipoprotein A precursor [Yersinia pestis Z176003]
 gi|294354865|gb|ADE65206.1| rare lipoprotein A precursor [Yersinia pestis Z176003]
          Length = 349

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/137 (40%), Positives = 84/137 (61%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G+ Y + +    ++ +G+AS YG+   G  TA GE++    +TAAHPTLP+PSYVR
Sbjct: 47  YKVNGQSYRIIKDPQNFSQIGLASSYGEEARGNTTATGEIFDPNALTAAHPTLPIPSYVR 106

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN+ NG  +VVRVNDRGPY   R+IDLS AAA  L +     +KV ++++ +A    + 
Sbjct: 107 VTNVSNGRQIVVRVNDRGPYTPGRVIDLSRAAADRLNISNN--TKVKIDFINVAPDGSLS 164

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +   +  LP
Sbjct: 165 GPGMVGTTIAKQSYALP 181


>gi|166366960|ref|YP_001659233.1| RlpA-like lipoprotein precursor [Microcystis aeruginosa NIES-843]
 gi|166089333|dbj|BAG04041.1| RlpA-like lipoprotein precursor [Microcystis aeruginosa NIES-843]
          Length = 249

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/92 (56%), Positives = 66/92 (71%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           GMASWYG  FHGR TA+GE + +  +TAAH  LP  + VRVTN+ NG S+VVR+NDRGP+
Sbjct: 157 GMASWYGPGFHGRRTASGETFNSSSLTAAHRYLPFGTKVRVTNLRNGRSVVVRINDRGPF 216

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
              R+IDLS  AA I+ V + GV+ V +E LG
Sbjct: 217 SGGRVIDLSRGAAAIIGVFQSGVAPVVLEVLG 248


>gi|113460465|ref|YP_718527.1| rare lipoprotein A [Haemophilus somnus 129PT]
 gi|112822508|gb|ABI24597.1| possible rare lipoprotein A [Haemophilus somnus 129PT]
          Length = 186

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/95 (56%), Positives = 67/95 (70%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           Y+  GMAS+Y K FHGR TANGE++     TAAH TLPL SYV VTN+ N   ++VR+ND
Sbjct: 67  YSQKGMASFYHKKFHGRKTANGEIFNNNAYTAAHKTLPLNSYVVVTNLRNNRKVIVRIND 126

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+   R+IDLS AAAK L +   G++KV VE L
Sbjct: 127 RGPFSKARIIDLSEAAAKELGMIPAGIAKVKVESL 161


>gi|92113672|ref|YP_573600.1| rare lipoprotein A [Chromohalobacter salexigens DSM 3043]
 gi|91796762|gb|ABE58901.1| rare lipoprotein A [Chromohalobacter salexigens DSM 3043]
          Length = 290

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 74/111 (66%), Gaps = 1/111 (0%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G+ Y V    + Y A G ASWYG  F G  TA+GE Y    ++AAH TLPLP+Y R
Sbjct: 62  YEVWGKTYHVLSDPSGYEAEGEASWYGTKFQGYDTASGEPYDMYKMSAAHRTLPLPTYAR 121

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VTN++NG  ++VR+NDRGP+H +RLIDLS AAA  L++   G   V VE +
Sbjct: 122 VTNLDNGRDVIVRINDRGPFHGDRLIDLSYAAAARLKILGGGTGHVRVEAI 172


>gi|322379280|ref|ZP_08053666.1| rare lipoprotein A (rlpA) [Helicobacter suis HS1]
 gi|322379848|ref|ZP_08054136.1| rare lipoprotein A (rlpA) [Helicobacter suis HS5]
 gi|321147726|gb|EFX42338.1| rare lipoprotein A (rlpA) [Helicobacter suis HS5]
 gi|321148317|gb|EFX42831.1| rare lipoprotein A (rlpA) [Helicobacter suis HS1]
          Length = 303

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 103/182 (56%), Gaps = 7/182 (3%)

Query: 25  CFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVP-RQY 83
            FFS  ++  K +  P+S+    +S  + +G R      R  + +PY + G+ Y P R  
Sbjct: 37  SFFSFFHRHKKNKA-PQSV--TPSSTSLTAGMRDSEAIQRATM-RPYSVGGKMYYPTRVN 92

Query: 84  TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRV 143
                 G ASWYG  FH + T+NGE Y     TAA+ TLP+ + V+VTN  N  S +VR+
Sbjct: 93  VGQTFDGYASWYGPNFHAKRTSNGETYNMYAHTAANKTLPMNTIVKVTNKNNNKSTIVRI 152

Query: 144 NDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNSAT 203
           NDRGP+ +NR+IDLSNAAA+ + +  +GV+ V +E LG   L  + ++Y +S      A 
Sbjct: 153 NDRGPFVANRIIDLSNAAARDIALVGKGVAPVRLEVLGFGGL--IAKQYEKSLDQNKQAK 210

Query: 204 VL 205
           VL
Sbjct: 211 VL 212


>gi|57167672|ref|ZP_00366812.1| lipoprotein, rare lipoprotein A family [Campylobacter coli RM2228]
 gi|305433179|ref|ZP_07402335.1| rare lipoprotein A [Campylobacter coli JV20]
 gi|57020794|gb|EAL57458.1| lipoprotein, rare lipoprotein A family [Campylobacter coli RM2228]
 gi|304443880|gb|EFM36537.1| rare lipoprotein A [Campylobacter coli JV20]
          Length = 279

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 74/119 (62%), Gaps = 1/119 (0%)

Query: 69  KPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY I G+ Y P   +    A G+ASWYG  FHG+ T+NGE Y    +TAAH TLP+ + 
Sbjct: 62  KPYTINGKTYYPTVVSVGETADGIASWYGPGFHGKKTSNGETYNQNGLTAAHKTLPMNTI 121

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLN 186
           ++VTN+ N   + VRVNDRGP+ +NR+IDLS  AA  + +   G + V +E +G    N
Sbjct: 122 LKVTNLNNNRQVTVRVNDRGPFVNNRIIDLSKGAASQIDMIAAGTAPVRLEVIGFGSAN 180


>gi|283956060|ref|ZP_06373547.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni 1336]
 gi|283792380|gb|EFC31162.1| putative lipoprotein [Campylobacter jejuni subsp. jejuni 1336]
          Length = 267

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 73/119 (61%), Gaps = 1/119 (0%)

Query: 69  KPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY I G+ Y P        A G+ASWYG  FHG+ T+NGE Y    +TAAH TLP+ + 
Sbjct: 50  KPYTINGKTYYPTVVAVGETADGIASWYGPGFHGKKTSNGETYNQNALTAAHKTLPMNTI 109

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLN 186
           ++VTN+ N   + VRVNDRGP+ +NR+IDLS  AA  + +   G + V +E +G    N
Sbjct: 110 LKVTNLNNNRQVTVRVNDRGPFVNNRIIDLSKGAASQIDMIASGTAPVRLEVIGFGSSN 168


>gi|253687573|ref|YP_003016763.1| rare lipoprotein A [Pectobacterium carotovorum subsp. carotovorum
           PC1]
 gi|251754151|gb|ACT12227.1| rare lipoprotein A [Pectobacterium carotovorum subsp. carotovorum
           PC1]
          Length = 375

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 74/114 (64%), Gaps = 3/114 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y I G+ Y + +    ++  G+A+WYG+   G  T+ GE +    ITAAHPTLPLPSYVR
Sbjct: 59  YSIKGKSYKIVKDPQNFSETGLAAWYGEEASGNRTSIGETFDPNAITAAHPTLPLPSYVR 118

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VTN+ NG  LVVRVNDRGPY   R+IDLS AA   L +     +KV V+++ +A
Sbjct: 119 VTNLSNGRRLVVRVNDRGPYTPGRIIDLSKAAGDRLNISNN--TKVKVDFINVA 170


>gi|187479629|ref|YP_787654.1| lipoprotein [Bordetella avium 197N]
 gi|115424216|emb|CAJ50769.1| putative lipoprotein [Bordetella avium 197N]
          Length = 295

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 56/113 (49%), Positives = 75/113 (66%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY + G+ YVP  +   +   G+ASWYGK FHG  T+ GE Y    +TAAHPT+PLPSY
Sbjct: 64  RPYVVFGKRYVPDTREQPFRQEGIASWYGKKFHGNSTSIGEPYDMYSMTAAHPTMPLPSY 123

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            RVT+   G +++VRVNDRGP+HS+R++DLS  AA  L +   G   V VE +
Sbjct: 124 ARVTSKATGRTIIVRVNDRGPFHSDRIMDLSYVAAYKLGIIGPGSGPVVVERI 176


>gi|126175478|ref|YP_001051627.1| rare lipoprotein A [Shewanella baltica OS155]
 gi|125998683|gb|ABN62758.1| rare lipoprotein A [Shewanella baltica OS155]
          Length = 277

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 56/137 (40%), Positives = 82/137 (59%), Gaps = 12/137 (8%)

Query: 69  KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY + G  Y V      ++  G ASWYG+ FHG  T+NGE Y    ++ AH TLPLPSY
Sbjct: 74  KPYTVYGESYTVMNTGQGFSETGRASWYGEKFHGYETSNGEPYDMYSMSGAHKTLPLPSY 133

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
            R+TN++N   +++R+NDRGP+HS+R++D+S AAA  L +  +G +++            
Sbjct: 134 ARITNLDNNKQVIIRINDRGPFHSDRILDVSYAAAYKLGMLGKGTARIK----------- 182

Query: 188 MDQEYLRSTVMVNSATV 204
           +D  Y+ S    NSA V
Sbjct: 183 LDVVYVGSVAATNSAVV 199


>gi|22125079|ref|NP_668502.1| rare lipoprotein A [Yersinia pestis KIM 10]
 gi|45440941|ref|NP_992480.1| rare lipoprotein A [Yersinia pestis biovar Microtus str. 91001]
 gi|51595442|ref|YP_069633.1| rare lipoprotein A [Yersinia pseudotuberculosis IP 32953]
 gi|108811251|ref|YP_647018.1| rare lipoprotein A [Yersinia pestis Nepal516]
 gi|145599914|ref|YP_001163990.1| rare lipoprotein A [Yersinia pestis Pestoides F]
 gi|149365497|ref|ZP_01887532.1| rare lipoprotein A precursor [Yersinia pestis CA88-4125]
 gi|153949737|ref|YP_001401913.1| rare lipoprotein A [Yersinia pseudotuberculosis IP 31758]
 gi|165925392|ref|ZP_02221224.1| rare lipoprotein A/sporulation and cell division repeat protein
           [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165937744|ref|ZP_02226306.1| rare lipoprotein A/sporulation and cell division repeat protein
           [Yersinia pestis biovar Orientalis str. IP275]
 gi|166008551|ref|ZP_02229449.1| rare lipoprotein A/sporulation and cell division repeat protein
           [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166212380|ref|ZP_02238415.1| rare lipoprotein A/sporulation and cell division repeat protein
           [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167422571|ref|ZP_02314324.1| rare lipoprotein A/sporulation and cell division repeat protein
           [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167423683|ref|ZP_02315436.1| rare lipoprotein A/sporulation and cell division repeat protein
           [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|167468425|ref|ZP_02333129.1| rare lipoprotein A [Yersinia pestis FV-1]
 gi|218929683|ref|YP_002347558.1| rare lipoprotein A [Yersinia pestis CO92]
 gi|229838148|ref|ZP_04458307.1| minor lipoprotein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229898741|ref|ZP_04513886.1| minor lipoprotein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229901488|ref|ZP_04516610.1| minor lipoprotein [Yersinia pestis Nepal516]
 gi|270489673|ref|ZP_06206747.1| sporulation and cell division repeat protein [Yersinia pestis KIM
           D27]
 gi|20139504|sp|Q8ZDG6|RLPA_YERPE RecName: Full=Rare lipoprotein A; Flags: Precursor
 gi|21957933|gb|AAM84753.1|AE013721_1 rlpA lipoprotein [Yersinia pestis KIM 10]
 gi|45435800|gb|AAS61357.1| rare lipoprotein A precursor [Yersinia pestis biovar Microtus str.
           91001]
 gi|51588724|emb|CAH20335.1| rare lipoprotein A precursor [Yersinia pseudotuberculosis IP 32953]
 gi|108774899|gb|ABG17418.1| rare lipoprotein A precursor [Yersinia pestis Nepal516]
 gi|115348294|emb|CAL21225.1| rare lipoprotein A precursor [Yersinia pestis CO92]
 gi|145211610|gb|ABP41017.1| rare lipoprotein A precursor [Yersinia pestis Pestoides F]
 gi|149291910|gb|EDM41984.1| rare lipoprotein A precursor [Yersinia pestis CA88-4125]
 gi|152961232|gb|ABS48693.1| rare lipoprotein A/sporulation and cell division repeat protein
           [Yersinia pseudotuberculosis IP 31758]
 gi|165914494|gb|EDR33109.1| rare lipoprotein A/sporulation and cell division repeat protein
           [Yersinia pestis biovar Orientalis str. IP275]
 gi|165922999|gb|EDR40150.1| rare lipoprotein A/sporulation and cell division repeat protein
           [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165992933|gb|EDR45234.1| rare lipoprotein A/sporulation and cell division repeat protein
           [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166206311|gb|EDR50791.1| rare lipoprotein A/sporulation and cell division repeat protein
           [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166958585|gb|EDR55606.1| rare lipoprotein A/sporulation and cell division repeat protein
           [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167057853|gb|EDR67599.1| rare lipoprotein A/sporulation and cell division repeat protein
           [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|229681417|gb|EEO77511.1| minor lipoprotein [Yersinia pestis Nepal516]
 gi|229688289|gb|EEO80360.1| minor lipoprotein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229694514|gb|EEO84561.1| minor lipoprotein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|262366392|gb|ACY62949.1| rare lipoprotein A precursor [Yersinia pestis D182038]
 gi|270338177|gb|EFA48954.1| sporulation and cell division repeat protein [Yersinia pestis KIM
           D27]
 gi|320016195|gb|ADV99766.1| minor lipoprotein [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 360

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 56/137 (40%), Positives = 84/137 (61%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G+ Y + +    ++ +G+AS YG+   G  TA GE++    +TAAHPTLP+PSYVR
Sbjct: 58  YKVNGQSYRIIKDPQNFSQIGLASSYGEEARGNTTATGEIFDPNALTAAHPTLPIPSYVR 117

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN+ NG  +VVRVNDRGPY   R+IDLS AAA  L +     +KV ++++ +A    + 
Sbjct: 118 VTNVSNGRQIVVRVNDRGPYTPGRVIDLSRAAADRLNISNN--TKVKIDFINVAPDGSLS 175

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +   +  LP
Sbjct: 176 GPGMVGTTIAKQSYALP 192


>gi|229895940|ref|ZP_04511110.1| Rare lipoprotein A precursor [Yersinia pestis Pestoides A]
 gi|229700863|gb|EEO88892.1| Rare lipoprotein A precursor [Yersinia pestis Pestoides A]
          Length = 317

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 56/137 (40%), Positives = 84/137 (61%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G+ Y + +    ++ +G+AS YG+   G  TA GE++    +TAAHPTLP+PSYVR
Sbjct: 58  YKVNGQSYRIIKDPQNFSQIGLASSYGEEARGNTTATGEIFDPNALTAAHPTLPIPSYVR 117

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN+ NG  +VVRVNDRGPY   R+IDLS AAA  L +     +KV ++++ +A    + 
Sbjct: 118 VTNVSNGRQIVVRVNDRGPYTPGRVIDLSRAAADRLNISNN--TKVKIDFINVAPDGSLS 175

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +   +  LP
Sbjct: 176 GPGMVGTTIAKQSYALP 192


>gi|88810568|ref|ZP_01125825.1| Rare lipoprotein A [Nitrococcus mobilis Nb-231]
 gi|88792198|gb|EAR23308.1| Rare lipoprotein A [Nitrococcus mobilis Nb-231]
          Length = 259

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 71/105 (67%)

Query: 76  RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMEN 135
           R++V R    +   G+ASWYG+ FHGR T++GE+Y    +TAAH  LP+PS V VTN+ N
Sbjct: 44  RYHVLRSADGFVQHGIASWYGRKFHGRRTSSGELYNMYAMTAAHKRLPIPSRVEVTNLTN 103

Query: 136 GISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           G   VVR+NDRGP+  NR+IDLS AAAK L +   G++ V +  L
Sbjct: 104 GRHAVVRINDRGPFVRNRIIDLSYAAAKQLDMLNEGIATVEIRAL 148


>gi|186894473|ref|YP_001871585.1| rare lipoprotein A [Yersinia pseudotuberculosis PB1/+]
 gi|186697499|gb|ACC88128.1| rare lipoprotein A [Yersinia pseudotuberculosis PB1/+]
          Length = 360

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 56/137 (40%), Positives = 84/137 (61%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G+ Y + +    ++ +G+AS YG+   G  TA GE++    +TAAHPTLP+PSYVR
Sbjct: 58  YKVNGQSYRIIKDPQNFSQIGLASSYGEEARGNTTATGEIFDPNALTAAHPTLPIPSYVR 117

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN+ NG  +VVRVNDRGPY   R+IDLS AAA  L +     +KV ++++ +A    + 
Sbjct: 118 VTNVSNGRQIVVRVNDRGPYTPGRVIDLSRAAADRLNISNN--TKVKIDFINVAPDGSLS 175

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +   +  LP
Sbjct: 176 GPGMVGTTIAKQSYALP 192


>gi|170025244|ref|YP_001721749.1| rare lipoprotein A [Yersinia pseudotuberculosis YPIII]
 gi|169751778|gb|ACA69296.1| rare lipoprotein A [Yersinia pseudotuberculosis YPIII]
          Length = 360

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 56/137 (40%), Positives = 84/137 (61%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G+ Y + +    ++ +G+AS YG+   G  TA GE++    +TAAHPTLP+PSYVR
Sbjct: 58  YKVNGQSYRIIKDPQNFSQIGLASSYGEEARGNTTATGEIFDPNALTAAHPTLPIPSYVR 117

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN+ NG  +VVRVNDRGPY   R+IDLS AAA  L +     +KV ++++ +A    + 
Sbjct: 118 VTNVSNGRQIVVRVNDRGPYTPGRVIDLSRAAADRLNISNN--TKVKIDFINVAPDGSLS 175

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +   +  LP
Sbjct: 176 GPGMVGTTIAKQSYALP 192


>gi|313682556|ref|YP_004060294.1| rare lipoprotein a [Sulfuricurvum kujiense DSM 16994]
 gi|313155416|gb|ADR34094.1| rare lipoprotein A [Sulfuricurvum kujiense DSM 16994]
          Length = 251

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 63/158 (39%), Positives = 90/158 (56%), Gaps = 12/158 (7%)

Query: 69  KPYQIMGRWYVPRQ-YTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY +MG+ Y P   +      G ASWYG  FHG+ T+NGE Y    +TAAH TLP+ + 
Sbjct: 41  RPYTVMGKKYYPTVVHVGDTFNGRASWYGPDFHGKSTSNGEAYDMYAMTAAHKTLPMNTV 100

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG------ 181
           VRVTN EN    +VR+NDRGP+  +R+IDLS AAA  + + ++G + V +E LG      
Sbjct: 101 VRVTNTENNAQTIVRINDRGPFVESRIIDLSYAAADQIGLAKKGTAFVTLEVLGFEPGSM 160

Query: 182 ----MALLNGMDQEYLRSTVMVNSATVLPL-GCQYREE 214
               MA L+   Q+ + +T  V   +     G +Y +E
Sbjct: 161 RTINMAQLSSGPQQSVLNTFYVQIGSFSRFQGAKYTKE 198


>gi|108808488|ref|YP_652404.1| rare lipoprotein A [Yersinia pestis Antiqua]
 gi|167399690|ref|ZP_02305214.1| rare lipoprotein A/sporulation and cell division repeat protein
           [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|108780401|gb|ABG14459.1| rare lipoprotein A precursor [Yersinia pestis Antiqua]
 gi|167052194|gb|EDR63602.1| rare lipoprotein A/sporulation and cell division repeat protein
           [Yersinia pestis biovar Antiqua str. UG05-0454]
          Length = 360

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 56/137 (40%), Positives = 84/137 (61%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G+ Y + +    ++ +G+AS YG+   G  TA GE++    +TAAHPTLP+PSYVR
Sbjct: 58  YKVNGQSYRIIKDPQNFSQIGLASSYGEEARGNTTATGEIFDPNALTAAHPTLPIPSYVR 117

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN+ NG  +VVRVNDRGPY   R+IDLS AAA  L +     +KV ++++ +A    + 
Sbjct: 118 VTNVSNGRQIVVRVNDRGPYTPGRVIDLSRAAADRLNISNN--TKVKIDFINVAPDGSLS 175

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +   +  LP
Sbjct: 176 GPGMVGTTIAKQSYALP 192


>gi|161523375|ref|YP_001578387.1| rare lipoprotein A [Burkholderia multivorans ATCC 17616]
 gi|189351852|ref|YP_001947480.1| rare lipoprotein A [Burkholderia multivorans ATCC 17616]
 gi|221202365|ref|ZP_03575398.1| rare lipoprotein A [Burkholderia multivorans CGD2M]
 gi|221208996|ref|ZP_03581992.1| rare lipoprotein A [Burkholderia multivorans CGD2]
 gi|221214190|ref|ZP_03587162.1| rare lipoprotein A [Burkholderia multivorans CGD1]
 gi|160340804|gb|ABX13890.1| rare lipoprotein A [Burkholderia multivorans ATCC 17616]
 gi|189335874|dbj|BAG44944.1| rare lipoprotein A [Burkholderia multivorans ATCC 17616]
 gi|221165845|gb|EED98319.1| rare lipoprotein A [Burkholderia multivorans CGD1]
 gi|221171118|gb|EEE03569.1| rare lipoprotein A [Burkholderia multivorans CGD2]
 gi|221177779|gb|EEE10193.1| rare lipoprotein A [Burkholderia multivorans CGD2M]
          Length = 202

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 67/100 (67%)

Query: 81  RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLV 140
           +  + +   G ASWYGK FHGR TANGE +     TAAH TLPL SY++VTN  NG  +V
Sbjct: 84  KDVSDFRQTGRASWYGKGFHGRRTANGERFNMNAFTAAHRTLPLSSYIKVTNASNGKWVV 143

Query: 141 VRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           V+VNDRGP+   R++DLS AAAK++ +   G  +V +E L
Sbjct: 144 VKVNDRGPFKRGRVLDLSYAAAKVIGLVHAGTGRVKIEGL 183


>gi|160876562|ref|YP_001555878.1| rare lipoprotein A [Shewanella baltica OS195]
 gi|160862084|gb|ABX50618.1| rare lipoprotein A [Shewanella baltica OS195]
 gi|315268756|gb|ADT95609.1| rare lipoprotein A [Shewanella baltica OS678]
          Length = 277

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 51/116 (43%), Positives = 78/116 (67%), Gaps = 3/116 (2%)

Query: 69  KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY + G  Y V      ++  G ASWYG+ FHG  T+NGE Y    ++ AH TLPLPSY
Sbjct: 74  KPYTVYGESYTVMNTGQGFSETGRASWYGEKFHGYETSNGEPYDMYSMSGAHKTLPLPSY 133

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE--YLG 181
            R+TN++N   +++R+NDRGP+HS+R++D+S AAA  L +  +G +++ ++  Y+G
Sbjct: 134 ARITNLDNNKQVIIRINDRGPFHSDRILDVSYAAAHKLGMLGKGTARIKLDVVYVG 189


>gi|209519173|ref|ZP_03267977.1| rare lipoprotein A [Burkholderia sp. H160]
 gi|209500399|gb|EEA00451.1| rare lipoprotein A [Burkholderia sp. H160]
          Length = 198

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 52/93 (55%), Positives = 65/93 (69%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           +  +G ASWYG+ FHG  TANGE Y    +TAAH TLPL SYVRVTN  N  S++VR+ND
Sbjct: 83  FQQIGRASWYGRFFHGHRTANGERYNMHALTAAHRTLPLGSYVRVTNPANSRSVIVRIND 142

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           RGPY   R+IDLS AAA +L +   G ++V +E
Sbjct: 143 RGPYARGRVIDLSMAAAAMLDMRHTGTARVKIE 175


>gi|293397310|ref|ZP_06641582.1| rare lipoprotein A [Serratia odorifera DSM 4582]
 gi|291420228|gb|EFE93485.1| rare lipoprotein A [Serratia odorifera DSM 4582]
          Length = 358

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 75/114 (65%), Gaps = 3/114 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G  Y + +    ++  G+ASWYG+   G  TA GE +    ++AAHPTLP+PSYVR
Sbjct: 58  YKVNGDTYRIVKDPQNFSQTGLASWYGEELSGNTTAIGEPFDPNALSAAHPTLPIPSYVR 117

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VTN+ NG  LVVRVNDRGPY   R+IDLS AAA  L +     +KV V+++ +A
Sbjct: 118 VTNLANGRQLVVRVNDRGPYTKGRIIDLSKAAADRLNLSNN--TKVKVDFINVA 169


>gi|194291109|ref|YP_002007016.1| rare lipoprotein a (rlpa) [Cupriavidus taiwanensis LMG 19424]
 gi|193224944|emb|CAQ70955.1| putative rare lipoprotein A (rlpA) [Cupriavidus taiwanensis LMG
           19424]
          Length = 248

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 51/95 (53%), Positives = 65/95 (68%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           Y   G+ASWYGK FHGR TANGE +    +TAAHP+LPL S+V V N+ N    V+R+ND
Sbjct: 96  YEQRGVASWYGKGFHGRKTANGERFDMRAMTAAHPSLPLDSWVLVRNLRNNKVAVLRIND 155

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGPYH NR++D+S  AA+ L   ERG + V +  L
Sbjct: 156 RGPYHGNRVLDVSYGAARRLGFVERGATNVEIRRL 190


>gi|146293966|ref|YP_001184390.1| rare lipoprotein A [Shewanella putrefaciens CN-32]
 gi|145565656|gb|ABP76591.1| rare lipoprotein A [Shewanella putrefaciens CN-32]
          Length = 281

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 51/120 (42%), Positives = 77/120 (64%), Gaps = 1/120 (0%)

Query: 69  KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY + G  Y V      +   G ASWYG+ FHG  T+NGE Y    ++ AH TLPLPSY
Sbjct: 78  KPYTVYGESYNVMNTGQGFTETGRASWYGEKFHGYETSNGEPYDMYSMSGAHKTLPLPSY 137

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
            ++TN+EN   +++R+NDRGP+HS+R++D+S AAA  L +   G +++ +E + +  + G
Sbjct: 138 AKITNLENNKQVIIRINDRGPFHSDRILDVSYAAAYKLGMLATGTARIKLEVIYIGSIAG 197


>gi|203284631|ref|YP_002222371.1| rare lipoprotein A [Borrelia duttonii Ly]
 gi|203288165|ref|YP_002223180.1| rare lipoprotein A [Borrelia recurrentis A1]
 gi|201084074|gb|ACH93665.1| rare lipoprotein A [Borrelia duttonii Ly]
 gi|201085385|gb|ACH94959.1| rare lipoprotein A [Borrelia recurrentis A1]
          Length = 276

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 76/117 (64%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
           A VG+ASWYG+AFHG+ TANGE +    +TAAH  LP  S VRVTN+ N  ++VVR+NDR
Sbjct: 43  ATVGLASWYGEAFHGKTTANGEKFDMTALTAAHKELPFNSVVRVTNLLNNRTVVVRINDR 102

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNSAT 203
           GP+  +R+IDLS +AA+ L     GV+ V +E L    +  ++ +   + + V  A+
Sbjct: 103 GPFRRDRIIDLSKSAAEKLDFIGIGVAPVKIEILKQVDVKNIENQKSENNLDVKDAS 159


>gi|162419897|ref|YP_001606338.1| rare lipoprotein A [Yersinia pestis Angola]
 gi|162352712|gb|ABX86660.1| rare lipoprotein A/sporulation and cell division repeat protein
           [Yersinia pestis Angola]
          Length = 360

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 56/137 (40%), Positives = 84/137 (61%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G+ Y + +    ++ +G+AS YG+   G  TA GE++    +TAAHPTLP+PSYVR
Sbjct: 58  YKVNGQSYRIIKDPQNFSQIGLASSYGEEARGNTTATGEIFDPNALTAAHPTLPIPSYVR 117

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN+ NG  +VVRVNDRGPY   R+IDLS AAA  L +     +KV ++++ +A    + 
Sbjct: 118 VTNVSNGRQIVVRVNDRGPYTPGRVIDLSRAAADRLNISNN--TKVKIDFINVAPDGSLS 175

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +   +  LP
Sbjct: 176 GPGMVGTTIAKQSYALP 192


>gi|124268525|ref|YP_001022529.1| putative lipoprotein [Methylibium petroleiphilum PM1]
 gi|124261300|gb|ABM96294.1| putative lipoprotein [Methylibium petroleiphilum PM1]
          Length = 230

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 79/133 (59%), Gaps = 3/133 (2%)

Query: 70  PYQIMGRWYVPRQY-TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY I G  Y P      +  +G+ASWYG+ FHGR TANGEVY    +TAAH T+PLPSY 
Sbjct: 94  PYVIRGESYEPDDTDVPWFEIGVASWYGEPFHGRRTANGEVYDMHGMTAAHKTMPLPSYA 153

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGM 188
            V N  NG  +VVRVNDRGP+   R+IDLS AAA+ L +  RG+ +V V  L    +   
Sbjct: 154 VVRNRVNGRQVVVRVNDRGPFIDGRVIDLSFAAARKLGI--RGLGEVEVRRLTHDEIRAG 211

Query: 189 DQEYLRSTVMVNS 201
             + L  T+ V  
Sbjct: 212 SWKKLPQTMAVGE 224


>gi|120597861|ref|YP_962435.1| rare lipoprotein A [Shewanella sp. W3-18-1]
 gi|120557954|gb|ABM23881.1| rare lipoprotein A [Shewanella sp. W3-18-1]
 gi|319427342|gb|ADV55416.1| rare lipoprotein A [Shewanella putrefaciens 200]
          Length = 281

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 51/120 (42%), Positives = 77/120 (64%), Gaps = 1/120 (0%)

Query: 69  KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY + G  Y V      +   G ASWYG+ FHG  T+NGE Y    ++ AH TLPLPSY
Sbjct: 78  KPYTVYGESYNVMNTGQGFTETGRASWYGEKFHGYETSNGEPYDMYSMSGAHKTLPLPSY 137

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
            ++TN+EN   +++R+NDRGP+HS+R++D+S AAA  L +   G +++ +E + +  + G
Sbjct: 138 AKITNLENNKQVIIRINDRGPFHSDRILDVSYAAAYKLGMLATGTARIKLEVIYIGSIAG 197


>gi|113476388|ref|YP_722449.1| rare lipoprotein A [Trichodesmium erythraeum IMS101]
 gi|110167436|gb|ABG51976.1| rare lipoprotein A [Trichodesmium erythraeum IMS101]
          Length = 342

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 67/92 (72%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  FHGRL+ANGE +    +TAAH TLP  + VRVTN+ NG S++VR+NDRGP+
Sbjct: 248 GWASWYGPGFHGRLSANGERFNQYAMTAAHKTLPFGTKVRVTNLHNGSSVIVRINDRGPF 307

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
              R+IDLS+AAA +L + + GV+ V VE + 
Sbjct: 308 IPGRVIDLSSAAADVLDMIQIGVAPVKVEVMA 339


>gi|268679302|ref|YP_003303733.1| lipoprotein A [Sulfurospirillum deleyianum DSM 6946]
 gi|268617333|gb|ACZ11698.1| rare lipoprotein A [Sulfurospirillum deleyianum DSM 6946]
          Length = 264

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 77/117 (65%), Gaps = 3/117 (2%)

Query: 69  KPYQIMGRWYVPRQYTA--YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
           +PY I G+ Y P   +   Y + G+ASWYGK FHG+ T+NGEVY    +TAAH TLP+ +
Sbjct: 59  RPYTIDGKTYTPTMVSVGDYFS-GVASWYGKDFHGKKTSNGEVYNMYDMTAAHKTLPMNT 117

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
            ++VTN++N  S+VVRVNDRGP+   R+IDLS  AA  L +   G   V +E +G A
Sbjct: 118 MLKVTNLKNSKSVVVRVNDRGPFVGTRVIDLSYTAATRLELVAHGTGPVGLEVIGFA 174


>gi|317050979|ref|YP_004112095.1| rare lipoprotein A [Desulfurispirillum indicum S5]
 gi|316946063|gb|ADU65539.1| rare lipoprotein A [Desulfurispirillum indicum S5]
          Length = 264

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 68/181 (37%), Positives = 95/181 (52%), Gaps = 10/181 (5%)

Query: 69  KPYQIMGRWYVPRQY--TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
           + Y I G+ Y P +   T +   G+ASWYG  FHGR T+NGE Y     TAAH TLP+  
Sbjct: 48  RSYTIDGQTYHPVETVSTGFRERGIASWYGHPFHGRKTSNGETYDMYKFTAAHKTLPMNV 107

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLN 186
           YV+V N+ENG S +VR+NDRGP+   R+IDLS AAA+ + +   G + V +  LG  L +
Sbjct: 108 YVQVNNLENGKSTIVRINDRGPFAPRRIIDLSKAAAERIDMVGPGTAPVEIIVLGYNLRD 167

Query: 187 GMDQ-------EYLRSTVMVNSAT-VLPLGCQYREEIVVIPYLLTRSRTVHLNNCDDDSL 238
              Q       ++ RS  M+      L +G     E         R++  H++    DS 
Sbjct: 168 PRAQTTRHQTGDFFRSREMIQQGNFTLQVGAFRSRENAEQQAQQLRTQYQHVSVTPHDSP 227

Query: 239 Q 239
           Q
Sbjct: 228 Q 228


>gi|21675080|ref|NP_663145.1| rare lipoprotein A [Chlorobium tepidum TLS]
 gi|21648320|gb|AAM73487.1| rare lipoprotein A [Chlorobium tepidum TLS]
          Length = 169

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 75/117 (64%), Gaps = 7/117 (5%)

Query: 69  KPYQIMGRWYVP---RQYTAYAAVGMASWYGK----AFHGRLTANGEVYGTEYITAAHPT 121
           KPY I GR YVP    Q   Y   G+ASWYGK      +G+ TA GE++  +  +AAH  
Sbjct: 49  KPYLIDGRLYVPMSFDQVYGYEETGLASWYGKETLDQHNGQPTAYGEIFDPDLPSAAHKY 108

Query: 122 LPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           LPLP  VRVTN+EN  S++VRVNDRGP+   R+IDLS AAAK L    +G ++V +E
Sbjct: 109 LPLPMIVRVTNLENNTSIIVRVNDRGPFVDGRVIDLSAAAAKALGFYGKGTARVKIE 165


>gi|157164643|ref|YP_001467174.1| drug/metabolite exporter (DME) family protein [Campylobacter
           concisus 13826]
 gi|112801378|gb|EAT98722.1| rAre lipoprotein A rlpa [Campylobacter concisus 13826]
          Length = 286

 Score =  108 bits (271), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 55/115 (47%), Positives = 76/115 (66%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY I G+ Y P   +    A G ASWYG  FHG+ T+NGEVY    +TAAH TLP+ + 
Sbjct: 51  RPYTINGKTYYPTVVSVGDKASGTASWYGPNFHGKTTSNGEVYNMYNMTAAHKTLPMNTI 110

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           ++VTN+ N  S++VRVNDRGP+ ++R++DLS AAA  L V   G + V +E +G 
Sbjct: 111 LKVTNLRNQKSVIVRVNDRGPFVADRVLDLSKAAAMKLDVIGTGTAPVSMEVIGF 165


>gi|304410305|ref|ZP_07391924.1| rare lipoprotein A [Shewanella baltica OS183]
 gi|307301984|ref|ZP_07581742.1| rare lipoprotein A [Shewanella baltica BA175]
 gi|304351714|gb|EFM16113.1| rare lipoprotein A [Shewanella baltica OS183]
 gi|306914022|gb|EFN44443.1| rare lipoprotein A [Shewanella baltica BA175]
          Length = 277

 Score =  108 bits (271), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 102/192 (53%), Gaps = 22/192 (11%)

Query: 69  KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY + G  Y V      ++  G ASWYG+ FHG  T+NGE Y    ++ AH TLPLPSY
Sbjct: 74  KPYTVYGESYTVMNTGQGFSETGRASWYGEKFHGYETSNGEPYDMYSMSGAHKTLPLPSY 133

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
            R+TN++N   +++R+NDRGP+HS+R++D+S AAA  L +  +G +++            
Sbjct: 134 ARITNLDNNKQVIIRINDRGPFHSDRILDVSYAAAYKLGMLGKGTARIK----------- 182

Query: 188 MDQEYLRSTVMVNS--ATVLPLGCQYREEIVVIPYLLTRSRTVHLNNCDDDSLQKQREIS 245
           +D  Y+ S    NS  A+    G  Y +       L+       LN    D L+++ +I 
Sbjct: 183 LDVVYVGSVAATNSAVASAQDTGNHYIQ-------LVASKDRAKLNAMAKD-LEQKYQIK 234

Query: 246 LRERKKSNLIPL 257
            R +  +N+  L
Sbjct: 235 TRVQAANNMFRL 246


>gi|119487731|ref|ZP_01621240.1| hypothetical protein L8106_29655 [Lyngbya sp. PCC 8106]
 gi|119455564|gb|EAW36701.1| hypothetical protein L8106_29655 [Lyngbya sp. PCC 8106]
          Length = 352

 Score =  108 bits (271), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 53/95 (55%), Positives = 67/95 (70%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
           A  G+ASWYG  FHGRLTANGE +    +TAAH +LP  + VRVTN  NG S+VVR+NDR
Sbjct: 255 AVEGLASWYGPGFHGRLTANGERFNQYELTAAHRSLPFGTAVRVTNTNNGRSVVVRINDR 314

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           GP+   R+IDLS AAA+ + +   GV++V VE L 
Sbjct: 315 GPFSGGRIIDLSVAAAQEIGMISSGVAQVKVEVLA 349


>gi|159027154|emb|CAO86785.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 245

 Score =  108 bits (271), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 52/92 (56%), Positives = 66/92 (71%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           GMASWYG  FHGR TA+GE + +  +TAAH  LP  + VRVTN+ NG S+VVR+NDRGP+
Sbjct: 153 GMASWYGPGFHGRRTASGETFNSGGLTAAHRYLPFGTRVRVTNLRNGRSVVVRINDRGPF 212

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
              R+IDLS  AA I+ V + GV+ V +E LG
Sbjct: 213 SGGRVIDLSRGAAAIIGVFQSGVAPVVLEVLG 244


>gi|113869518|ref|YP_728007.1| rare lipoprotein A [Ralstonia eutropha H16]
 gi|113528294|emb|CAJ94639.1| rare lipoprotein A [Ralstonia eutropha H16]
          Length = 256

 Score =  108 bits (271), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 50/91 (54%), Positives = 64/91 (70%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G++SWYGK FHGR TANGE +    +TAAHPTLPL S+V V N+ N    V+R+NDRGPY
Sbjct: 108 GVSSWYGKGFHGRKTANGERFDMRAMTAAHPTLPLDSWVLVRNLRNNKVAVLRINDRGPY 167

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           H NR++D+S  AA+ L   ERG + V +  L
Sbjct: 168 HGNRVLDVSYGAARRLGFVERGATNVEIRRL 198


>gi|37525262|ref|NP_928606.1| rare lipoprotein A [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|36784689|emb|CAE13589.1| Rare lipoprotein A precursor [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 332

 Score =  108 bits (271), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 79/114 (69%), Gaps = 3/114 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ+ G  Y + +  + ++  G ASWYG+   G++TA GE +    +TAAHPTLP+PSYVR
Sbjct: 55  YQMNGHTYHIVQAPSQFSETGYASWYGEESSGKMTAIGERFNPYALTAAHPTLPIPSYVR 114

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VTN+ NG  ++VRVNDRGPY   R+IDLS A+A+ L + +   +KV V+++ +A
Sbjct: 115 VTNLSNGRMMIVRVNDRGPYKPGRIIDLSKASAERLNLTQS--TKVKVDFIEVA 166


>gi|223039866|ref|ZP_03610150.1| 30S ribosomal protein S16 [Campylobacter rectus RM3267]
 gi|222878875|gb|EEF13972.1| 30S ribosomal protein S16 [Campylobacter rectus RM3267]
          Length = 286

 Score =  108 bits (271), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 54/115 (46%), Positives = 75/115 (65%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQY-TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY I G+ Y P        A G+ASWYG  FHG+ T+NGE+Y    +TAAH TLP+ + 
Sbjct: 55  RPYTINGKTYYPTVVKVGDRASGIASWYGPDFHGKRTSNGEIYDMHAMTAAHKTLPMNTM 114

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           VRVTN++NG +++VR+NDRGP+ + R+IDLS   A  L V   G + V +E +G 
Sbjct: 115 VRVTNIKNGKNIIVRINDRGPFVAGRVIDLSKTGAVKLDVFNAGTAPVLLEVVGF 169


>gi|222823661|ref|YP_002575235.1| rare lipoprotein A [Campylobacter lari RM2100]
 gi|222538883|gb|ACM63984.1| rare lipoprotein A [Campylobacter lari RM2100]
          Length = 279

 Score =  108 bits (271), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 53/116 (45%), Positives = 73/116 (62%), Gaps = 1/116 (0%)

Query: 69  KPYQIMGRWYVPRQY-TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY I G+ Y P        A G+ASWYG  FHG+ T+NGE Y     TAAH TLP+ + 
Sbjct: 63  KPYTINGKTYYPTVVEVGETADGIASWYGPGFHGKKTSNGETYDQHAYTAAHKTLPMNTI 122

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           V+VTN++N     VR+NDRGP+ + R+IDLSN AA+ + + + G + V +E +G  
Sbjct: 123 VKVTNLKNHRQTTVRINDRGPFVAGRIIDLSNMAARDIDMIQSGTAPVRLEVIGFG 178


>gi|113969332|ref|YP_733125.1| rare lipoprotein A [Shewanella sp. MR-4]
 gi|113884016|gb|ABI38068.1| rare lipoprotein A [Shewanella sp. MR-4]
          Length = 280

 Score =  108 bits (271), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 53/116 (45%), Positives = 77/116 (66%), Gaps = 3/116 (2%)

Query: 69  KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY + G  Y V      ++  G ASWYG+ FHG  T+NGE Y    ++ AH TLPLPSY
Sbjct: 77  KPYTVYGESYTVLDSGQGFSETGRASWYGEKFHGYETSNGEPYDMYGMSGAHKTLPLPSY 136

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE--YLG 181
            RVTN++N   +++R+NDRGP+HS+R++DLS AAA  L +   G +++ ++  Y+G
Sbjct: 137 ARVTNLDNNKQVIIRINDRGPFHSDRILDLSYAAAYKLGMLGTGTARIKLDVIYIG 192


>gi|292490706|ref|YP_003526145.1| lipoprotein A [Nitrosococcus halophilus Nc4]
 gi|291579301|gb|ADE13758.1| rare lipoprotein A [Nitrosococcus halophilus Nc4]
          Length = 259

 Score =  108 bits (271), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 56/108 (51%), Positives = 72/108 (66%), Gaps = 1/108 (0%)

Query: 71  YQIMG-RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G R++  R    Y   G+ASWYG  FHGR T++GE Y    +TAAH +LPLPSYV 
Sbjct: 59  YEVNGQRYHTLRSSRGYREKGIASWYGSKFHGRRTSSGETYDMYGMTAAHRSLPLPSYVV 118

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           VTN+ N   +V+RVNDRGP+HS+R+IDLS AAA  L +   G   V V
Sbjct: 119 VTNLSNQRQVVLRVNDRGPFHSDRIIDLSYAAAVKLGLAREGTGLVEV 166


>gi|253990638|ref|YP_003041994.1| rare lipoprotein A [Photorhabdus asymbiotica subsp. asymbiotica
           ATCC 43949]
 gi|253782088|emb|CAQ85252.1| rare lipoprotein a [Photorhabdus asymbiotica]
          Length = 336

 Score =  108 bits (271), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 52/114 (45%), Positives = 80/114 (70%), Gaps = 3/114 (2%)

Query: 71  YQIMGR-WYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ+ G  +++ +  + ++  G ASWYG   +G++TA GE +    +TAAHPTLP+PSYVR
Sbjct: 55  YQMNGHIYHIVQDPSQFSETGYASWYGAEHNGKMTAIGERFNPYALTAAHPTLPIPSYVR 114

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VTN+ NG  ++VRVNDRGPY   R+IDLS A+A+ L + +   +KV ++++ +A
Sbjct: 115 VTNLSNGRMMIVRVNDRGPYKPGRIIDLSKASAERLNLTQS--TKVKIDFIQVA 166


>gi|153001829|ref|YP_001367510.1| rare lipoprotein A [Shewanella baltica OS185]
 gi|217972276|ref|YP_002357027.1| rare lipoprotein A [Shewanella baltica OS223]
 gi|151366447|gb|ABS09447.1| rare lipoprotein A [Shewanella baltica OS185]
 gi|217497411|gb|ACK45604.1| rare lipoprotein A [Shewanella baltica OS223]
          Length = 277

 Score =  108 bits (270), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 51/116 (43%), Positives = 78/116 (67%), Gaps = 3/116 (2%)

Query: 69  KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY + G  Y V      ++  G ASWYG+ FHG  T+NGE Y    ++ AH TLPLPSY
Sbjct: 74  KPYTVYGESYTVMNTGQGFSETGRASWYGEKFHGYETSNGEPYDMYSMSGAHKTLPLPSY 133

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE--YLG 181
            R+TN++N   +++R+NDRGP+HS+R++D+S AAA  L +  +G +++ ++  Y+G
Sbjct: 134 ARITNLDNNKQVIIRINDRGPFHSDRILDVSYAAAYKLGMLGKGTARIKLDVVYVG 189


>gi|117919441|ref|YP_868633.1| rare lipoprotein A [Shewanella sp. ANA-3]
 gi|117611773|gb|ABK47227.1| rare lipoprotein A [Shewanella sp. ANA-3]
          Length = 280

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 53/116 (45%), Positives = 77/116 (66%), Gaps = 3/116 (2%)

Query: 69  KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY + G  Y V      ++  G ASWYG+ FHG  T+NGE Y    ++ AH TLPLPSY
Sbjct: 77  KPYTVYGESYTVLDSGQGFSETGRASWYGEKFHGYETSNGEPYDMYGMSGAHKTLPLPSY 136

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE--YLG 181
            RVTN++N   +++R+NDRGP+HS+R++DLS AAA  L +   G +++ ++  Y+G
Sbjct: 137 ARVTNLDNNKQVIIRINDRGPFHSDRILDLSYAAAYKLGMLGTGTARIKLDVIYIG 192


>gi|170741041|ref|YP_001769696.1| rare lipoprotein A [Methylobacterium sp. 4-46]
 gi|168195315|gb|ACA17262.1| rare lipoprotein A [Methylobacterium sp. 4-46]
          Length = 121

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 56/94 (59%), Positives = 66/94 (70%), Gaps = 2/94 (2%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
           A  G+ASWYG  FHGR TANGE + T  +TAAH  LP  S VRVTN  NG S+VVR+NDR
Sbjct: 30  AQAGVASWYGPGFHGRRTANGERFDTHALTAAHRFLPFGSRVRVTNNSNGRSVVVRINDR 89

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           GPY   R+IDLSNAAA+ + V   GV+KV +  L
Sbjct: 90  GPYVGGRVIDLSNAAARAIGVS--GVAKVRIARL 121


>gi|282897031|ref|ZP_06305033.1| Rare lipoprotein A precursor [Raphidiopsis brookii D9]
 gi|281197683|gb|EFA72577.1| Rare lipoprotein A precursor [Raphidiopsis brookii D9]
          Length = 332

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 53/92 (57%), Positives = 67/92 (72%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           GMASWYG  + GR TANGE +  E +TAAH +LP+ + VRVTN  NG S++VR+NDRGPY
Sbjct: 240 GMASWYGYDWAGRKTANGERFNPEAMTAAHRSLPMGTRVRVTNTHNGRSVIVRINDRGPY 299

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
              R+IDLS  AA+IL +  RGV+ V +E LG
Sbjct: 300 IGGRVIDLSVGAARILGMVSRGVAAVRIEVLG 331


>gi|186474891|ref|YP_001856361.1| rare lipoprotein A [Burkholderia phymatum STM815]
 gi|184191350|gb|ACC69315.1| rare lipoprotein A [Burkholderia phymatum STM815]
          Length = 199

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 53/95 (55%), Positives = 66/95 (69%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           +   G ASWYG+ FHGR TANGE +    +TAAH TLPL SYVRVTN     S+VV++ND
Sbjct: 82  FHQTGRASWYGRGFHGRKTANGERFDMHALTAAHRTLPLGSYVRVTNPATNDSVVVKIND 141

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGPY   R++DLS AAAKIL +   G ++V +E L
Sbjct: 142 RGPYARGRVLDLSYAAAKILHLAHIGTARVKIEGL 176


>gi|114046559|ref|YP_737109.1| rare lipoprotein A [Shewanella sp. MR-7]
 gi|113888001|gb|ABI42052.1| rare lipoprotein A [Shewanella sp. MR-7]
          Length = 280

 Score =  108 bits (270), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 53/116 (45%), Positives = 77/116 (66%), Gaps = 3/116 (2%)

Query: 69  KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY + G  Y V      ++  G ASWYG+ FHG  T+NGE Y    ++ AH TLPLPSY
Sbjct: 77  KPYTVYGESYTVLDSGQGFSETGRASWYGEKFHGYETSNGEPYDMYGMSGAHKTLPLPSY 136

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE--YLG 181
            RVTN++N   +++R+NDRGP+HS+R++DLS AAA  L +   G +++ ++  Y+G
Sbjct: 137 ARVTNLDNNKQVIIRINDRGPFHSDRILDLSYAAAYKLGMLGTGTARIKLDVIYIG 192


>gi|291277363|ref|YP_003517135.1| putative rare lipoprotein A, RlpA [Helicobacter mustelae 12198]
 gi|290964557|emb|CBG40410.1| putative rare lipoprotein A, RlpA [Helicobacter mustelae 12198]
          Length = 319

 Score =  108 bits (270), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 73/117 (62%), Gaps = 1/117 (0%)

Query: 70  PYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY+I GRWY P R        G+ASWYG  FH + T+NGE Y     TAA  TLP+ + V
Sbjct: 94  PYKIAGRWYYPSRVDVGDIFDGIASWYGPNFHEKKTSNGETYNMYAHTAASKTLPMNTIV 153

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALL 185
           +V N ENG   +VR+NDRGP+   R+IDLSNAAA  + +  +G ++V +E +G   L
Sbjct: 154 KVYNKENGKITIVRINDRGPFVDGRIIDLSNAAAHDIGMVNKGTAQVRLEVIGFGGL 210


>gi|57242605|ref|ZP_00370542.1| lipoprotein, rare lipoprotein A family [Campylobacter upsaliensis
           RM3195]
 gi|57016534|gb|EAL53318.1| lipoprotein, rare lipoprotein A family [Campylobacter upsaliensis
           RM3195]
          Length = 276

 Score =  108 bits (270), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 74/123 (60%), Gaps = 1/123 (0%)

Query: 69  KPYQIMGRWYVPRQY-TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY I G+ Y P        A G+ASWYG  FHG+ T+NGE Y    +TAAH TLP+ + 
Sbjct: 59  KPYTINGKTYYPTVVEVGETADGIASWYGPGFHGKKTSNGETYDQNGLTAAHKTLPMNTI 118

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
           ++VTN+ N   + VRVNDRGP+  NR+IDLS  AA  + +   G + V +E +G    N 
Sbjct: 119 LKVTNLNNNRQVTVRVNDRGPFAHNRIIDLSKGAAGKIDMIHAGTAPVRLEVIGFGNKNS 178

Query: 188 MDQ 190
            ++
Sbjct: 179 GNE 181


>gi|291295741|ref|YP_003507139.1| rare lipoprotein A [Meiothermus ruber DSM 1279]
 gi|290470700|gb|ADD28119.1| rare lipoprotein A [Meiothermus ruber DSM 1279]
          Length = 199

 Score =  108 bits (269), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 69/91 (75%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG  FHGR TA+GE +   ++TAAH TLP  + VRVTN++NG S+VVR+NDRGP+
Sbjct: 108 GLASWYGARFHGRRTASGERFNKYHLTAAHRTLPFNAQVRVTNLQNGKSVVVRINDRGPH 167

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R+IDLS AAA+++ + + GV  V VE+L
Sbjct: 168 IRGRIIDLSYAAARLIGMHQSGVVLVRVEWL 198


>gi|145641830|ref|ZP_01797405.1| lipoprotein [Haemophilus influenzae R3021]
 gi|145273452|gb|EDK13323.1| lipoprotein [Haemophilus influenzae 22.4-21]
          Length = 287

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 87/147 (59%), Gaps = 13/147 (8%)

Query: 41  ESMYGVTASD-RIVSGKRVPRGGGRYFLGKPYQIMGRWYVPR---QYTAYAAVGMASWYG 96
           + MYG+   +  I +    PR          Y + G+ Y  +   +  +Y   G+AS+Y 
Sbjct: 28  QKMYGIRGDNLSIATQMPAPR---------TYSVKGQTYTTKSGNEAKSYIKEGLASYYH 78

Query: 97  KAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLID 156
             F+GR TA+G+VY ++  TAAH TLP+ SY  VTN+ N   ++VR+NDRGP+   RLID
Sbjct: 79  LKFNGRKTASGDVYNSKQFTAAHKTLPINSYALVTNLHNNRKVIVRINDRGPFSDKRLID 138

Query: 157 LSNAAAKILRVEERGVSKVHVEYLGMA 183
           LS+AAAK + +  RG+ +V +E L +A
Sbjct: 139 LSHAAAKEIGLISRGIGQVRIEALHVA 165


>gi|24372748|ref|NP_716790.1| rare lipoprotein A [Shewanella oneidensis MR-1]
 gi|24346819|gb|AAN54235.1|AE015560_8 rare lipoprotein A [Shewanella oneidensis MR-1]
          Length = 283

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 53/116 (45%), Positives = 76/116 (65%), Gaps = 3/116 (2%)

Query: 69  KPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY + G  Y V      ++  G ASWYG+ FHG  T+NGE Y    ++ AH TLPLPSY
Sbjct: 79  KPYTVYGESYTVLNSGEGFSETGRASWYGEKFHGYETSNGEPYDMYGMSGAHKTLPLPSY 138

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE--YLG 181
            RVTN++N   +++R+NDRGP+HS R++DLS AAA  L +   G +++ ++  Y+G
Sbjct: 139 ARVTNLDNNKQVIIRINDRGPFHSERILDLSYAAAYKLGMLGTGTARIKLDVIYIG 194


>gi|145630678|ref|ZP_01786457.1| RlpA-like protein [Haemophilus influenzae R3021]
 gi|144983804|gb|EDJ91254.1| RlpA-like protein [Haemophilus influenzae R3021]
          Length = 287

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 98/179 (54%), Gaps = 20/179 (11%)

Query: 9   LLKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASD-RIVSGKRVPRGGGRYFL 67
           L  G  + V++L M S  F        ++   + MYG+   +  I +    PR       
Sbjct: 3   LKTGLNLTVLLLFMISVAFP-------VQADTQKMYGIRGDNLSIATQMPAPR------- 48

Query: 68  GKPYQIMGRWYVPR---QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
              Y + G+ Y  +   +  +Y   G+AS+Y   F GR TA+G+VY ++  TAAH TLP+
Sbjct: 49  --TYSVKGQTYTTKSGNEAKSYIKEGLASYYHLKFDGRKTASGDVYNSKQFTAAHKTLPI 106

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
            SY  VTN+ N   ++VR+NDRGP+   RLIDLS+AAAK + +  RG+ +V +E L +A
Sbjct: 107 NSYALVTNLHNNRKVIVRINDRGPFSDKRLIDLSHAAAKEIGLISRGIGQVRIEALHVA 165


>gi|73542950|ref|YP_297470.1| rare lipoprotein A [Ralstonia eutropha JMP134]
 gi|72120363|gb|AAZ62626.1| Rare lipoprotein A [Ralstonia eutropha JMP134]
          Length = 247

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 59/149 (39%), Positives = 85/149 (57%), Gaps = 18/149 (12%)

Query: 32  KDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGM 91
           K DK +    +++G+   D  +SG+ +   G R  +G                ++   GM
Sbjct: 60  KADKPDTGSWNLFGLDQDDSSLSGRSLD--GLRADMG----------------SFEQRGM 101

Query: 92  ASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHS 151
           ASWYGK FHGR TANGE +    +TAAHP+LPL S+V V N+ N    V+R+NDRGPYH 
Sbjct: 102 ASWYGKGFHGRKTANGERFDMRAMTAAHPSLPLDSWVLVRNLRNNKVAVLRINDRGPYHG 161

Query: 152 NRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           NR++D+S  AA+ L   + G ++V +  L
Sbjct: 162 NRVLDVSYGAARRLGFVDHGATQVEIRRL 190


>gi|194337825|ref|YP_002019619.1| rare lipoprotein A [Pelodictyon phaeoclathratiforme BU-1]
 gi|194310302|gb|ACF45002.1| rare lipoprotein A [Pelodictyon phaeoclathratiforme BU-1]
          Length = 154

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 62/127 (48%), Positives = 81/127 (63%), Gaps = 11/127 (8%)

Query: 65  YFLGK----PYQIMGRWYVPRQYT---AYAAVGMASWYGKA----FHGRLTANGEVYGTE 113
           Y LGK    PY I G+ YVP  Y    +Y   G+ASWYG+      +G+LTA GEV+   
Sbjct: 26  YRLGKIKNTPYVINGKVYVPMSYEEALSYQESGIASWYGQETLDQHNGQLTAYGEVFDPS 85

Query: 114 YITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVS 173
             +AAH  LPLPS V+VTN+E   S+VVRVNDRGP+  +R+IDLS  AAK L   ++G +
Sbjct: 86  KPSAAHKYLPLPSIVKVTNLETRASMVVRVNDRGPFVGDRVIDLSAEAAKRLGFYQKGSA 145

Query: 174 KVHVEYL 180
           KV +E +
Sbjct: 146 KVKIEVI 152


>gi|330828594|ref|YP_004391546.1| Rare lipoprotein A [Aeromonas veronii B565]
 gi|328803730|gb|AEB48929.1| Rare lipoprotein A [Aeromonas veronii B565]
          Length = 312

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/120 (46%), Positives = 77/120 (64%), Gaps = 5/120 (4%)

Query: 61  GGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHP 120
           G   Y++GK  Q    W   R    Y+  G ASW      G+ TANG+V  ++  +AAH 
Sbjct: 46  GNRDYWIGK--QKHEVW---RDIKHYSEEGTASWLSPDLDGQKTANGDVLDSKLFSAAHR 100

Query: 121 TLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            LP+PSYVRVTN++NG+  +VRVNDRGP++S RLIDLS AAAK L + + G ++V +E +
Sbjct: 101 NLPIPSYVRVTNLDNGLETIVRVNDRGPFNSPRLIDLSYAAAKQLEMVDSGEARVRLELI 160


>gi|78187929|ref|YP_375972.1| rare lipoprotein A [Chlorobium luteolum DSM 273]
 gi|78167831|gb|ABB24929.1| Rare lipoprotein A [Chlorobium luteolum DSM 273]
          Length = 169

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 64/119 (53%), Positives = 75/119 (63%), Gaps = 7/119 (5%)

Query: 70  PYQIMGRWYVPRQY---TAYAAVGMASWYGKAF----HGRLTANGEVYGTEYITAAHPTL 122
           PY I GR YVP  Y   TAY  VG ASWYG       +G+ TA GE +     +AAH  L
Sbjct: 50  PYVIDGRIYVPMSYEQATAYEEVGRASWYGHETLDKNNGQPTAYGEPFDPAEPSAAHKYL 109

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           PLPS VRVTN+EN  S+VVRVNDRGP+  +R+IDLS  AAK L    +G +KV VE L 
Sbjct: 110 PLPSVVRVTNLENSRSIVVRVNDRGPFVDDRVIDLSAEAAKQLGFYLQGTAKVRVEVLN 168


>gi|16272005|ref|NP_438203.1| lipoprotein [Haemophilus influenzae Rd KW20]
 gi|145639681|ref|ZP_01795284.1| lipoprotein [Haemophilus influenzae PittII]
 gi|260580666|ref|ZP_05848493.1| lipoprotein [Haemophilus influenzae RdAW]
 gi|2495670|sp|Q57092|RLPA_HAEIN RecName: Full=RlpA-like protein; Flags: Precursor
 gi|1572975|gb|AAC21708.1| lipoprotein, putative [Haemophilus influenzae Rd KW20]
 gi|145271238|gb|EDK11152.1| lipoprotein [Haemophilus influenzae PittII]
 gi|260092728|gb|EEW76664.1| lipoprotein [Haemophilus influenzae RdAW]
 gi|309750651|gb|ADO80635.1| Rare lipoprotein A-like protein [Haemophilus influenzae R2866]
          Length = 287

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 86/147 (58%), Gaps = 13/147 (8%)

Query: 41  ESMYGVTASD-RIVSGKRVPRGGGRYFLGKPYQIMGRWYVPR---QYTAYAAVGMASWYG 96
           + MYG+   +  I +    PR          Y + G+ Y  +   +  +Y   G+AS+Y 
Sbjct: 28  QKMYGIRGDNLSIATQMPAPR---------TYSVKGQTYTTKSGNEAKSYIKEGLASYYH 78

Query: 97  KAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLID 156
             F GR TA+G+VY ++  TAAH TLP+ SY  VTN+ N   ++VR+NDRGP+   RLID
Sbjct: 79  LKFDGRKTASGDVYNSKQFTAAHKTLPINSYALVTNLHNNRKVIVRINDRGPFSDKRLID 138

Query: 157 LSNAAAKILRVEERGVSKVHVEYLGMA 183
           LS+AAAK + +  RG+ +V +E L +A
Sbjct: 139 LSHAAAKEIGLISRGIGQVRIEALHVA 165


>gi|332289416|ref|YP_004420268.1| rare lipoprotein A [Gallibacterium anatis UMN179]
 gi|330432312|gb|AEC17371.1| rare lipoprotein A [Gallibacterium anatis UMN179]
          Length = 278

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/113 (49%), Positives = 73/113 (64%), Gaps = 3/113 (2%)

Query: 69  KPYQIMG---RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLP 125
           K Y + G   R    ++   YA  G AS+Y   F G+ T++GEVY  +  TAAH TLPL 
Sbjct: 53  KTYTVKGVRYRTVTTKEAKTYAKQGKASFYHPKFVGQRTSSGEVYNEKLFTAAHKTLPLN 112

Query: 126 SYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           SYV VTN+ N   +VVR+NDRGP+HSNR+IDLS AAAK L +   GV+ V ++
Sbjct: 113 SYVLVTNLRNHKKVVVRINDRGPFHSNRIIDLSKAAAKELGMTGHGVANVKLD 165


>gi|260582056|ref|ZP_05849851.1| lipoprotein [Haemophilus influenzae NT127]
 gi|319774982|ref|YP_004137470.1| RlpA-like protein [Haemophilus influenzae F3047]
 gi|329123116|ref|ZP_08251686.1| lipoprotein [Haemophilus aegyptius ATCC 11116]
 gi|260094946|gb|EEW78839.1| lipoprotein [Haemophilus influenzae NT127]
 gi|317449573|emb|CBY85778.1| RlpA-like protein [Haemophilus influenzae F3047]
 gi|327471671|gb|EGF17113.1| lipoprotein [Haemophilus aegyptius ATCC 11116]
          Length = 287

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 86/147 (58%), Gaps = 13/147 (8%)

Query: 41  ESMYGVTASD-RIVSGKRVPRGGGRYFLGKPYQIMGRWYVPR---QYTAYAAVGMASWYG 96
           + MYG+   +  I +    PR          Y + G+ Y  +   +  +Y   G+AS+Y 
Sbjct: 28  QKMYGIRGDNLSIATQMPAPR---------TYSVKGQTYTTKSGNEAKSYIKEGLASYYH 78

Query: 97  KAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLID 156
             F GR TA+G+VY ++  TAAH TLP+ SY  VTN+ N   ++VR+NDRGP+   RLID
Sbjct: 79  LKFDGRKTASGDVYNSKQFTAAHKTLPINSYALVTNLHNNRKVIVRINDRGPFSDKRLID 138

Query: 157 LSNAAAKILRVEERGVSKVHVEYLGMA 183
           LS+AAAK + +  RG+ +V +E L +A
Sbjct: 139 LSHAAAKEIGLISRGIGQVRIEALHVA 165


>gi|330815177|ref|YP_004358882.1| Lipoprotein A family protein [Burkholderia gladioli BSR3]
 gi|327367570|gb|AEA58926.1| Lipoprotein A family protein [Burkholderia gladioli BSR3]
          Length = 210

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 50/88 (56%), Positives = 63/88 (71%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG+AFHGR TANGE +    +TAAH TLPL SYV+V N  NG S+VV++NDRGP+
Sbjct: 100 GKASWYGRAFHGRRTANGERFDMNELTAAHRTLPLSSYVKVINQSNGKSVVVKINDRGPF 159

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHV 177
              R++DLS AAAKI+ +   G   V +
Sbjct: 160 KRGRVLDLSYAAAKIIGLVHAGTGSVKI 187


>gi|261855868|ref|YP_003263151.1| lipoprotein A [Halothiobacillus neapolitanus c2]
 gi|261836337|gb|ACX96104.1| rare lipoprotein A [Halothiobacillus neapolitanus c2]
          Length = 284

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 82/137 (59%), Gaps = 7/137 (5%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y ++GR Y V      Y A G+ASWYG  F  + T++GE Y    +TAAH TL +PSYV 
Sbjct: 58  YSVLGRTYHVLGSNDGYDAQGVASWYGPNFQSKPTSSGERYNMYAMTAAHKTLRIPSYVL 117

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTNMENG  +VVRVNDRGP+ SNR+IDLS AAAK + +  RG + V V  +        D
Sbjct: 118 VTNMENGKQVVVRVNDRGPFVSNRIIDLSYAAAKKIGMIGRGTAMVDVRSI------TPD 171

Query: 190 QEYLRSTVMVNSATVLP 206
                S  +V+ A  LP
Sbjct: 172 SPIPTSQTIVSGAPTLP 188


>gi|319896452|ref|YP_004134645.1| rlpa-like protein [Haemophilus influenzae F3031]
 gi|317431954|emb|CBY80302.1| RlpA-like protein [Haemophilus influenzae F3031]
          Length = 287

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 86/147 (58%), Gaps = 13/147 (8%)

Query: 41  ESMYGVTASD-RIVSGKRVPRGGGRYFLGKPYQIMGRWYVPR---QYTAYAAVGMASWYG 96
           + MYG+   +  I +    PR          Y + G+ Y  +   +  +Y   G+AS+Y 
Sbjct: 28  QKMYGIRGDNLSIATQMPAPR---------TYSVKGQTYTTKSGNEAKSYIKEGLASYYH 78

Query: 97  KAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLID 156
             F GR TA+G+VY ++  TAAH TLP+ SY  VTN+ N   ++VR+NDRGP+   RLID
Sbjct: 79  LKFDGRKTASGDVYNSKQFTAAHKTLPINSYALVTNLHNNRKVIVRINDRGPFSDKRLID 138

Query: 157 LSNAAAKILRVEERGVSKVHVEYLGMA 183
           LS+AAAK + +  RG+ +V +E L +A
Sbjct: 139 LSHAAAKEIGLISRGIGQVRIEALHVA 165


>gi|148825689|ref|YP_001290442.1| lipoprotein [Haemophilus influenzae PittEE]
 gi|229846949|ref|ZP_04467055.1| lipoprotein [Haemophilus influenzae 7P49H1]
 gi|148715849|gb|ABQ98059.1| lipoprotein [Haemophilus influenzae PittEE]
 gi|229810033|gb|EEP45753.1| lipoprotein [Haemophilus influenzae 7P49H1]
          Length = 287

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 86/147 (58%), Gaps = 13/147 (8%)

Query: 41  ESMYGVTASD-RIVSGKRVPRGGGRYFLGKPYQIMGRWYVPR---QYTAYAAVGMASWYG 96
           + MYG+   +  I +    PR          Y + G+ Y  +   +  +Y   G+AS+Y 
Sbjct: 28  QKMYGIRGDNLSIATQMPAPR---------TYSVKGQTYTTKSGNEAKSYIKEGLASYYH 78

Query: 97  KAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLID 156
             F GR TA+G+VY ++  TAAH TLP+ SY  VTN+ N   ++VR+NDRGP+   RLID
Sbjct: 79  LKFDGRKTASGDVYNSKQFTAAHKTLPINSYALVTNLHNNRKVIVRINDRGPFSDKRLID 138

Query: 157 LSNAAAKILRVEERGVSKVHVEYLGMA 183
           LS+AAAK + +  RG+ +V +E L +A
Sbjct: 139 LSHAAAKEIGLISRGIGQVRIEALHVA 165


>gi|148285044|ref|YP_001249134.1| rare lipoprotein A precursor [Orientia tsutsugamushi str. Boryong]
 gi|146740483|emb|CAM81038.1| Rare lipoprotein A precursor [Orientia tsutsugamushi str. Boryong]
          Length = 221

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 76/119 (63%), Gaps = 1/119 (0%)

Query: 63  GRYFLGKPYQIMGRWYVPRQY-TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPT 121
           G Y +GKPY+I G+ Y PRQ    +  VG ASWY        TAN + +   ++TAAH  
Sbjct: 48  GHYKIGKPYKINGKVYSPRQVANNFQQVGYASWYSCKNSNSKTANSDTFNPSHLTAAHHI 107

Query: 122 LPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           LP+PS ++VTN++N  +L++ VNDRGP+   R++D+S   A++L    +G++KV +E +
Sbjct: 108 LPMPSIIKVTNLQNTRTLILMVNDRGPFAKRRVLDISKRGAELLGFIRQGITKVKIELM 166


>gi|300715825|ref|YP_003740628.1| Rare lipoprotein A [Erwinia billingiae Eb661]
 gi|299061661|emb|CAX58777.1| Rare lipoprotein A [Erwinia billingiae Eb661]
          Length = 377

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 74/114 (64%), Gaps = 3/114 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + G+ Y + +  + ++  G+A+WYG       TA GE +  + +TAAHPTLPLPSYVR
Sbjct: 59  YTVNGKTYKIVKDPSNFSETGLAAWYGDEAGSNRTATGEQFDPDALTAAHPTLPLPSYVR 118

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VTN+ NG  LVVRVNDRGPY   R+IDLS AA   L +     +KV ++Y+ +A
Sbjct: 119 VTNLANGRQLVVRVNDRGPYTPGRVIDLSRAAGDRLNISNN--TKVKIDYIKVA 170


>gi|83747434|ref|ZP_00944473.1| Rare lipoprotein A [Ralstonia solanacearum UW551]
 gi|207744750|ref|YP_002261142.1| lipoprotein [Ralstonia solanacearum IPO1609]
 gi|83725891|gb|EAP73030.1| Rare lipoprotein A [Ralstonia solanacearum UW551]
 gi|206596160|emb|CAQ63087.1| lipoprotein [Ralstonia solanacearum IPO1609]
          Length = 235

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 71/112 (63%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG+ FHGR TA+GE +     T AHP+LPL S+V V N+ N   +V +V DRGPY
Sbjct: 98  GLASWYGRGFHGRRTASGERFDMNAFTVAHPSLPLSSWVLVRNLANDRVVVAKVTDRGPY 157

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNS 201
           H  R+IDLS AAAK L    RG ++V +  L  A ++ +  E  ++ V  NS
Sbjct: 158 HGKRIIDLSYAAAKRLDFVRRGSTQVEIRRLSRAEVDALRPELTQTDVASNS 209


>gi|68248581|ref|YP_247693.1| RlpA-like protein [Haemophilus influenzae 86-028NP]
 gi|229845376|ref|ZP_04465507.1| RlpA-like protein [Haemophilus influenzae 6P18H1]
 gi|68056780|gb|AAX87033.1| RlpA-like protein [Haemophilus influenzae 86-028NP]
 gi|229811684|gb|EEP47382.1| RlpA-like protein [Haemophilus influenzae 6P18H1]
          Length = 287

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 86/147 (58%), Gaps = 13/147 (8%)

Query: 41  ESMYGVTASD-RIVSGKRVPRGGGRYFLGKPYQIMGRWYVPR---QYTAYAAVGMASWYG 96
           + MYG+   +  I +    PR          Y + G+ Y  +   +  +Y   G+AS+Y 
Sbjct: 28  QKMYGIRGDNLSIATQMPAPR---------TYSVKGQTYTTKSGNEAKSYIKEGLASYYH 78

Query: 97  KAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLID 156
             F GR TA+G+VY ++  TAAH TLP+ SY  VTN+ N   ++VR+NDRGP+   RLID
Sbjct: 79  LKFDGRKTASGDVYNSKQFTAAHKTLPINSYALVTNLHNNRKVIVRINDRGPFSDKRLID 138

Query: 157 LSNAAAKILRVEERGVSKVHVEYLGMA 183
           LS+AAAK + +  RG+ +V +E L +A
Sbjct: 139 LSHAAAKEIGLISRGIGQVRIEALHVA 165


>gi|309972836|gb|ADO96037.1| Rare lipoprotein A-like protein [Haemophilus influenzae R2846]
          Length = 287

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 98/179 (54%), Gaps = 20/179 (11%)

Query: 9   LLKGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASD-RIVSGKRVPRGGGRYFL 67
           L  G  + V++L M S  F        ++   + MYG+   +  I +    PR       
Sbjct: 3   LKTGLNLTVLLLFMISVAFP-------VQADTQKMYGIRGDNLSIATQMPAPR------- 48

Query: 68  GKPYQIMGRWYVPR---QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
              Y + G+ Y  +   +  +Y   G+AS+Y   F GR TA+G+VY ++  TAAH TLP+
Sbjct: 49  --TYSVKGQTYTTKSGNEAKSYIKEGLASYYHLKFDGRKTASGDVYNSKQFTAAHKTLPI 106

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
            SY  VTN+ N   ++VR+NDRGP+   RLIDLS+AAAK + +  RG+ +V +E L +A
Sbjct: 107 NSYALVTNLHNNRKVIVRINDRGPFSDKRLIDLSHAAAKEIGLISRGIGQVRIEALHVA 165


>gi|254250880|ref|ZP_04944198.1| Rare lipoprotein A [Burkholderia dolosa AUO158]
 gi|124893489|gb|EAY67369.1| Rare lipoprotein A [Burkholderia dolosa AUO158]
          Length = 203

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 67/100 (67%)

Query: 81  RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLV 140
           +  + +   G ASWYG+ FHGR TANGE +     TAAH TLPL SY++VTN  NG  +V
Sbjct: 85  KDISDFHQTGRASWYGRDFHGRRTANGERFNMNAFTAAHRTLPLSSYIKVTNASNGKWVV 144

Query: 141 VRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           V+VNDRGP+   R++DLS AAAK++ +   G  +V +E L
Sbjct: 145 VKVNDRGPFKRGRVLDLSYAAAKVIGLVHAGTGRVKIEGL 184


>gi|194335017|ref|YP_002016877.1| rare lipoprotein A [Prosthecochloris aestuarii DSM 271]
 gi|194312835|gb|ACF47230.1| rare lipoprotein A [Prosthecochloris aestuarii DSM 271]
          Length = 194

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 104/190 (54%), Gaps = 18/190 (9%)

Query: 9   LLKGSVVCV-VVLGMSSCFFSSTYKDDKLEYFPESMYGVTA---SDRI-----VSGKRVP 59
           + K + +C+  V+G+SSC    T  +        ++  V +   SD I     +S +   
Sbjct: 1   MKKTAFLCLGAVIGLSSCSVVKTTANTAASIGSFAVKTVASPFTSDEIESIDGLSPEEAV 60

Query: 60  RGGGRYFLGKPYQIMGRWYVP---RQYTAYAAVGMASWYGKAFH----GRLTANGEVYGT 112
           R G       PY + GR YVP    +   Y+  G+ASWYG+       G +TANGE +  
Sbjct: 61  RQG--RVKNAPYVVHGRTYVPMSMEEAQNYSETGIASWYGEETRSKPGGTITANGESFHP 118

Query: 113 EYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGV 172
           + ++AAH  LPLP YVRVTN+EN  S++VRVNDRGP+   R+IDLS  AAK L   + G 
Sbjct: 119 DRVSAAHKYLPLPVYVRVTNLENRNSIIVRVNDRGPFAHERVIDLSAGAAKKLGFYDYGT 178

Query: 173 SKVHVEYLGM 182
           ++V +E + +
Sbjct: 179 ARVKLEVVSL 188


>gi|269139991|ref|YP_003296692.1| rare lipoprotein A [Edwardsiella tarda EIB202]
 gi|267985652|gb|ACY85481.1| rare lipoprotein A [Edwardsiella tarda EIB202]
 gi|304559824|gb|ADM42488.1| Rare lipoprotein A precursor [Edwardsiella tarda FL6-60]
          Length = 373

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 78/108 (72%), Gaps = 2/108 (1%)

Query: 76  RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMEN 135
           R+ + +  + ++ +G+A+ YG+   G +TA+GE +  E ++AAHPTLP+PSYVRVTN+ N
Sbjct: 68  RYTIVKDPSNFSQIGLAASYGEENRGNVTASGEQFNPEAMSAAHPTLPIPSYVRVTNLAN 127

Query: 136 GISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           G  +VVR+NDRGPY   R+IDLS+AAA  L + +   +KV V+++ +A
Sbjct: 128 GRRIVVRINDRGPYTPGRIIDLSSAAANRLNITQH--TKVRVDFINVA 173


>gi|255322555|ref|ZP_05363700.1| 30S ribosomal protein S16 [Campylobacter showae RM3277]
 gi|255300463|gb|EET79735.1| 30S ribosomal protein S16 [Campylobacter showae RM3277]
          Length = 233

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/115 (46%), Positives = 74/115 (64%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQY-TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY I G+ Y P        A G+ASWYG  FHG+ T+NGE Y    +TAAH TLP+ + 
Sbjct: 2   RPYTINGKTYYPTVVKVGDRASGIASWYGPDFHGKKTSNGETYDMHAMTAAHKTLPMNTM 61

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           VRVTN++NG +++VR+NDRGP+ + R+IDLS   A  L V   G + V +E +G 
Sbjct: 62  VRVTNIKNGKNIIVRINDRGPFVAGRVIDLSKTGAVKLDVFNAGTAPVLLEVVGF 116


>gi|119953513|ref|YP_945722.1| rare lipoprotein A [Borrelia turicatae 91E135]
 gi|119862284|gb|AAX18052.1| rare lipoprotein A [Borrelia turicatae 91E135]
          Length = 266

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 53/111 (47%), Positives = 73/111 (65%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
           A VG+ASWYG+AFHG+ TANGE +    +TAAH  LP  + VRVTN+ N  ++VVR+NDR
Sbjct: 35  ATVGLASWYGEAFHGKSTANGEKFDMTALTAAHKELPFNTIVRVTNLLNNRTVVVRINDR 94

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTV 197
           GP+  +R+IDLS +AA+ L     GV+ V +E L     N +  +  + TV
Sbjct: 95  GPFRKDRIIDLSKSAAEKLDFLGIGVAPVKIEILEQLDENKVVTQEAKKTV 145


>gi|239818119|ref|YP_002947029.1| lipoprotein A [Variovorax paradoxus S110]
 gi|239804696|gb|ACS21763.1| rare lipoprotein A [Variovorax paradoxus S110]
          Length = 391

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 73/113 (64%), Gaps = 2/113 (1%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY ++GR Y P      +   G+ASWYG+ FH   TA+GE Y    +TAAH TLPLPSY
Sbjct: 73  KPYTVLGRAYQPITDDRPFRESGIASWYGRKFHSASTASGEPYDMYAMTAAHKTLPLPSY 132

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VRV N  NG  ++VRVNDRGP+   R+IDLS  AA  L +  RGV+ V +E +
Sbjct: 133 VRVRNPANGREVIVRVNDRGPFVDGRIIDLSYTAALKLDL-LRGVAPVEIERI 184


>gi|158333628|ref|YP_001514800.1| rare lipoprotein A [Acaryochloris marina MBIC11017]
 gi|158303869|gb|ABW25486.1| rare lipoprotein A, putative [Acaryochloris marina MBIC11017]
          Length = 335

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/95 (54%), Positives = 65/95 (68%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           Y   G ASWYG  FHG  TANGEVY    +TAAH TLP  + VRVTN+ NG S+VVR+ND
Sbjct: 240 YQVNGEASWYGPGFHGNYTANGEVYNQYALTAAHKTLPFGTRVRVTNLYNGRSVVVRIND 299

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+   R+IDLS  AA+++ V   GV+ V ++ L
Sbjct: 300 RGPFIPGRIIDLSQGAAQLIGVTSSGVAPVQMDIL 334


>gi|299065248|emb|CBJ36414.1| putative rare lipoprotein A (rlpA) [Ralstonia solanacearum CMR15]
          Length = 234

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 70/112 (62%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG+ FHGR TA+GE +     T AHP+LPL S+V V N+ N   +V +V DRGPY
Sbjct: 97  GLASWYGRGFHGRRTASGERFDMNAFTVAHPSLPLSSWVLVRNLSNDRVVVAKVTDRGPY 156

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNS 201
           H  R+IDLS AAAK L    RG ++V +  L  A +  +  E  ++ V  NS
Sbjct: 157 HGKRIIDLSYAAAKRLDFVRRGSTQVEIRRLSRAEVEALRPELTQTDVASNS 208


>gi|94969620|ref|YP_591668.1| rare lipoprotein A [Candidatus Koribacter versatilis Ellin345]
 gi|94551670|gb|ABF41594.1| rare lipoprotein A [Candidatus Koribacter versatilis Ellin345]
          Length = 166

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 70/101 (69%)

Query: 80  PRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISL 139
           P++ T    VG ASWYGK FHG+ TA+GE Y    +TAAHP LPL + V+VTN+ N  ++
Sbjct: 53  PKKKTKPFQVGPASWYGKLFHGKQTASGETYNMYEMTAAHPDLPLGTRVKVTNLRNDKAV 112

Query: 140 VVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +VRVNDRGP    R+IDLS  AA++L   ++GV KV ++ +
Sbjct: 113 IVRVNDRGPLVPGRIIDLSYGAAQVLGFSDKGVQKVRLDIV 153


>gi|282901318|ref|ZP_06309244.1| Rare lipoprotein A [Cylindrospermopsis raciborskii CS-505]
 gi|281193813|gb|EFA68784.1| Rare lipoprotein A [Cylindrospermopsis raciborskii CS-505]
          Length = 360

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/92 (58%), Positives = 66/92 (71%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           GMASWYG  + GR TANGE +  E +TAAH +LPL + VRVTN  NG S+VVR+NDRGPY
Sbjct: 268 GMASWYGYDWAGRKTANGERFNPEAMTAAHRSLPLGTKVRVTNTHNGRSVVVRINDRGPY 327

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
              R+IDLS  AA+IL +   GV+ V +E LG
Sbjct: 328 IGGRVIDLSVGAARILGMVSSGVAAVRIEVLG 359


>gi|17547984|ref|NP_521386.1| lipoprotein [Ralstonia solanacearum GMI1000]
 gi|17430290|emb|CAD17055.1| probable lipoprotein [Ralstonia solanacearum GMI1000]
          Length = 234

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 70/112 (62%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG+ FHGR TA+GE +     T AHP+LPL S+V V N+ N   +V +V DRGPY
Sbjct: 97  GLASWYGRGFHGRRTASGERFDMNAFTVAHPSLPLSSWVLVRNLSNDRVVVAKVTDRGPY 156

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNS 201
           H  R+IDLS AAAK L    RG ++V +  L  A +  +  E  ++ V  NS
Sbjct: 157 HGKRIIDLSYAAAKRLDFVRRGSTQVEIRRLSRAEVEALRPELTQTDVASNS 208


>gi|320353517|ref|YP_004194856.1| rare lipoprotein A [Desulfobulbus propionicus DSM 2032]
 gi|320122019|gb|ADW17565.1| rare lipoprotein A [Desulfobulbus propionicus DSM 2032]
          Length = 282

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 61/143 (42%), Positives = 82/143 (57%), Gaps = 9/143 (6%)

Query: 40  PESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVPR-QYTAYAAVGMASWYGKA 98
           P++  GVT S +  +  +  +        +PY I G  Y P      Y   G+ASWYG+ 
Sbjct: 31  PKTREGVTQSGKKRAKSKATQ--------RPYVINGITYYPIPSAVGYVERGLASWYGEP 82

Query: 99  FHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLS 158
           FHGR T+NGE Y     TAAH TLP+ + + V N+ENG S VVR+NDRGP+   R+IDL+
Sbjct: 83  FHGRKTSNGETYNMYGDTAAHKTLPMDTMLLVKNLENGRSTVVRINDRGPFVQERIIDLT 142

Query: 159 NAAAKILRVEERGVSKVHVEYLG 181
              AK L V  +G +KV +  LG
Sbjct: 143 YTKAKALGVVGKGTAKVEIVALG 165


>gi|145298089|ref|YP_001140930.1| rare lipoprotein A [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142850861|gb|ABO89182.1| Rare lipoprotein A [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 316

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 57/120 (47%), Positives = 75/120 (62%), Gaps = 5/120 (4%)

Query: 61  GGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHP 120
           G   Y++GK  Q    W   R    Y   G ASW      G+ TANG+V  ++  +AAH 
Sbjct: 60  GNRDYWIGK--QKNEVW---RDIKHYTEEGTASWLAPDLDGQKTANGDVLDSKLFSAAHR 114

Query: 121 TLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            LPLPSYVRVTN+ NG+  +VRVNDRGP+ S+RLIDLS AAAK L + + G ++V +E +
Sbjct: 115 NLPLPSYVRVTNLSNGLETIVRVNDRGPFGSDRLIDLSYAAAKQLDMIDSGEARVRLELI 174


>gi|325577706|ref|ZP_08147981.1| rare lipoprotein A [Haemophilus parainfluenzae ATCC 33392]
 gi|325160451|gb|EGC72577.1| rare lipoprotein A [Haemophilus parainfluenzae ATCC 33392]
          Length = 202

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 52/114 (45%), Positives = 74/114 (64%), Gaps = 2/114 (1%)

Query: 69  KPYQIMGRWYVPR--QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
           + Y++ G+ Y  +  +  +Y+  G AS+Y   F+GR TANGE Y +   TAAH TLPL S
Sbjct: 48  QSYEVNGKTYTTQGDEAKSYSKEGTASYYHHKFNGRKTANGERYNSALFTAAHKTLPLNS 107

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           Y  VTN+ N   ++VR+NDRGP+   R+IDLS++AAK L +  RG  +V +E L
Sbjct: 108 YAVVTNLHNNRKVIVRINDRGPFSEKRIIDLSHSAAKELGLIARGTGQVRIEAL 161


>gi|317047294|ref|YP_004114942.1| rare lipoprotein A [Pantoea sp. At-9b]
 gi|316948911|gb|ADU68386.1| rare lipoprotein A [Pantoea sp. At-9b]
          Length = 362

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 74/114 (64%), Gaps = 3/114 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + G+ Y + +    ++ VG+A+ YG    G  TA GE +  E +TAAHPTLPLPSYVR
Sbjct: 59  YSVNGKSYRIVKNPANFSEVGLATSYGDEARGNRTAIGETFDPEAMTAAHPTLPLPSYVR 118

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VTN  NG  +VVRVNDRGPY   R+IDLS AAA  L +     ++V V+Y+ +A
Sbjct: 119 VTNQANGRQIVVRVNDRGPYTPGRIIDLSRAAADRLNISNN--TRVRVDYINVA 170


>gi|300702575|ref|YP_003744175.1| rare lipoprotein a (rlpa) [Ralstonia solanacearum CFBP2957]
 gi|299070236|emb|CBJ41527.1| putative rare lipoprotein A (rlpA) [Ralstonia solanacearum
           CFBP2957]
          Length = 235

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 70/112 (62%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG+ FHGR TA+GE +     T AHP+LPL S+V V N+ N   +V +V DRGPY
Sbjct: 98  GLASWYGRGFHGRRTASGERFDMNAFTVAHPSLPLSSWVLVRNLANDRVVVAKVTDRGPY 157

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNS 201
           H  R+IDLS AAAK L    RG ++V +  L  A +  +  E  ++ V  NS
Sbjct: 158 HGKRIIDLSYAAAKRLDFVRRGSTQVEIRRLSHAEVEALRPELTQTDVASNS 209


>gi|294637511|ref|ZP_06715797.1| lipoprotein A [Edwardsiella tarda ATCC 23685]
 gi|291089343|gb|EFE21904.1| lipoprotein A [Edwardsiella tarda ATCC 23685]
          Length = 387

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 77/108 (71%), Gaps = 2/108 (1%)

Query: 76  RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMEN 135
           R+ + +  + ++ +G+A+ YG+   G +TA+GE +  + +TAAHPTLP+PSYVRVTN+ N
Sbjct: 66  RYTIVKDPSNFSQIGLAASYGEENRGNVTASGEQFNPDAMTAAHPTLPIPSYVRVTNLAN 125

Query: 136 GISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           G  LVVR+NDRGPY   R+IDLS AAA  L + +   +KV ++++ +A
Sbjct: 126 GRRLVVRINDRGPYTPGRIIDLSTAAANRLNLTQH--TKVRIDFIDVA 171


>gi|325520983|gb|EGC99939.1| rare lipoprotein A [Burkholderia sp. TJI49]
          Length = 203

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 66/100 (66%)

Query: 81  RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLV 140
           +  + +   G ASWYGK FHGR TANGE +     TAAH TLPL SY++VTN   G  +V
Sbjct: 85  KDVSDFRQTGRASWYGKDFHGRRTANGERFNMNAFTAAHRTLPLSSYIKVTNASTGKWVV 144

Query: 141 VRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           V+VNDRGP+   R++DLS AAAK++ +   G  +V +E L
Sbjct: 145 VKVNDRGPFKRGRVLDLSYAAAKVIGLVHAGTGRVKIEGL 184


>gi|332705907|ref|ZP_08425981.1| rare lipoprotein A [Lyngbya majuscula 3L]
 gi|332355311|gb|EGJ34777.1| rare lipoprotein A [Lyngbya majuscula 3L]
          Length = 360

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 50/91 (54%), Positives = 65/91 (71%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           GMASWYG  FHGR TA+GE +    +TAAH TL   + VRVTNM NG S++VR+NDRGP+
Sbjct: 269 GMASWYGPGFHGRRTASGERFNQYALTAAHRTLRFGTRVRVTNMRNGRSVIVRINDRGPH 328

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
             +RLIDLS  AA+++ +E  G + V +E L
Sbjct: 329 SRSRLIDLSRGAARVIGLERSGTAAVRLEVL 359


>gi|254411243|ref|ZP_05025020.1| Rare lipoprotein A-like double-psi beta-barrel [Microcoleus
           chthonoplastes PCC 7420]
 gi|196181744|gb|EDX76731.1| Rare lipoprotein A-like double-psi beta-barrel [Microcoleus
           chthonoplastes PCC 7420]
          Length = 435

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 48/83 (57%), Positives = 61/83 (73%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG  FHGR TA GE+Y    +TAAHPTLP  +Y++V N+ENG S++VR+NDRGPY
Sbjct: 335 GIASWYGPYFHGRYTATGEIYDQHDLTAAHPTLPFDTYLKVKNLENGHSVIVRINDRGPY 394

Query: 150 HSNRLIDLSNAAAKILRVEERGV 172
              R +DLS  AA+ +R E  GV
Sbjct: 395 IPGRTLDLSRQAARSIRSEIVGV 417


>gi|171057929|ref|YP_001790278.1| rare lipoprotein A [Leptothrix cholodnii SP-6]
 gi|170775374|gb|ACB33513.1| rare lipoprotein A [Leptothrix cholodnii SP-6]
          Length = 409

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 65/160 (40%), Positives = 92/160 (57%), Gaps = 9/160 (5%)

Query: 30  TYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPYQIMGRWYVP-RQYTAYAA 88
           T +D      P  ++ V  ++  V   RV   GG     KPY ++GR Y P  +      
Sbjct: 65  TERDGPEANPPPDLHKVPDAEPKVEALRV---GG---PNKPYAVLGRQYTPMTRDEPVLE 118

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G+ASWYG+ FHGR TA+GEVY    +T AH T P+PSY R+ N  NG  ++VR+NDRGP
Sbjct: 119 RGLASWYGRKFHGRRTASGEVYNMYAMTGAHRTFPIPSYARIRNPANGREVIVRINDRGP 178

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM-ALLNG 187
           +  +R++D+S  AA  L +   GV++V VE +   A+ NG
Sbjct: 179 FKRDRVVDVSYTAALKLGILG-GVTEVEVERITHEAIRNG 217


>gi|194337747|ref|YP_002019541.1| rare lipoprotein A [Pelodictyon phaeoclathratiforme BU-1]
 gi|194310224|gb|ACF44924.1| rare lipoprotein A [Pelodictyon phaeoclathratiforme BU-1]
          Length = 171

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 71/103 (68%), Gaps = 2/103 (1%)

Query: 81  RQYTAYAAV--GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGIS 138
           RQ+ A+  V  G AS+Y   FHGR TANGE +    +TAAHP+LP  ++VRVTN+ N   
Sbjct: 60  RQHKAHVPVTEGKASFYANQFHGRKTANGETFNMNQLTAAHPSLPFGTWVRVTNLRNRKE 119

Query: 139 LVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           ++VR+NDRGPY   R+IDLS  AAK + + + G++KV +E LG
Sbjct: 120 VIVRINDRGPYVKGRVIDLSIGAAKKIGLLKSGITKVKLEALG 162


>gi|78064866|ref|YP_367635.1| rare lipoprotein A [Burkholderia sp. 383]
 gi|77965611|gb|ABB06991.1| Rare lipoprotein A [Burkholderia sp. 383]
          Length = 214

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 67/100 (67%)

Query: 81  RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLV 140
           +  + +   G ASWYG+ FHGR TANGE +    +TAAH TLPL SY++VTN   G  +V
Sbjct: 96  KDVSDFRQTGRASWYGRDFHGRRTANGERFNMNALTAAHRTLPLSSYIKVTNASTGKWVV 155

Query: 141 VRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           V+VNDRGPY   R++DLS AAAK++ +   G  +V +E L
Sbjct: 156 VKVNDRGPYKRGRVLDLSYAAAKLIGLVHAGTGRVKIEGL 195


>gi|319796500|ref|YP_004158140.1| rare lipoprotein a [Variovorax paradoxus EPS]
 gi|315598963|gb|ADU40029.1| rare lipoprotein A [Variovorax paradoxus EPS]
          Length = 385

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 73/113 (64%), Gaps = 2/113 (1%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY ++GR Y P      +   G+ASWYG+ FH   T++GE Y    +TAAH TLPLPSY
Sbjct: 73  KPYTVLGRGYQPITDDRPFRESGLASWYGRKFHAASTSSGEPYDMYAMTAAHKTLPLPSY 132

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VRV N  NG  ++VRVNDRGP+   R+IDLS  AA  L +  RGV+ V +E +
Sbjct: 133 VRVRNPANGREVIVRVNDRGPFVDGRVIDLSYTAALKLDL-LRGVAPVEIERI 184


>gi|224373221|ref|YP_002607593.1| rare lipoprotein A [Nautilia profundicola AmH]
 gi|223589275|gb|ACM93011.1| rare lipoprotein A [Nautilia profundicola AmH]
          Length = 226

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 51/120 (42%), Positives = 74/120 (61%), Gaps = 2/120 (1%)

Query: 69  KPYQIMGRWYVPRQYT--AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
           K Y + G  Y P+      ++  G+ASWYG  FHG+ T+NGE+Y     TAAH TLP+ +
Sbjct: 37  KAYSVNGSVYYPKSTVPLGWSQRGIASWYGPNFHGKYTSNGEIYNMYAFTAAHKTLPMDT 96

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLN 186
            V+VTN+ NG S++VR+NDRGP+   R+IDLS  A K + ++  G + V +  +G    N
Sbjct: 97  MVKVTNLNNGKSVIVRINDRGPFVRGRIIDLSYVAGKQIGLDRTGTAPVKITVIGFKGKN 156


>gi|186473139|ref|YP_001860481.1| rare lipoprotein A [Burkholderia phymatum STM815]
 gi|184195471|gb|ACC73435.1| rare lipoprotein A [Burkholderia phymatum STM815]
          Length = 212

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 66/93 (70%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           +  +G+ASWYG  FHGR TANGE Y    +TAAH TLPL SYVRVT++ N  S+VVR+ND
Sbjct: 99  FRQLGLASWYGHGFHGRRTANGEHYDMYAMTAAHRTLPLGSYVRVTSLANARSVVVRIND 158

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           RGPY   R+IDLS  AA  L +   GV+KV +E
Sbjct: 159 RGPYARGRVIDLSYLAATELGMHRAGVTKVAIE 191


>gi|262038863|ref|ZP_06012210.1| rare lipoprotein A [Leptotrichia goodfellowii F0264]
 gi|261747114|gb|EEY34606.1| rare lipoprotein A [Leptotrichia goodfellowii F0264]
          Length = 157

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 66/94 (70%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
           +Y   G AS+YG  +HGR TANGE++ T  +TAAH TLP  + VRVTN+ NG S+VVR+N
Sbjct: 61  SYFQTGTASFYGGKWHGRKTANGEIFDTYKLTAAHKTLPFGTRVRVTNLSNGKSVVVRIN 120

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           +RGPY   R+IDLS AA   +    +GV+KV +E
Sbjct: 121 NRGPYSKGRIIDLSQAAFSKIENMSKGVTKVKLE 154


>gi|332528030|ref|ZP_08404063.1| rare lipoprotein A [Rubrivivax benzoatilyticus JA2]
 gi|332112603|gb|EGJ12396.1| rare lipoprotein A [Rubrivivax benzoatilyticus JA2]
          Length = 308

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 74/113 (65%), Gaps = 2/113 (1%)

Query: 69  KPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY++ G+ YVP      Y+  G+ASWYG AFHG+ T++GE Y    +TAAH TLPLPSY
Sbjct: 59  KPYEVFGKRYVPMDADLPYSERGLASWYGTAFHGKSTSSGEPYDMYAMTAAHKTLPLPSY 118

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
             V N  NG  +VVRVNDRGP+ + R+IDLS  AA  L +   GV+ V V  L
Sbjct: 119 AVVRNPANGREVVVRVNDRGPFVAGRIIDLSYTAALRLGLLA-GVAPVEVRRL 170


>gi|219685501|ref|ZP_03540318.1| rare lipoprotein A [Borrelia garinii Far04]
 gi|219672900|gb|EED29922.1| rare lipoprotein A [Borrelia garinii Far04]
          Length = 262

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 67/94 (71%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
           A VG+ASWYG+AFHG++TANGE +    +TAAH  LP  + VRVTN+ N  S+VVR+NDR
Sbjct: 31  ATVGLASWYGEAFHGKITANGEKFDMMALTAAHKELPFNTAVRVTNLLNNRSVVVRINDR 90

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           GP+  +R+IDLS  AA+ L     GV+ V +E +
Sbjct: 91  GPFRKDRIIDLSKHAAEKLDFLGIGVAPVKIEVI 124


>gi|302036641|ref|YP_003796963.1| hypothetical protein NIDE1284 [Candidatus Nitrospira defluvii]
 gi|300604705|emb|CBK41037.1| exported protein of unknown function, putative Rare lipoprotein A
           [Candidatus Nitrospira defluvii]
          Length = 219

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 65/92 (70%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYGK FHG+L ANGE +     TAAH  LPL S VRV N  NG ++ VR+NDRGPY
Sbjct: 47  GVASWYGKEFHGKLAANGEAFDMTAFTAAHRKLPLGSVVRVVNFTNGKTVQVRINDRGPY 106

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
            + R++DLS+AAA+ L + E G + V +E +G
Sbjct: 107 VAGRMLDLSHAAARELGMVEAGTTAVQIEVVG 138


>gi|152990523|ref|YP_001356245.1| hypothetical protein NIS_0776 [Nitratiruptor sp. SB155-2]
 gi|151422384|dbj|BAF69888.1| conserved hypothetical protein [Nitratiruptor sp. SB155-2]
          Length = 260

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 75/118 (63%), Gaps = 5/118 (4%)

Query: 69  KPYQIMGRWYVPRQY---TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLP 125
           +PY + G  Y P      T Y   G+ASWYG  FHG+ T+NGE Y     TAAH TLP+ 
Sbjct: 51  RPYVVNGVRYYPTVVEVGTKYR--GIASWYGPNFHGKKTSNGETYNMYDYTAAHKTLPMN 108

Query: 126 SYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           + VRVTN+ NG S VVR+NDRGP+  NR+IDLS +AAK + + + G + V +E LG  
Sbjct: 109 TMVRVTNLNNGKSTVVRINDRGPFVGNRIIDLSYSAAKKIGMVKTGTAPVELEVLGFG 166


>gi|187918591|ref|YP_001884154.1| rare lipoprotein A [Borrelia hermsii DAH]
 gi|119861439|gb|AAX17234.1| rare lipoprotein A [Borrelia hermsii DAH]
          Length = 268

 Score =  106 bits (265), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 67/94 (71%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
           A VG+ASWYG+AFHG+ TANGE +    +TAAH  LP  + VRVTN+ N  ++VVR+NDR
Sbjct: 37  ATVGLASWYGEAFHGKPTANGEKFDMTALTAAHKELPFNTVVRVTNLLNNRTVVVRINDR 96

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           GP+  +R+IDLS +AA+ L     GV+ V +E L
Sbjct: 97  GPFRKDRIIDLSKSAAEKLDFLGIGVAPVKIEVL 130


>gi|220935871|ref|YP_002514770.1| rare lipoprotein A [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997181|gb|ACL73783.1| rare lipoprotein A [Thioalkalivibrio sp. HL-EbGR7]
          Length = 285

 Score =  106 bits (265), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 79/126 (62%), Gaps = 3/126 (2%)

Query: 58  VPRGGGRYFLGKP--YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEY 114
           VPR   R   G P  Y++ G  Y V      Y   G+ASWYG  FHGR T++GE Y    
Sbjct: 61  VPRVEPRSRYGNPATYEVFGVTYRVMDSADGYVERGVASWYGTKFHGRRTSSGEPYDMFA 120

Query: 115 ITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSK 174
           +TAAH  LPLP+YV+VTN+EN  S+VVRVNDRGP+   R+IDLS AAA  L + E+G + 
Sbjct: 121 MTAAHTRLPLPTYVQVTNLENRRSVVVRVNDRGPFARGRIIDLSYAAAYRLGMLEQGTAL 180

Query: 175 VHVEYL 180
           V V  +
Sbjct: 181 VEVRAI 186


>gi|189183671|ref|YP_001937456.1| rare lipoprotein A precursor [Orientia tsutsugamushi str. Ikeda]
 gi|189180442|dbj|BAG40222.1| rare lipoprotein A precursor [Orientia tsutsugamushi str. Ikeda]
          Length = 221

 Score =  106 bits (265), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 76/119 (63%), Gaps = 1/119 (0%)

Query: 63  GRYFLGKPYQIMGRWYVPRQY-TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPT 121
           G Y +GKPY+I G+ Y P+Q    +  VG ASWY        TAN + +   ++TAAH  
Sbjct: 48  GHYKIGKPYKINGKVYSPKQVANNFQQVGYASWYSCKNSNSKTANSDTFNPSHLTAAHHI 107

Query: 122 LPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           LP+PS ++VTN++N  +L++ VNDRGP+   R++D+S   A++L    +GV+KV +E +
Sbjct: 108 LPMPSIIKVTNLQNTRTLILMVNDRGPFAKRRVLDISRRGAELLGFIRQGVTKVKIELM 166


>gi|51598987|ref|YP_073175.1| rare lipoprotein A [Borrelia garinii PBi]
 gi|51573558|gb|AAU07583.1| rare lipoprotein A [Borrelia garinii PBi]
          Length = 262

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 67/94 (71%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
           A VG+ASWYG+AFHG++TANGE +    +TAAH  LP  + VRVTN+ N  S+VVR+NDR
Sbjct: 31  ATVGLASWYGEAFHGKITANGEKFDMMALTAAHKELPFNTAVRVTNLLNNRSVVVRINDR 90

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           GP+  +R+IDLS  AA+ L     GV+ V +E +
Sbjct: 91  GPFRKDRIIDLSKHAAEKLDFLGIGVAPVKIEVI 124


>gi|238025886|ref|YP_002910117.1| lipoprotein A family protein [Burkholderia glumae BGR1]
 gi|237875080|gb|ACR27413.1| Lipoprotein A family protein [Burkholderia glumae BGR1]
          Length = 209

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 48/89 (53%), Positives = 65/89 (73%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWYG+AFHGR TANG+ +    +TAAH TLPL SYV+V N  NG S+VV++NDRGP
Sbjct: 98  TGRASWYGRAFHGRRTANGDRFDMNELTAAHRTLPLSSYVKVINQANGKSVVVKINDRGP 157

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           +   R++DLS AAAK++ +   G ++V +
Sbjct: 158 FKRGRVLDLSYAAAKVIGLVRSGTARVKI 186


>gi|219684192|ref|ZP_03539136.1| rare lipoprotein A [Borrelia garinii PBr]
 gi|219672181|gb|EED29234.1| rare lipoprotein A [Borrelia garinii PBr]
          Length = 262

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 67/94 (71%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
           A VG+ASWYG+AFHG++TANGE +    +TAAH  LP  + VRVTN+ N  S+VVR+NDR
Sbjct: 31  ATVGLASWYGEAFHGKITANGEKFDMMALTAAHKELPFNTAVRVTNLLNNRSVVVRINDR 90

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           GP+  +R+IDLS  AA+ L     GV+ V +E +
Sbjct: 91  GPFRKDRIIDLSKHAAEKLDFLGIGVAPVKIEVI 124


>gi|212212577|ref|YP_002303513.1| rare lipoprotein A [Coxiella burnetii CbuG_Q212]
 gi|212010987|gb|ACJ18368.1| rare lipoprotein A [Coxiella burnetii CbuG_Q212]
          Length = 265

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 77/123 (62%), Gaps = 3/123 (2%)

Query: 59  PRGGGRYFLGKP--YQIMG-RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYI 115
           PR   R   G P  Y + G R++V +    Y   G+ASWYG  FHG+LT+  E Y    +
Sbjct: 44  PRPLPRSKYGNPSSYTVNGKRYHVLKTARGYQRRGIASWYGTKFHGQLTSTREPYNMLAM 103

Query: 116 TAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKV 175
           T A P LP+P +VRVTN+ NG S+VV++NDRGP+  NR++DLS AAAK L    RG + V
Sbjct: 104 TGASPVLPIPCFVRVTNLSNGRSVVVKINDRGPFAPNRILDLSYAAAKKLGYVNRGTALV 163

Query: 176 HVE 178
            V+
Sbjct: 164 EVK 166


>gi|170743032|ref|YP_001771687.1| rare lipoprotein A [Methylobacterium sp. 4-46]
 gi|168197306|gb|ACA19253.1| rare lipoprotein A [Methylobacterium sp. 4-46]
          Length = 121

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 65/96 (67%), Gaps = 2/96 (2%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
           A A  G ASWYG  F GR TANGE + T  +TAAH +LP  S VRVTN  NG S+VVR+N
Sbjct: 28  ALAQTGGASWYGPGFQGRRTANGERFNTHALTAAHRSLPFGSRVRVTNTSNGRSVVVRIN 87

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGPY   R+IDLS A+A+ + +   GVSKV +  L
Sbjct: 88  DRGPYVGGRVIDLSQASARAIGIS--GVSKVQLSRL 121


>gi|167856208|ref|ZP_02478944.1| possible rare lipoprotein A [Haemophilus parasuis 29755]
 gi|167852663|gb|EDS23941.1| possible rare lipoprotein A [Haemophilus parasuis 29755]
          Length = 330

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 72/113 (63%), Gaps = 4/113 (3%)

Query: 68  GKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           G  + +MG+    RQY+    VG AS+Y   FHGR TA+GE++     TAAH TL L SY
Sbjct: 101 GTTHTVMGKE-ASRQYSE---VGTASYYADKFHGRRTASGEIFDKNGYTAAHKTLALGSY 156

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
             +TN+ NG  ++VR+NDRGP+   R+IDLS  AAK++ +   G +KV VE +
Sbjct: 157 ALITNLRNGKKVIVRINDRGPFSKTRIIDLSKGAAKVIGMVGAGTAKVRVEAM 209


>gi|317484728|ref|ZP_07943629.1| rare lipoprotein A [Bilophila wadsworthia 3_1_6]
 gi|316924084|gb|EFV45269.1| rare lipoprotein A [Bilophila wadsworthia 3_1_6]
          Length = 240

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 73/109 (66%), Gaps = 1/109 (0%)

Query: 71  YQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + G+ Y P      Y   G+ASWYG+ FHG+ TANGE Y    +TAAH  LPL + VR
Sbjct: 45  YTVRGKTYRPYLSADGYREDGVASWYGRDFHGKTTANGERYNMYAMTAAHKLLPLGTKVR 104

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           VT++ NG S+VVRVNDRGP+  +R+IDLS A+AK L +   G ++V VE
Sbjct: 105 VTHLRNGKSIVVRVNDRGPFVGDRIIDLSYASAKELGMIGTGTARVRVE 153


>gi|262362604|gb|ACY59325.1| rare lipoprotein A precursor [Yersinia pestis D106004]
          Length = 179

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 53/118 (44%), Positives = 79/118 (66%), Gaps = 3/118 (2%)

Query: 67  LGKPYQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLP 125
           + + Y++ G+ Y + +    ++ +G+AS YG+   G  TA GE++    +TAAHPTLP+P
Sbjct: 54  VNQDYKVNGQSYRIIKDPQNFSQIGLASSYGEEARGNTTATGEIFDPNALTAAHPTLPIP 113

Query: 126 SYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           SYVRVTN+ NG  +VVRVNDRGPY   R+IDLS AAA  L +     +KV ++++ +A
Sbjct: 114 SYVRVTNVSNGRQIVVRVNDRGPYTPGRVIDLSRAAADRLNISNN--TKVKIDFINVA 169


>gi|300689885|ref|YP_003750880.1| rare lipoprotein A (rlpA) [Ralstonia solanacearum PSI07]
 gi|299076945|emb|CBJ49558.1| putative rare lipoprotein A (rlpA) [Ralstonia solanacearum PSI07]
          Length = 235

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 70/112 (62%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG+ FHGR TA+GE +     T AHP+LPL S+V V N+ N   +V +V DRGPY
Sbjct: 98  GLASWYGRGFHGRRTASGERFDMNAFTVAHPSLPLSSWVLVRNLSNDRVVVAKVTDRGPY 157

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVNS 201
           H  R+IDLS AAAK L    RG ++V +  L  A +  +  E  ++ V  N+
Sbjct: 158 HGKRIIDLSYAAAKRLDFVRRGSTQVEIRRLSRAEVEALRPELTQTDVASNN 209


>gi|165918600|ref|ZP_02218686.1| rare lipoprotein A family protein [Coxiella burnetii RSA 334]
 gi|165917728|gb|EDR36332.1| rare lipoprotein A family protein [Coxiella burnetii RSA 334]
          Length = 261

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 78/123 (63%), Gaps = 3/123 (2%)

Query: 59  PRGGGRYFLGKP--YQIMG-RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYI 115
           PR   R   G P  Y + G R++V +    Y   G+ASWYG  FHG+LT+N E Y    +
Sbjct: 40  PRPLPRSKYGNPSSYTVNGKRYHVLKTARGYQRRGIASWYGTKFHGQLTSNREPYNMLAM 99

Query: 116 TAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKV 175
           T A P LP+P +VRVTN+ NG S+VV++NDRGP+  +R++DLS AAAK L    RG + V
Sbjct: 100 TGASPVLPIPCFVRVTNLSNGRSVVVKINDRGPFAPHRILDLSYAAAKKLGYVNRGTALV 159

Query: 176 HVE 178
            V+
Sbjct: 160 EVK 162


>gi|145636766|ref|ZP_01792432.1| lipoprotein [Haemophilus influenzae PittHH]
 gi|145270064|gb|EDK10001.1| lipoprotein [Haemophilus influenzae PittHH]
          Length = 287

 Score =  106 bits (264), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 76/116 (65%), Gaps = 3/116 (2%)

Query: 71  YQIMGRWYVPR---QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           Y + G+ Y  +   +   Y   G+AS+Y   F+GR TA+G+VY ++  TAAH TLP+ SY
Sbjct: 50  YSVKGQTYTTKSGNEAKFYIKEGLASYYHLKFNGRKTASGDVYNSKQFTAAHKTLPINSY 109

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
             VTN+ N   ++VR+NDRGP+   RLIDLS+AAAK + +  RG+ +V +E L +A
Sbjct: 110 ALVTNLHNNRKVIVRINDRGPFSDKRLIDLSHAAAKEIGLISRGIGQVRIEALHVA 165


>gi|301168631|emb|CBW28221.1| RlpA-like protein [Haemophilus influenzae 10810]
          Length = 287

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 85/147 (57%), Gaps = 13/147 (8%)

Query: 41  ESMYGVTASD-RIVSGKRVPRGGGRYFLGKPYQIMGRWYVPR---QYTAYAAVGMASWYG 96
           + MYG+   +  I +    PR          Y + G+ Y  +   +   Y   G+AS+Y 
Sbjct: 28  QKMYGIRGDNLSIATQMPAPR---------TYSVKGQTYTTKSGNEAKFYIKEGLASYYH 78

Query: 97  KAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLID 156
             F GR TA+G+VY ++  TAAH TLP+ SY  VTN+ N   ++VR+NDRGP+   RLID
Sbjct: 79  LKFDGRKTASGDVYNSKQFTAAHKTLPINSYALVTNLHNNRKVIVRINDRGPFSDKRLID 138

Query: 157 LSNAAAKILRVEERGVSKVHVEYLGMA 183
           LS+AAAK + +  RG+ +V +E L +A
Sbjct: 139 LSHAAAKEIGLISRGIGQVRIEALHVA 165


>gi|172059279|ref|YP_001806931.1| rare lipoprotein A [Burkholderia ambifaria MC40-6]
 gi|171991796|gb|ACB62715.1| rare lipoprotein A [Burkholderia ambifaria MC40-6]
          Length = 203

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 81  RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLV 140
           +  + +   G ASWYG+ FHGR TANGE +    +TAAH TLPL SY++VTN   G  +V
Sbjct: 85  KDVSDFRQTGRASWYGRDFHGRRTANGERFNMNALTAAHRTLPLSSYIKVTNASTGKWVV 144

Query: 141 VRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           V+VNDRGPY   R++DLS AAA+++ +   G  +V +E L
Sbjct: 145 VKVNDRGPYKRGRVLDLSYAAARMIGLVHSGTGRVKIEGL 184


>gi|224534540|ref|ZP_03675116.1| rare lipoprotein A [Borrelia spielmanii A14S]
 gi|224514217|gb|EEF84535.1| rare lipoprotein A [Borrelia spielmanii A14S]
          Length = 270

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 66/94 (70%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
           A VG+ASWYG+AFHG+ TANGE +    +TAAH  LP  + VRVTN+ N  S+VVR+NDR
Sbjct: 39  ATVGLASWYGEAFHGKTTANGEKFDMMALTAAHKELPFNTAVRVTNLLNNRSVVVRINDR 98

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           GP+  +R+IDLS  AA+ L     GV+ V +E +
Sbjct: 99  GPFRKDRIIDLSKHAAEKLDFLGIGVAPVKIEVI 132


>gi|119358461|ref|YP_913105.1| rare lipoprotein A [Chlorobium phaeobacteroides DSM 266]
 gi|119355810|gb|ABL66681.1| rare lipoprotein A [Chlorobium phaeobacteroides DSM 266]
          Length = 169

 Score =  105 bits (263), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 76/118 (64%), Gaps = 7/118 (5%)

Query: 70  PYQIMGRWYVPRQY---TAYAAVGMASWYGKA----FHGRLTANGEVYGTEYITAAHPTL 122
           PY I G+ Y+P  Y   TAY   G+ASWYG+      +G+ TA GE +  +  +AAH  L
Sbjct: 49  PYVINGKLYIPMSYEQATAYEETGIASWYGQETLLQHNGQATAYGEPFYPDKPSAAHKYL 108

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           PLPS VRVTN++   S+ VRVNDRGP+  NR+IDLS  AAK L   E+G ++V +E +
Sbjct: 109 PLPSIVRVTNLDTSASIEVRVNDRGPFVDNRVIDLSAEAAKQLGFYEKGTARVKLEVI 166


>gi|300866127|ref|ZP_07110851.1| Rare lipoprotein A-like double-psi beta-barrel [Oscillatoria sp.
           PCC 6506]
 gi|300335873|emb|CBN56009.1| Rare lipoprotein A-like double-psi beta-barrel [Oscillatoria sp.
           PCC 6506]
          Length = 357

 Score =  105 bits (263), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 66/92 (71%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWYG  FHG L+A+GE Y  + +TAAH  LP  + V VTN++NG S+VVR+NDRGP
Sbjct: 256 TGWASWYGPGFHGNLSASGETYNQDELTAAHRDLPFGTRVLVTNLDNGRSVVVRINDRGP 315

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           Y  +RLIDLS AAA++L +   G++ V +E +
Sbjct: 316 YVGDRLIDLSAAAAQVLGMVNSGIAPVQLELI 347


>gi|154149193|ref|YP_001405904.1| rare lipoprotein A rlpa [Campylobacter hominis ATCC BAA-381]
 gi|153805202|gb|ABS52209.1| rAre lipoprotein A rlpa [Campylobacter hominis ATCC BAA-381]
          Length = 240

 Score =  105 bits (263), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 54/116 (46%), Positives = 74/116 (63%), Gaps = 1/116 (0%)

Query: 69  KPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY + G+ Y P + +      G ASWYG  FHG+ T+NGE Y    +TAAH T P+ + 
Sbjct: 36  RPYTVNGKTYYPEKVSVGDTQRGTASWYGPNFHGKNTSNGEQYNMYAMTAAHKTYPMNTM 95

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VRVTN+  G S VVR+NDRGP+ + R+IDLS  AA+ L V  RG + V +E +G +
Sbjct: 96  VRVTNLNTGDSDVVRINDRGPFVNGRIIDLSKKAAQRLGVFARGTAPVKLEVVGFS 151


>gi|171320218|ref|ZP_02909277.1| rare lipoprotein A [Burkholderia ambifaria MEX-5]
 gi|171094539|gb|EDT39594.1| rare lipoprotein A [Burkholderia ambifaria MEX-5]
          Length = 203

 Score =  105 bits (263), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 81  RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLV 140
           +  + +   G ASWYG+ FHGR TANGE +    +TAAH TLPL SY++VTN   G  +V
Sbjct: 85  KDVSDFRQTGRASWYGRDFHGRRTANGERFNMNALTAAHRTLPLSSYIKVTNSSTGKWVV 144

Query: 141 VRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           V+VNDRGPY   R++DLS AAA+++ +   G  +V +E L
Sbjct: 145 VKVNDRGPYKRGRVLDLSYAAARMIGLVHSGTGRVKIEGL 184


>gi|254458056|ref|ZP_05071483.1| rare lipoprotein A [Campylobacterales bacterium GD 1]
 gi|207085449|gb|EDZ62734.1| rare lipoprotein A [Campylobacterales bacterium GD 1]
          Length = 214

 Score =  105 bits (263), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 54/115 (46%), Positives = 72/115 (62%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY I G  Y P          G ASWYG  FHG+ T+NGE+Y    +TAAH TLP+ + 
Sbjct: 2   RPYVIRGIKYYPTVVGVGDEFDGRASWYGPDFHGKHTSNGEIYNMYDMTAAHKTLPMNTI 61

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           V+VTN +NG+S VVR+NDRGP+   R+IDLS +AA  + +   G + V +E LG 
Sbjct: 62  VKVTNHDNGMSTVVRINDRGPFVDTRIIDLSKSAASKINMIATGTAPVSIEILGF 116


>gi|194333064|ref|YP_002014924.1| rare lipoprotein A [Prosthecochloris aestuarii DSM 271]
 gi|194310882|gb|ACF45277.1| rare lipoprotein A [Prosthecochloris aestuarii DSM 271]
          Length = 163

 Score =  105 bits (263), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 64/89 (71%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+Y   FHGRLTANGE +    +TAAH +LP  S VRVTN+ NG  +VVR+NDRGPY
Sbjct: 62  GKASYYADRFHGRLTANGERFNMHEMTAAHKSLPFGSMVRVTNLTNGKKVVVRINDRGPY 121

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVE 178
              R+IDLS  AAK + + ++GVSKV +E
Sbjct: 122 IKGRIIDLSKGAAKEIGLIKKGVSKVKLE 150


>gi|167587813|ref|ZP_02380201.1| Rare lipoprotein A [Burkholderia ubonensis Bu]
          Length = 198

 Score =  105 bits (263), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 63/92 (68%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWYG+ FHGR TANGE +     TAAH TLPL SY++VTN   G  +VV+VNDRGP
Sbjct: 88  TGRASWYGRGFHGRRTANGERFNMNAFTAAHRTLPLSSYIKVTNASTGKWVVVKVNDRGP 147

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +   R++DLS AAAK++ +   G  +V +E L
Sbjct: 148 FKRGRVLDLSYAAAKLIGLVHAGTGRVKIEGL 179


>gi|189501379|ref|YP_001960849.1| rare lipoprotein A [Chlorobium phaeobacteroides BS1]
 gi|189496820|gb|ACE05368.1| rare lipoprotein A [Chlorobium phaeobacteroides BS1]
          Length = 195

 Score =  105 bits (263), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 74/116 (63%), Gaps = 7/116 (6%)

Query: 70  PYQIMGRWYVP---RQYTAYAAVGMASWYGKAFH----GRLTANGEVYGTEYITAAHPTL 122
           PY + G+ YVP    +   Y   G+ASWYG+       G +TANGE +  +  +AAH  L
Sbjct: 70  PYVVFGKTYVPMSVDESQNYRETGLASWYGEETREKDGGHMTANGEKFDPDKFSAAHKYL 129

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           PLP +VRVTN+E   SL+VRVNDRGP+  +R+IDLS  AAK L   ++G +KV +E
Sbjct: 130 PLPIHVRVTNLETRQSLIVRVNDRGPFAHDRVIDLSAGAAKKLGFYQKGTAKVSLE 185


>gi|110597322|ref|ZP_01385610.1| rare lipoprotein A [Chlorobium ferrooxidans DSM 13031]
 gi|110341158|gb|EAT59626.1| rare lipoprotein A [Chlorobium ferrooxidans DSM 13031]
          Length = 168

 Score =  105 bits (263), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 75/116 (64%), Gaps = 7/116 (6%)

Query: 70  PYQIMGRWYVPRQY---TAYAAVGMASWYG----KAFHGRLTANGEVYGTEYITAAHPTL 122
           PY I G+ YVP  Y    +Y   G+ASWYG    +  +G+ TA GE++     +AAH  L
Sbjct: 49  PYVINGKVYVPMSYEEANSYEETGLASWYGHETLRQHNGQPTAYGEIFDPSKPSAAHKYL 108

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           PLP+ V+VTN+E   S+VVRVNDRGP+  NR+IDLS  AAK L   ++G +KV +E
Sbjct: 109 PLPALVKVTNLETNASIVVRVNDRGPFVDNRIIDLSAEAAKRLGFYDKGTAKVKIE 164


>gi|170701639|ref|ZP_02892583.1| rare lipoprotein A [Burkholderia ambifaria IOP40-10]
 gi|170133460|gb|EDT01844.1| rare lipoprotein A [Burkholderia ambifaria IOP40-10]
          Length = 203

 Score =  105 bits (262), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 81  RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLV 140
           +  + +   G ASWYG+ FHGR TANGE +    +TAAH TLPL SY++VTN   G  +V
Sbjct: 85  KDVSDFRQTGRASWYGRDFHGRRTANGERFNMNALTAAHRTLPLSSYIKVTNSSTGKWVV 144

Query: 141 VRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           V+VNDRGPY   R++DLS AAA+++ +   G  +V +E L
Sbjct: 145 VKVNDRGPYKRGRVLDLSYAAARMIGLVHSGTGRVKIEGL 184


>gi|115350256|ref|YP_772095.1| rare lipoprotein A [Burkholderia ambifaria AMMD]
 gi|115280244|gb|ABI85761.1| rare lipoprotein A [Burkholderia ambifaria AMMD]
          Length = 203

 Score =  105 bits (262), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 81  RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLV 140
           +  + +   G ASWYG+ FHGR TANGE +    +TAAH TLPL SY++VTN   G  +V
Sbjct: 85  KDVSDFRQTGRASWYGRDFHGRRTANGERFNMNALTAAHRTLPLSSYIKVTNSSTGKWVV 144

Query: 141 VRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           V+VNDRGPY   R++DLS AAA+++ +   G  +V +E L
Sbjct: 145 VKVNDRGPYKRGRVLDLSYAAARMIGLVHSGTGRVKIEGL 184


>gi|317152776|ref|YP_004120824.1| rare lipoprotein A [Desulfovibrio aespoeensis Aspo-2]
 gi|316943027|gb|ADU62078.1| rare lipoprotein A [Desulfovibrio aespoeensis Aspo-2]
          Length = 252

 Score =  105 bits (262), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 85/152 (55%), Gaps = 18/152 (11%)

Query: 15  VCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSG--KRVPRGGGRYFLGKPYQ 72
           V +V+L ++ C          L  FP  +Y    S R   G     P+         PY 
Sbjct: 9   VGLVLLAVAGC--------ASLNPFPSHIYSTPPSSRDTPGPVTHDPKT-------NPYT 53

Query: 73  IMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVT 131
           ++G+ Y P      Y  VG ASWYG+ FHG+ TANG++Y    I+AAH TLPL + VRVT
Sbjct: 54  VLGQTYYPLTSAQGYDEVGDASWYGEDFHGKKTANGQIYNMHGISAAHKTLPLGTRVRVT 113

Query: 132 NMENGISLVVRVNDRGPYHSNRLIDLSNAAAK 163
           N+ENG ++ + +NDRGP+   R+IDLS+ AA+
Sbjct: 114 NLENGRNVTLVINDRGPFVRGRIIDLSHGAAR 145


>gi|206558564|ref|YP_002229324.1| putative RlpA-like lipoprotein [Burkholderia cenocepacia J2315]
 gi|198034601|emb|CAR50467.1| putative RlpA-like lipoprotein [Burkholderia cenocepacia J2315]
          Length = 203

 Score =  105 bits (262), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 66/100 (66%)

Query: 81  RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLV 140
           +  + +   G ASWYG+ FHGR TANGE +     TAAH TLPL SY++VTN   G  +V
Sbjct: 85  KDVSDFRQTGRASWYGRDFHGRRTANGERFNMNAFTAAHRTLPLSSYIKVTNASTGKWVV 144

Query: 141 VRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           V+VNDRGP+   R++DLS AAAK++ +   G  +V +E L
Sbjct: 145 VKVNDRGPFKRGRVLDLSYAAAKVIGLVHAGTGRVKIEGL 184


>gi|78189641|ref|YP_379979.1| rare lipoprotein A [Chlorobium chlorochromatii CaD3]
 gi|78171840|gb|ABB28936.1| Rare lipoprotein A [Chlorobium chlorochromatii CaD3]
          Length = 150

 Score =  105 bits (261), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 48/89 (53%), Positives = 65/89 (73%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+Y   FHGR TANGE +    +TAAHP+LP  + V+VTNM+NG ++VVR+NDRGPY
Sbjct: 50  GTASFYSTQFHGRKTANGETFNMNQLTAAHPSLPFGTLVKVTNMDNGKNVVVRINDRGPY 109

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVE 178
              R+IDLS +AA  + + + GV++V VE
Sbjct: 110 VKGRIIDLSKSAAIKIGILKEGVAQVKVE 138


>gi|134294362|ref|YP_001118097.1| rare lipoprotein A [Burkholderia vietnamiensis G4]
 gi|134137519|gb|ABO53262.1| rare lipoprotein A [Burkholderia vietnamiensis G4]
          Length = 213

 Score =  105 bits (261), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 49/95 (51%), Positives = 65/95 (68%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           +   G ASWYG+ FHGR TANGE +    +TAAH TLPL SY++VTN   G  +VV+VND
Sbjct: 100 FRQTGRASWYGRDFHGRRTANGERFNMNALTAAHRTLPLSSYIKVTNASTGKWVVVKVND 159

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+   R++DLS AAAK++ +   G  +V +E L
Sbjct: 160 RGPFKRGRVLDLSYAAAKMIGLVHAGTGRVKIEGL 194


>gi|258406355|ref|YP_003199097.1| rare lipoprotein A [Desulfohalobium retbaense DSM 5692]
 gi|257798582|gb|ACV69519.1| rare lipoprotein A [Desulfohalobium retbaense DSM 5692]
          Length = 249

 Score =  105 bits (261), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 72/114 (63%), Gaps = 1/114 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY I G+ Y P R    Y   G+ASWYG  FHG+ TANGE Y    +TAAH TLP+ + 
Sbjct: 53  RPYTINGQTYRPLRSANGYVEQGIASWYGSDFHGKPTANGERYDMHAMTAAHRTLPMNTK 112

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           + VTN+ N     VR+NDRGP+  NR++DLS AAAK L V   G + V ++ +G
Sbjct: 113 LMVTNLRNNKQTTVRINDRGPFVKNRILDLSFAAAKRLGVVGPGTAPVRIKAVG 166


>gi|170731623|ref|YP_001763570.1| rare lipoprotein A [Burkholderia cenocepacia MC0-3]
 gi|169814865|gb|ACA89448.1| rare lipoprotein A [Burkholderia cenocepacia MC0-3]
          Length = 203

 Score =  105 bits (261), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 49/91 (53%), Positives = 63/91 (69%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG+ FHGR TANGE +     TAAH TLPL SY++VTN   G  +VV+VNDRGP+
Sbjct: 94  GRASWYGRDFHGRRTANGERFNMNAFTAAHRTLPLSSYIKVTNASTGKWVVVKVNDRGPF 153

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R++DLS AAAK++ +   G  +V +E L
Sbjct: 154 KRGRVLDLSYAAAKVIGLVHAGTGRVKIEGL 184


>gi|225551723|ref|ZP_03772666.1| rare lipoprotein A [Borrelia sp. SV1]
 gi|225371518|gb|EEH00945.1| rare lipoprotein A [Borrelia sp. SV1]
          Length = 262

 Score =  105 bits (261), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 66/94 (70%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
           A VG+ASWYG+AFHG+ TANGE +    +TAAH  LP  + VRVTN+ N  S+VVR+NDR
Sbjct: 31  ATVGLASWYGEAFHGKTTANGEKFDMMALTAAHKELPFNTTVRVTNLLNNRSVVVRINDR 90

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           GP+  +R+IDLS  AA+ L     GV+ V +E +
Sbjct: 91  GPFRKDRIIDLSKYAAEKLDFLGIGVAPVKIEVI 124


>gi|188534482|ref|YP_001908279.1| rare lipoprotein A [Erwinia tasmaniensis Et1/99]
 gi|188029524|emb|CAO97401.1| Rare lipoprotein A [Erwinia tasmaniensis Et1/99]
          Length = 372

 Score =  105 bits (261), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 74/114 (64%), Gaps = 3/114 (2%)

Query: 71  YQIMGR-WYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + G  W + +  + ++  G+A+ YG+      TA GE++    +TAAHPTLPLPSYVR
Sbjct: 61  YTVKGTTWKIVKDPSNFSQTGLATTYGEEMGSNQTATGELFDANALTAAHPTLPLPSYVR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VTN+ NG  +VVRVNDRGPY   R+IDLS AAA   R+     ++V V+Y+ +A
Sbjct: 121 VTNLANGRMIVVRVNDRGPYTPGRIIDLSRAAAD--RLNTSNNTRVRVDYINVA 172


>gi|224531829|ref|ZP_03672461.1| rare lipoprotein A [Borrelia valaisiana VS116]
 gi|224511294|gb|EEF81700.1| rare lipoprotein A [Borrelia valaisiana VS116]
          Length = 263

 Score =  105 bits (261), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 66/94 (70%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
           A VG+ASWYG+AFHG+ TANGE +    +TAAH  LP  + VRVTN+ N  S+VVR+NDR
Sbjct: 32  ATVGLASWYGEAFHGKTTANGEKFDMMALTAAHKELPFNTAVRVTNLLNNRSVVVRINDR 91

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           GP+  +R+IDLS  AA+ L     GV+ V +E +
Sbjct: 92  GPFRKDRIIDLSKYAAEKLDFLGIGVAPVKIEVI 125


>gi|19879583|gb|AAL68890.1| rare lipoprotein A [Chlorobium limicola]
          Length = 136

 Score =  105 bits (261), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 48/91 (52%), Positives = 64/91 (70%)

Query: 88  AVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRG 147
           AVG AS+Y   FHGR TANGE +  +  TAAH +LP  + VRVTN+ NG  + V++NDRG
Sbjct: 43  AVGKASYYATRFHGRTTANGETFDMKEFTAAHRSLPFGTIVRVTNLNNGKMVFVKINDRG 102

Query: 148 PYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           P+  NR+IDLS AAAK L + + G+ +V +E
Sbjct: 103 PFKKNRIIDLSKAAAKKLDLVDNGIGRVKIE 133


>gi|256830731|ref|YP_003159459.1| rare lipoprotein A [Desulfomicrobium baculatum DSM 4028]
 gi|256579907|gb|ACU91043.1| rare lipoprotein A [Desulfomicrobium baculatum DSM 4028]
          Length = 258

 Score =  105 bits (261), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 74/113 (65%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           KPY ++G+ Y P      YA  G+ASWYG  FHG+ TANGE Y    +TAAH  LP+ + 
Sbjct: 62  KPYTVLGQTYYPLGSAEGYAETGVASWYGTDFHGKKTANGERYDMYQMTAAHRILPMHTR 121

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           + V N++NG +  VRVNDRGP+  NR+IDLS AAA +L V   G ++V ++ +
Sbjct: 122 LVVRNLDNGRTTEVRVNDRGPFVGNRIIDLSYAAASVLGVVGPGTARVSLQTI 174


>gi|103486741|ref|YP_616302.1| rare lipoprotein A [Sphingopyxis alaskensis RB2256]
 gi|98976818|gb|ABF52969.1| rare lipoprotein A [Sphingopyxis alaskensis RB2256]
          Length = 320

 Score =  105 bits (261), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 72/112 (64%), Gaps = 1/112 (0%)

Query: 66  FLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLP 125
            +G  Y++    Y P     Y  VG ASWYG    G+ TANGE++    I+AAH TLPLP
Sbjct: 49  IVGDSYKVGDVTYTPADVIDYDDVGYASWYGDEAAGKATANGEIFDPARISAAHKTLPLP 108

Query: 126 SYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           SYV VT ++ G +++VRVNDRGP  +N+LI LS AAA  L + ERG++ V V
Sbjct: 109 SYVEVTALDTGRTILVRVNDRGPMANNQLIALSPAAAMQLGL-ERGLTAVRV 159


>gi|254246789|ref|ZP_04940110.1| Rare lipoprotein A [Burkholderia cenocepacia PC184]
 gi|124871565|gb|EAY63281.1| Rare lipoprotein A [Burkholderia cenocepacia PC184]
          Length = 213

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 66/100 (66%)

Query: 81  RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLV 140
           +  + +   G ASWYG+ FHGR TANGE +     TAAH TLPL SY++VTN   G  +V
Sbjct: 95  KDVSEFRQSGRASWYGRDFHGRRTANGERFNMNAFTAAHRTLPLSSYIKVTNASTGKWVV 154

Query: 141 VRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           V+VNDRGP+   R++DLS AAAK++ +   G  +V +E L
Sbjct: 155 VKVNDRGPFKRGRVLDLSYAAAKVIGLVHAGTGRVKIEGL 194


>gi|116688310|ref|YP_833933.1| rare lipoprotein A [Burkholderia cenocepacia HI2424]
 gi|116646399|gb|ABK07040.1| rare lipoprotein A [Burkholderia cenocepacia HI2424]
          Length = 213

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 66/100 (66%)

Query: 81  RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLV 140
           +  + +   G ASWYG+ FHGR TANGE +     TAAH TLPL SY++VTN   G  +V
Sbjct: 95  KDVSEFRQSGRASWYGRDFHGRRTANGERFNMNAFTAAHRTLPLSSYIKVTNASTGKWVV 154

Query: 141 VRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           V+VNDRGP+   R++DLS AAAK++ +   G  +V +E L
Sbjct: 155 VKVNDRGPFKRGRVLDLSYAAAKVIGLVHAGTGRVKIEGL 194


>gi|309780475|ref|ZP_07675223.1| rare lipoprotein A [Ralstonia sp. 5_7_47FAA]
 gi|308920749|gb|EFP66398.1| rare lipoprotein A [Ralstonia sp. 5_7_47FAA]
          Length = 243

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 70/111 (63%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG+ FHGR TA+GE +     T AHP+LPL S+V V N+ N   +V +V DRGPY
Sbjct: 107 GLASWYGRGFHGRRTASGERFDMNAFTVAHPSLPLQSWVLVRNLSNDRVVVAKVTDRGPY 166

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVN 200
           H  R++D+S AAAK L   +RG ++V +  L  A +  +  E  ++ V  N
Sbjct: 167 HGKRIVDMSYAAAKRLDFVKRGSTQVEIRRLSRAEVEALRPELTQTDVASN 217


>gi|237750167|ref|ZP_04580647.1| predicted protein [Helicobacter bilis ATCC 43879]
 gi|229374354|gb|EEO24745.1| predicted protein [Helicobacter bilis ATCC 43879]
          Length = 607

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 70/115 (60%), Gaps = 1/115 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY + G+ Y P          G+ASWYG  FH + T+NGE Y     TAAH T P+ + 
Sbjct: 140 RPYTVRGKTYRPHPVKVGDTFDGIASWYGPDFHAKATSNGETYNMHAHTAAHKTFPMNTI 199

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           V+V N +NG + VVR+NDRGP+   R+IDLSN AA  + +  +G++ V VE +G 
Sbjct: 200 VKVYNKDNGKTTVVRINDRGPFVEGRIIDLSNVAAHDIAMVGKGIANVRVEVVGF 254


>gi|33152984|ref|NP_874337.1| rare lipoprotein A [Haemophilus ducreyi 35000HP]
 gi|33149209|gb|AAP96726.1| possible rare lipoprotein A [Haemophilus ducreyi 35000HP]
          Length = 184

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 48/91 (52%), Positives = 68/91 (74%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+AS+YG  F+GRLTANGE++    +TAAH TLP  + + VTN+ NG S++VRVNDRGPY
Sbjct: 79  GIASYYGDQFNGRLTANGELFSNNEMTAAHKTLPFGTLLEVTNVRNGRSVIVRVNDRGPY 138

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           + +R++DLS AAA  L ++  G++KV +  L
Sbjct: 139 YGSRIVDLSKAAAIELGMKRAGLAKVKLAVL 169


>gi|110597248|ref|ZP_01385536.1| rare lipoprotein A [Chlorobium ferrooxidans DSM 13031]
 gi|110341084|gb|EAT59552.1| rare lipoprotein A [Chlorobium ferrooxidans DSM 13031]
          Length = 167

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 64/92 (69%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+Y   FHGR TANGE +    +TAAHP+LP  ++VRVTNM  G  +VVR+NDRGP+
Sbjct: 67  GKASFYANQFHGRTTANGETFNMNKLTAAHPSLPFGTWVRVTNMRTGKDVVVRINDRGPF 126

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
              R+IDLS  AAK L + + G ++V +E +G
Sbjct: 127 VKGRIIDLSIGAAKELGILKTGTAQVKLETIG 158


>gi|241664716|ref|YP_002983076.1| rare lipoprotein A [Ralstonia pickettii 12D]
 gi|240866743|gb|ACS64404.1| rare lipoprotein A [Ralstonia pickettii 12D]
          Length = 250

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 70/111 (63%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG+ FHGR TA+GE +     T AHP+LPL S+V V N+ N   +V +V DRGPY
Sbjct: 114 GLASWYGRGFHGRRTASGERFDMNAFTVAHPSLPLQSWVLVRNLSNDRVVVAKVTDRGPY 173

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVN 200
           H  R++D+S AAAK L   +RG ++V +  L  A +  +  E  ++ V  N
Sbjct: 174 HGKRIVDMSYAAAKRLDFVKRGSTQVEIRRLSRAEVEALRPELTQTDVASN 224


>gi|315453177|ref|YP_004073447.1| rare lipoprotein A, RlpA [Helicobacter felis ATCC 49179]
 gi|315132229|emb|CBY82857.1| rare lipoprotein A, RlpA [Helicobacter felis ATCC 49179]
          Length = 341

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 55/138 (39%), Positives = 84/138 (60%), Gaps = 3/138 (2%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY++  + Y P +        G ASWYG  FH + T+NGE Y     TAA+ TLP+ + 
Sbjct: 116 RPYRVGSKMYYPTKVDIGQTFDGYASWYGPNFHAKRTSNGETYNMYAHTAANKTLPMNTI 175

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
           V+VTN +N  S +VR+NDRGP+ +NR+IDLSNAAA  + +  +GV+ V +E +G   +  
Sbjct: 176 VKVTNKDNNKSTIVRINDRGPFVANRIIDLSNAAAHDIDMVGKGVAPVKLEVIGFGGV-- 233

Query: 188 MDQEYLRSTVMVNSATVL 205
           + ++Y ++      AT L
Sbjct: 234 ISKQYQKTLEKAPQATTL 251


>gi|219871408|ref|YP_002475783.1| rare lipoprotein A [Haemophilus parasuis SH0165]
 gi|219691612|gb|ACL32835.1| rare lipoprotein A [Haemophilus parasuis SH0165]
          Length = 330

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 71/113 (62%), Gaps = 4/113 (3%)

Query: 68  GKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           G  + +MG+    RQY+    VG AS+Y   FHGR TA+GE++     TAAH TL L SY
Sbjct: 101 GTTHTVMGKE-ASRQYSE---VGTASYYADKFHGRRTASGEIFDKNGYTAAHKTLALGSY 156

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
             +TN+ NG  ++VR+NDRGP+   R+IDLS  AAK + +   G +KV VE +
Sbjct: 157 ALITNLRNGKKVIVRINDRGPFSKTRIIDLSKGAAKAIGMVGAGTAKVRVEAM 209


>gi|218249747|ref|YP_002375234.1| rare lipoprotein A [Borrelia burgdorferi ZS7]
 gi|221217998|ref|ZP_03589465.1| rare lipoprotein A [Borrelia burgdorferi 72a]
 gi|226321433|ref|ZP_03796960.1| rare lipoprotein A [Borrelia burgdorferi Bol26]
 gi|218164935|gb|ACK74996.1| rare lipoprotein A [Borrelia burgdorferi ZS7]
 gi|221192304|gb|EEE18524.1| rare lipoprotein A [Borrelia burgdorferi 72a]
 gi|226233229|gb|EEH31981.1| rare lipoprotein A [Borrelia burgdorferi Bol26]
          Length = 262

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 66/94 (70%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
           A VG+ASWYG+AFHG+ TANGE +    +TAAH  LP  + V+VTN+ N  S+VVR+NDR
Sbjct: 31  ATVGLASWYGEAFHGKTTANGEKFDMMALTAAHKELPFNTTVKVTNLLNNRSVVVRINDR 90

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           GP+  +R+IDLS  AA+ L     GV+ V +E +
Sbjct: 91  GPFRKDRIIDLSKHAAEKLDFLGIGVAPVKIEVI 124


>gi|332188476|ref|ZP_08390198.1| rare lipoA family protein [Sphingomonas sp. S17]
 gi|332011488|gb|EGI53571.1| rare lipoA family protein [Sphingomonas sp. S17]
          Length = 190

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 60/129 (46%), Positives = 81/129 (62%), Gaps = 5/129 (3%)

Query: 67  LGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
           +GKPY + G  YVP + T Y  +G ASWYG    G+ TANGE +   + TAAH TLPLPS
Sbjct: 35  IGKPYTVRGVTYVPAEDTTYDMLGYASWYGNE-SGKRTANGERFRPGWATAAHTTLPLPS 93

Query: 127 YVRVTNMENGISLVVRVNDRGPYH-SNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALL 185
           YV VT ++ G  ++VR+NDRGP+  S+R+IDLS  AA+ L +   G + V V  +     
Sbjct: 94  YVEVTALDTGRRIIVRINDRGPFAGSSRIIDLSRGAAEQLGLRAVGKAAVRVRRV---EP 150

Query: 186 NGMDQEYLR 194
           +  D+E LR
Sbjct: 151 DEKDRERLR 159


>gi|94497484|ref|ZP_01304054.1| putative rare lipoprotein A [Sphingomonas sp. SKA58]
 gi|94423115|gb|EAT08146.1| putative rare lipoprotein A [Sphingomonas sp. SKA58]
          Length = 156

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 75/115 (65%), Gaps = 2/115 (1%)

Query: 67  LGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
           +G PY++ G  YVP     Y  +G ASWYG +  G  TANGE +  ++ITAAH TLPLPS
Sbjct: 3   IGPPYKVRGVTYVPAADPQYDMLGYASWYG-SESGNRTANGERFRAKWITAAHVTLPLPS 61

Query: 127 YVRVTNMENGISLVVRVNDRGPYHS-NRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           YV VT+++ G ++VVRVNDRGP+    R+IDLS  AA  L +  RG + V V  +
Sbjct: 62  YVEVTSLDTGRTIVVRVNDRGPFAGRGRIIDLSRRAADELGIRARGHAAVRVRLV 116


>gi|15595080|ref|NP_212869.1| rare lipoprotein A (rlpA) [Borrelia burgdorferi B31]
 gi|2688668|gb|AAC67080.1| rare lipoprotein A (rlpA) [Borrelia burgdorferi B31]
          Length = 275

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 66/94 (70%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
           A VG+ASWYG+AFHG+ TANGE +    +TAAH  LP  + V+VTN+ N  S+VVR+NDR
Sbjct: 44  ATVGLASWYGEAFHGKTTANGEKFDMMALTAAHKELPFNTTVKVTNLLNNRSVVVRINDR 103

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           GP+  +R+IDLS  AA+ L     GV+ V +E +
Sbjct: 104 GPFRKDRIIDLSKYAAEKLDFLGIGVAPVKIEVI 137


>gi|111115565|ref|YP_710183.1| rare lipoprotein A [Borrelia afzelii PKo]
 gi|110890839|gb|ABH02007.1| rare lipoprotein A [Borrelia afzelii PKo]
          Length = 270

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 67/98 (68%)

Query: 83  YTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVR 142
           + +   VG+ASWYG+AFHG+ TANGE +    +TAAH  LP  + VRVTN+ N  S+VVR
Sbjct: 35  HVSSTTVGLASWYGEAFHGKTTANGEKFDMMALTAAHKELPFNTAVRVTNLLNNRSVVVR 94

Query: 143 VNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +NDRGP+  +R+IDLS  AA+ L     GV+ V +E +
Sbjct: 95  INDRGPFRKDRIIDLSKHAAEKLDFLGIGVAPVKIEVI 132


>gi|78189893|ref|YP_380231.1| rare lipoprotein A [Chlorobium chlorochromatii CaD3]
 gi|78172092|gb|ABB29188.1| Rare lipoprotein A [Chlorobium chlorochromatii CaD3]
          Length = 163

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/119 (49%), Positives = 78/119 (65%), Gaps = 7/119 (5%)

Query: 70  PYQIMGRWYVPRQYT---AYAAVGMASWYGKAF----HGRLTANGEVYGTEYITAAHPTL 122
           PY I G  Y+P +Y    AY   G+ASWYGK      + +LTA GEV+     +AAH  L
Sbjct: 44  PYVINGTTYLPLRYEEALAYEENGLASWYGKETLIQNNYQLTAYGEVFDPSKPSAAHKYL 103

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           PLP+ VRVTN++N  S+VVRVNDRGP+  +R+IDLS  AAK L   E+G+++V +E L 
Sbjct: 104 PLPALVRVTNLDNNNSIVVRVNDRGPFIGDRVIDLSAEAAKRLGFYEKGMARVKIEVLN 162


>gi|195941553|ref|ZP_03086935.1| rare lipoprotein A (rlpA) [Borrelia burgdorferi 80a]
 gi|225548976|ref|ZP_03769953.1| rare lipoprotein A [Borrelia burgdorferi 94a]
 gi|225370579|gb|EEH00016.1| rare lipoprotein A [Borrelia burgdorferi 94a]
 gi|312147922|gb|ADQ30581.1| rare lipoprotein A [Borrelia burgdorferi JD1]
          Length = 262

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 66/94 (70%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
           A VG+ASWYG+AFHG+ TANGE +    +TAAH  LP  + V+VTN+ N  S+VVR+NDR
Sbjct: 31  ATVGLASWYGEAFHGKTTANGEKFDMMALTAAHKELPFNTTVKVTNLLNNRSVVVRINDR 90

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           GP+  +R+IDLS  AA+ L     GV+ V +E +
Sbjct: 91  GPFRKDRIIDLSKYAAEKLDFLGIGVAPVKIEVI 124


>gi|16331599|ref|NP_442327.1| rare lipoprotein A [Synechocystis sp. PCC 6803]
 gi|20139442|sp|Q55752|RLPA_SYNY3 RecName: Full=RlpA-like protein
 gi|1001663|dbj|BAA10397.1| rare lipoprotein A [Synechocystis sp. PCC 6803]
          Length = 321

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/91 (51%), Positives = 63/91 (69%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG  FHGR TANGE +    +TAAH TLP  + V+VTN+ NG S+VVR+NDRGP+
Sbjct: 230 GIASWYGPGFHGRRTANGERFNQNALTAAHRTLPFGTRVKVTNLRNGQSVVVRINDRGPF 289

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R+IDLS  AA+ + +   GV  V ++ +
Sbjct: 290 TGGRVIDLSAGAARAIGIHSSGVGNVALDIV 320


>gi|223889445|ref|ZP_03624031.1| rare lipoprotein A [Borrelia burgdorferi 64b]
 gi|223885131|gb|EEF56235.1| rare lipoprotein A [Borrelia burgdorferi 64b]
          Length = 262

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 66/94 (70%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
           A VG+ASWYG+AFHG+ TANGE +    +TAAH  LP  + V+VTN+ N  S+VVR+NDR
Sbjct: 31  ATVGLASWYGEAFHGKTTANGEKFDMMALTAAHKELPFNTTVKVTNLLNNRSVVVRINDR 90

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           GP+  +R+IDLS  AA+ L     GV+ V +E +
Sbjct: 91  GPFRKDRIIDLSKYAAEKLDFLGIGVAPVKIEVI 124


>gi|212218446|ref|YP_002305233.1| rare lipoprotein A [Coxiella burnetii CbuK_Q154]
 gi|212012708|gb|ACJ20088.1| rare lipoprotein A [Coxiella burnetii CbuK_Q154]
          Length = 265

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 77/123 (62%), Gaps = 3/123 (2%)

Query: 59  PRGGGRYFLGKP--YQIMG-RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYI 115
           PR   R   G P  Y + G R++V +    Y   G+ASWYG  FHG+LT+  E Y    +
Sbjct: 44  PRPLPRSKYGNPSSYTVNGKRYHVLKTARGYQRRGIASWYGTKFHGQLTSTREPYNMLAM 103

Query: 116 TAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKV 175
           T A P LP+P +VRVTN+ NG S+VV++NDRGP+  +R++DLS AAAK L    RG + V
Sbjct: 104 TGASPVLPIPCFVRVTNLSNGRSVVVKINDRGPFAPHRILDLSYAAAKKLGYVNRGTALV 163

Query: 176 HVE 178
            V+
Sbjct: 164 EVK 166


>gi|209363954|ref|YP_001424431.2| rare lipoprotein A [Coxiella burnetii Dugway 5J108-111]
 gi|215919080|ref|NP_819994.2| rare lipoprotein A [Coxiella burnetii RSA 493]
 gi|206583965|gb|AAO90508.2| rare lipoprotein A [Coxiella burnetii RSA 493]
 gi|207081887|gb|ABS77181.2| rare lipoprotein A [Coxiella burnetii Dugway 5J108-111]
          Length = 265

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 77/123 (62%), Gaps = 3/123 (2%)

Query: 59  PRGGGRYFLGKP--YQIMG-RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYI 115
           PR   R   G P  Y + G R++V +    Y   G+ASWYG  FHG+LT+  E Y    +
Sbjct: 44  PRPLPRSKYGNPSSYTVNGKRYHVLKTARGYQRRGIASWYGTKFHGQLTSTREPYNMLAM 103

Query: 116 TAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKV 175
           T A P LP+P +VRVTN+ NG S+VV++NDRGP+  +R++DLS AAAK L    RG + V
Sbjct: 104 TGASPVLPIPCFVRVTNLSNGRSVVVKINDRGPFAPHRILDLSYAAAKKLGYVNRGTALV 163

Query: 176 HVE 178
            V+
Sbjct: 164 EVK 166


>gi|216264236|ref|ZP_03436228.1| rare lipoprotein A [Borrelia burgdorferi 156a]
 gi|215980709|gb|EEC21516.1| rare lipoprotein A [Borrelia burgdorferi 156a]
          Length = 262

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 66/94 (70%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
           A VG+ASWYG+AFHG+ TANGE +    +TAAH  LP  + V+VTN+ N  S+VVR+NDR
Sbjct: 31  ATVGLASWYGEAFHGKTTANGEKFDMMALTAAHKELPFNTTVKVTNLLNNRSVVVRINDR 90

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           GP+  +R+IDLS  AA+ L     GV+ V +E +
Sbjct: 91  GPFRKDRIIDLSKYAAEKLDFLGIGVAPVKIEVI 124


>gi|224532586|ref|ZP_03673208.1| rare lipoprotein A [Borrelia burgdorferi WI91-23]
 gi|225550055|ref|ZP_03771016.1| rare lipoprotein A [Borrelia burgdorferi 118a]
 gi|224512442|gb|EEF82821.1| rare lipoprotein A [Borrelia burgdorferi WI91-23]
 gi|225369514|gb|EEG98966.1| rare lipoprotein A [Borrelia burgdorferi 118a]
          Length = 262

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 66/94 (70%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
           A VG+ASWYG+AFHG+ TANGE +    +TAAH  LP  + V+VTN+ N  S++VR+NDR
Sbjct: 31  ATVGLASWYGEAFHGKTTANGEKFDMMALTAAHKELPFNTTVKVTNLLNNRSVIVRINDR 90

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           GP+  +R+IDLS  AA+ L     GV+ V +E +
Sbjct: 91  GPFRKDRIIDLSKHAAEKLDFLGIGVAPVKIEVI 124


>gi|238920818|ref|YP_002934333.1| rare lipoprotein A [Edwardsiella ictaluri 93-146]
 gi|238870387|gb|ACR70098.1| rare lipoprotein A [Edwardsiella ictaluri 93-146]
          Length = 370

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 77/108 (71%), Gaps = 2/108 (1%)

Query: 76  RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMEN 135
           R+ + +  + ++ +G+A+ YG+   G +TA+GE +  E ++AAHPTLP+PSYVRVTN+ N
Sbjct: 66  RYTIVKDPSNFSQIGLAASYGEENRGNVTASGEQFNPEAMSAAHPTLPIPSYVRVTNLAN 125

Query: 136 GISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           G  +VVR+NDRGPY   R+I LS+AAA  L + +   +KV V+++ +A
Sbjct: 126 GRRIVVRINDRGPYTPGRIIALSSAAANRLNITQH--TKVRVDFISVA 171


>gi|87300952|ref|ZP_01083794.1| possible rare lipoprotein A [Synechococcus sp. WH 5701]
 gi|87284823|gb|EAQ76775.1| possible rare lipoprotein A [Synechococcus sp. WH 5701]
          Length = 185

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 66/94 (70%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
           A  G ASWYG  F G  TANGEV+    +TAAH TLP  + V+VTN+ NG S +VR+NDR
Sbjct: 91  AGTGEASWYGPGFFGNRTANGEVFRPGTMTAAHRTLPFGTKVKVTNLRNGRSAIVRINDR 150

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           GP+H NR+IDL++ AA+ L +   GV++V +E +
Sbjct: 151 GPFHGNRIIDLAHGAAQNLGLVASGVAQVRLEVV 184


>gi|298530304|ref|ZP_07017706.1| rare lipoprotein A [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509678|gb|EFI33582.1| rare lipoprotein A [Desulfonatronospira thiodismutans ASO3-1]
          Length = 256

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 77/117 (65%), Gaps = 1/117 (0%)

Query: 68  GKPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
            + Y ++G+ Y+P   +  +   G+ASWYG  FHG+ TA+GEVY    I++AH  LP+ +
Sbjct: 58  ARKYTVLGQTYIPLSSSEGFEEEGIASWYGPKFHGKKTASGEVYNMYEISSAHRILPMHT 117

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
            V VTN+EN  S+ +R+NDRGP+  +R+IDLS AAAK L +   G + V V+ +G A
Sbjct: 118 KVEVTNLENDKSIRLRINDRGPFVDDRIIDLSMAAAKELDMIGPGTAPVRVKAVGSA 174


>gi|145635214|ref|ZP_01790918.1| lipoprotein [Haemophilus influenzae PittAA]
 gi|145267493|gb|EDK07493.1| lipoprotein [Haemophilus influenzae PittAA]
          Length = 285

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 84/147 (57%), Gaps = 13/147 (8%)

Query: 41  ESMYGVTASD-RIVSGKRVPRGGGRYFLGKPYQIMGRWYVPR---QYTAYAAVGMASWYG 96
           + MYG+   +  I +    PR          Y + G+ Y  +   +   Y   G+AS+Y 
Sbjct: 28  QKMYGIRGDNLSIATQMPAPR---------TYSVKGQTYTTKSGNEAKFYIKEGLASYYH 78

Query: 97  KAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLID 156
             F GR TA+G+VY ++  TAAH TLP+ SY  V N+ N   ++VR+NDRGP+   RLID
Sbjct: 79  LKFDGRKTASGDVYNSKQFTAAHKTLPINSYALVINLHNNRKVIVRINDRGPFSDKRLID 138

Query: 157 LSNAAAKILRVEERGVSKVHVEYLGMA 183
           LS+AAAK + +  RG+ +V +E L +A
Sbjct: 139 LSHAAAKEIGLISRGIGQVRIEALHVA 165


>gi|318042612|ref|ZP_07974568.1| rare lipoprotein A [Synechococcus sp. CB0101]
          Length = 177

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/91 (53%), Positives = 64/91 (70%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  F+G  TANGEV+    +TAAH TLP  + VRVTN+ NG S +VR+NDRGP+
Sbjct: 85  GQASWYGPGFYGNRTANGEVFRPGTLTAAHRTLPFGTKVRVTNLGNGRSAIVRINDRGPF 144

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           H NR+IDL++ AA  L +   G++ V +E L
Sbjct: 145 HGNRVIDLAHGAANNLGLISSGIANVKLEVL 175


>gi|153206719|ref|ZP_01945560.1| rare lipoprotein A family protein [Coxiella burnetii 'MSU Goat
           Q177']
 gi|120577082|gb|EAX33706.1| rare lipoprotein A family protein [Coxiella burnetii 'MSU Goat
           Q177']
          Length = 261

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 77/123 (62%), Gaps = 3/123 (2%)

Query: 59  PRGGGRYFLGKP--YQIMG-RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYI 115
           PR   R   G P  Y + G R++V +    Y   G+ASWYG  FHG+LT+  E Y    +
Sbjct: 40  PRPLPRSKYGNPSSYTVNGKRYHVLKTARGYQRRGIASWYGTKFHGQLTSTREPYNMLAM 99

Query: 116 TAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKV 175
           T A P LP+P +VRVTN+ NG S+VV++NDRGP+  +R++DLS AAAK L    RG + V
Sbjct: 100 TGASPVLPIPCFVRVTNLSNGRSVVVKINDRGPFAPHRILDLSYAAAKKLGYVNRGTALV 159

Query: 176 HVE 178
            V+
Sbjct: 160 EVK 162


>gi|46578813|ref|YP_009621.1| rare lipoprotein A [Desulfovibrio vulgaris str. Hildenborough]
 gi|120603580|ref|YP_967980.1| rare lipoprotein A [Desulfovibrio vulgaris DP4]
 gi|46448225|gb|AAS94880.1| rare lipoprotein A, putative [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120563809|gb|ABM29553.1| rare lipoprotein A [Desulfovibrio vulgaris DP4]
 gi|311232676|gb|ADP85530.1| rare lipoprotein A [Desulfovibrio vulgaris RCH1]
          Length = 243

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 54/129 (41%), Positives = 78/129 (60%), Gaps = 1/129 (0%)

Query: 54  SGKRVPRGGGRYFLGKPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGT 112
           SG   P+G       KPY + G+ Y P +    +   G+ASWYG  FHG+ TANGE Y  
Sbjct: 30  SGVSYPKGQPSGPRAKPYTVRGKTYYPLKSAHGFVEEGVASWYGSDFHGKKTANGERYDM 89

Query: 113 EYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGV 172
             +TAAH  LP  + +RVTN+ NG  ++VRVNDRGP+  +R+IDL++  A  + +   G 
Sbjct: 90  YAMTAAHKLLPFNTNLRVTNLANGKQIIVRVNDRGPFVGDRIIDLTHTGASRIGMIGPGT 149

Query: 173 SKVHVEYLG 181
           ++V +E +G
Sbjct: 150 ARVRLETVG 158


>gi|161830475|ref|YP_001596725.1| rare lipoprotein A family protein [Coxiella burnetii RSA 331]
 gi|161762342|gb|ABX77984.1| rare lipoprotein A family protein [Coxiella burnetii RSA 331]
          Length = 261

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 77/123 (62%), Gaps = 3/123 (2%)

Query: 59  PRGGGRYFLGKP--YQIMG-RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYI 115
           PR   R   G P  Y + G R++V +    Y   G+ASWYG  FHG+LT+  E Y    +
Sbjct: 40  PRPLPRSKYGNPSSYTVNGKRYHVLKTARGYQRRGIASWYGTKFHGQLTSTREPYNMLAM 99

Query: 116 TAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKV 175
           T A P LP+P +VRVTN+ NG S+VV++NDRGP+  +R++DLS AAAK L    RG + V
Sbjct: 100 TGASPVLPIPCFVRVTNLSNGRSVVVKINDRGPFAPHRILDLSYAAAKKLGYVNRGTALV 159

Query: 176 HVE 178
            V+
Sbjct: 160 EVK 162


>gi|224533334|ref|ZP_03673928.1| rare lipoprotein A [Borrelia burgdorferi CA-11.2a]
 gi|224513499|gb|EEF83856.1| rare lipoprotein A [Borrelia burgdorferi CA-11.2a]
          Length = 262

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 66/94 (70%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
           A VG+ASWYG+AFHG+ TANGE +    +TAAH  LP  + V+VTN+ N  S++VR+NDR
Sbjct: 31  ATVGLASWYGEAFHGKTTANGEKFDMMALTAAHKELPFNTTVKVTNLLNNRSVIVRINDR 90

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           GP+  +R+IDLS  AA+ L     GV+ V +E +
Sbjct: 91  GPFRKDRIIDLSKYAAEKLDFLGIGVAPVKIEVI 124


>gi|310778256|ref|YP_003966589.1| rare lipoprotein A [Ilyobacter polytropus DSM 2926]
 gi|309747579|gb|ADO82241.1| rare lipoprotein A [Ilyobacter polytropus DSM 2926]
          Length = 137

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 62/91 (68%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           GMASWYGK FHGRLTA+GE Y   Y TAAH +LP  + VRVTN+ NG S+ V++NDRGP+
Sbjct: 37  GMASWYGKDFHGRLTASGEKYNIRYYTAAHKSLPFGTIVRVTNLNNGKSVRVKINDRGPF 96

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R+IDLS  A K +     GV  V +E L
Sbjct: 97  VKGRVIDLSPKAFKSIASLNSGVIPVKIEIL 127


>gi|312149565|gb|ADQ29636.1| rare lipoprotein A [Borrelia burgdorferi N40]
          Length = 262

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 66/94 (70%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
           A VG+ASWYG+AFHG+ TANGE +    +TAAH  LP  + V+VTN+ N  S++VR+NDR
Sbjct: 31  ATVGLASWYGEAFHGKTTANGEKFDMMALTAAHKELPFNTTVKVTNLLNNRSVIVRINDR 90

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           GP+  +R+IDLS  AA+ L     GV+ V +E +
Sbjct: 91  GPFRKDRIIDLSKYAAEKLDFLGIGVAPVKIEVI 124


>gi|189499232|ref|YP_001958702.1| rare lipoprotein A [Chlorobium phaeobacteroides BS1]
 gi|189494673|gb|ACE03221.1| rare lipoprotein A [Chlorobium phaeobacteroides BS1]
          Length = 170

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 64/89 (71%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+Y   FHGRLTANGE +    +TAAH +LP  S VRVTN+ NG  ++VR+NDRGPY
Sbjct: 76  GKASYYADRFHGRLTANGERFNMHELTAAHKSLPFGSMVRVTNLNNGRKVMVRINDRGPY 135

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVE 178
              R+IDLS  AAK + + ++GV+KV +E
Sbjct: 136 IKGRIIDLSLEAAKEINLLKKGVAKVRIE 164


>gi|257455450|ref|ZP_05620685.1| rare lipoprotein A [Enhydrobacter aerosaccus SK60]
 gi|257447412|gb|EEV22420.1| rare lipoprotein A [Enhydrobacter aerosaccus SK60]
          Length = 194

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 67/93 (72%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           ++  G+ASWYG+ F GR TA+G+ + +  +TAAH +LP+  Y++VTN  NG S+VV+VND
Sbjct: 96  FSQTGVASWYGRQFQGRKTASGDTFDSNSLTAAHRSLPMNCYIKVTNKSNGKSVVVKVND 155

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           RGP+ S+R++DLS AAAK + +   G   V +E
Sbjct: 156 RGPFSSHRVLDLSYAAAKQIGLASTGTGNVVIE 188


>gi|145629113|ref|ZP_01784912.1| lipoprotein [Haemophilus influenzae 22.1-21]
 gi|145633413|ref|ZP_01789143.1| lipoprotein [Haemophilus influenzae 3655]
 gi|144978616|gb|EDJ88339.1| lipoprotein [Haemophilus influenzae 22.1-21]
 gi|144985976|gb|EDJ92578.1| lipoprotein [Haemophilus influenzae 3655]
          Length = 287

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 84/147 (57%), Gaps = 13/147 (8%)

Query: 41  ESMYGVTASD-RIVSGKRVPRGGGRYFLGKPYQIMGRWYVPR---QYTAYAAVGMASWYG 96
           + MYG+   +  I +    PR          Y + G+ Y  +   +   Y   G+AS+Y 
Sbjct: 28  QKMYGIRGDNLSIATQMPAPR---------TYSVKGQTYTTKSGNEAKFYIKEGLASYYH 78

Query: 97  KAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLID 156
             F GR TA+G+VY ++  TAAH TLP+ SY  V N+ N   ++VR+NDRGP+   RLID
Sbjct: 79  LKFDGRKTASGDVYNSKQFTAAHKTLPINSYALVINLHNNRKVIVRINDRGPFSDKRLID 138

Query: 157 LSNAAAKILRVEERGVSKVHVEYLGMA 183
           LS+AAAK + +  RG+ +V +E L +A
Sbjct: 139 LSHAAAKEIGLISRGIGQVRIEALHVA 165


>gi|193213586|ref|YP_001999539.1| rare lipoprotein A [Chlorobaculum parvum NCIB 8327]
 gi|193087063|gb|ACF12339.1| rare lipoprotein A [Chlorobaculum parvum NCIB 8327]
          Length = 146

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 50/91 (54%), Positives = 62/91 (68%)

Query: 88  AVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRG 147
           A G AS+YG  FHGR TANGE +     TAAH +LP  + VRVTN+ NG  + V +NDRG
Sbjct: 53  ATGTASYYGSKFHGRTTANGEQFDMRTFTAAHRSLPFGTIVRVTNLNNGKMVFVTINDRG 112

Query: 148 PYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           PY   R+IDLS AAAK L + + GVS+V +E
Sbjct: 113 PYVGKRIIDLSKAAAKQLDMVDAGVSRVKIE 143


>gi|198284615|ref|YP_002220936.1| rare lipoprotein A [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218668015|ref|YP_002427288.1| rare lipoprotein A, putative [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|198249136|gb|ACH84729.1| rare lipoprotein A [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218520228|gb|ACK80814.1| rare lipoprotein A, putative [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 361

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 74/113 (65%), Gaps = 1/113 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY+I GRWY P R    ++  G+ASWY +     +TA G  +    +TAA  TLPLPS 
Sbjct: 68  QPYEINGRWYHPLRGDADFSENGIASWYDRQSSSDVTAMGTAFHARQMTAASRTLPLPSC 127

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VRVTN++NG S+VV VNDRGP+ S R++D+S  AA  L +  RG + VH++ +
Sbjct: 128 VRVTNLKNGRSIVVLVNDRGPFVSGRIMDMSYGAASRLGMLSRGTTPVHIQVI 180


>gi|254417104|ref|ZP_05030850.1| Rare lipoprotein A-like double-psi beta-barrel [Microcoleus
           chthonoplastes PCC 7420]
 gi|196176082|gb|EDX71100.1| Rare lipoprotein A-like double-psi beta-barrel [Microcoleus
           chthonoplastes PCC 7420]
          Length = 373

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/91 (52%), Positives = 65/91 (71%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG  FHG  +A+GE +    +TAAH +LP  + VRVTN+ NG S++VR+NDRGPY
Sbjct: 281 GIASWYGPGFHGNRSASGERFNQNALTAAHRSLPFGTNVRVTNLNNGRSVIVRINDRGPY 340

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R+IDLS AAA++L +   GV+ V +E L
Sbjct: 341 TRGRVIDLSAAAARVLGLLRTGVAPVRIEVL 371


>gi|224370983|ref|YP_002605147.1| RlpA [Desulfobacterium autotrophicum HRM2]
 gi|223693700|gb|ACN16983.1| RlpA [Desulfobacterium autotrophicum HRM2]
          Length = 217

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 72/116 (62%), Gaps = 7/116 (6%)

Query: 70  PYQIMGRWYVP---RQYTAYAAVGMASWYG----KAFHGRLTANGEVYGTEYITAAHPTL 122
           PY + G+ YVP    +   Y  VG ASWYG    +   G +TANGE +     TAAH  L
Sbjct: 98  PYVVKGKRYVPMSVAKAATYQEVGTASWYGNETLRQKGGHMTANGEAFDPGKPTAAHKHL 157

Query: 123 PLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           PLP +V+VTN+ N  S++VRVNDRGP+  NR+IDLS  AAK L    +G ++V VE
Sbjct: 158 PLPIHVKVTNLANNRSIIVRVNDRGPFSGNRIIDLSADAAKKLGFYRQGTARVKVE 213


>gi|145220464|ref|YP_001131173.1| rare lipoprotein A [Prosthecochloris vibrioformis DSM 265]
 gi|145206628|gb|ABP37671.1| rare lipoprotein A [Chlorobium phaeovibrioides DSM 265]
          Length = 165

 Score =  103 bits (256), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 63/90 (70%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G+AS+Y   FHGR TANGE +    +TAAH +LP  ++VRVTNMENG  + VR+NDRGP
Sbjct: 64  TGIASYYADRFHGRTTANGETFDMNDLTAAHKSLPFGTWVRVTNMENGREVTVRINDRGP 123

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           Y   R+IDLS  AAK++ + + G  +V +E
Sbjct: 124 YVGQRIIDLSREAAKVIGLIKPGTGEVKLE 153


>gi|220924810|ref|YP_002500112.1| rare lipoprotein A [Methylobacterium nodulans ORS 2060]
 gi|219949417|gb|ACL59809.1| rare lipoprotein A [Methylobacterium nodulans ORS 2060]
          Length = 121

 Score =  103 bits (256), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 64/96 (66%), Gaps = 2/96 (2%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
           A A  G ASWYG  F GR TANGE + T   TAAH +LP  S VRVTN  NG S+VVR+N
Sbjct: 28  ASAQSGAASWYGPGFQGRRTANGERFNTHAFTAAHRSLPFGSRVRVTNTANGRSVVVRIN 87

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGPY   R+IDLS A+A+ + +   GVS+V +  L
Sbjct: 88  DRGPYVGGRVIDLSQASARAIGIH--GVSRVRLSRL 121


>gi|321443604|gb|EFX60146.1| hypothetical protein DAPPUDRAFT_345155 [Daphnia pulex]
          Length = 242

 Score =  102 bits (255), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 49/91 (53%), Positives = 64/91 (70%), Gaps = 1/91 (1%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYGK FHG+ T++GE+Y    +T AH T+P+P Y RV N  NG  ++VR+NDRGP+
Sbjct: 11  GLASWYGKKFHGKPTSSGEIYNMYAMTGAHATMPIPGYARVRNPANGREVLVRINDRGPF 70

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           H  R+IDLS  AA  L +  RGVS V VE +
Sbjct: 71  HRGRIIDLSYTAALKLDI-LRGVSPVEVERI 100


>gi|170078706|ref|YP_001735344.1| RlpA-like protein [Synechococcus sp. PCC 7002]
 gi|169886375|gb|ACB00089.1| RlpA-like protein [Synechococcus sp. PCC 7002]
          Length = 357

 Score =  102 bits (255), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 47/83 (56%), Positives = 61/83 (73%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG  FHGRLTANGE Y    +TAAHP++PL +Y++VTN+ N  S+++R+NDRGPY
Sbjct: 252 GLASWYGPYFHGRLTANGETYDQYALTAAHPSMPLNTYLKVTNLNNDRSVIIRLNDRGPY 311

Query: 150 HSNRLIDLSNAAAKILRVEERGV 172
              R +DLS  AA+ L   E GV
Sbjct: 312 IPPRSLDLSLGAARCLNSVETGV 334


>gi|163849590|ref|YP_001637633.1| rare lipoprotein A [Methylobacterium extorquens PA1]
 gi|163661195|gb|ABY28562.1| rare lipoprotein A [Methylobacterium extorquens PA1]
          Length = 122

 Score =  102 bits (255), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 69/105 (65%), Gaps = 5/105 (4%)

Query: 71  YQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRV 130
           + I G    P+   A    G ASWYG  FHGRLTA+GE + T  +TAAH TLP  + VRV
Sbjct: 18  FTISGAEAAPK---AAGQSGAASWYGPGFHGRLTASGERFNTHAMTAAHRTLPFGARVRV 74

Query: 131 TNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKV 175
           TN  NG S+VVR+NDRGP+  +R+IDLS A+A  + V   GV+KV
Sbjct: 75  TNKSNGRSVVVRINDRGPFVVDRVIDLSKASAGAIGVS--GVAKV 117


>gi|251793193|ref|YP_003007921.1| lipoprotein [Aggregatibacter aphrophilus NJ8700]
 gi|247534588|gb|ACS97834.1| lipoprotein [Aggregatibacter aphrophilus NJ8700]
          Length = 294

 Score =  102 bits (255), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 73/115 (63%), Gaps = 3/115 (2%)

Query: 69  KPYQIMGRWYVPRQYTA---YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLP 125
           + Y + G  Y  R +     Y+  G+AS+Y   F+GR T+NG++Y +   TAAH TLPL 
Sbjct: 47  QTYNVKGETYTTRSHQTAKNYSKQGIASYYHHKFNGRKTSNGDIYDSTLYTAAHKTLPLN 106

Query: 126 SYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           SY  VTNM N   ++VR+NDRGP+  +R+IDLS+AAAK + +   G+  V VE L
Sbjct: 107 SYAVVTNMYNQRKVIVRINDRGPFAKDRIIDLSHAAAKEIGIVNYGMGLVKVEAL 161


>gi|322833902|ref|YP_004213929.1| rare lipoprotein A [Rahnella sp. Y9602]
 gi|321169103|gb|ADW74802.1| rare lipoprotein A [Rahnella sp. Y9602]
          Length = 383

 Score =  102 bits (255), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 74/114 (64%), Gaps = 3/114 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + G+ Y + +  + ++ VG A+WY +   G  TA GE +    +TAAHPTLP+PSYVR
Sbjct: 59  YTVNGKTYKIIKDPSNFSQVGQAAWYSQENGGNTTALGEEFDPTAMTAAHPTLPIPSYVR 118

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VTNM  G  LVVRVNDRGPY   ++IDLS AAA  L +     +KV ++++ +A
Sbjct: 119 VTNMATGRMLVVRVNDRGPYVPGKIIDLSQAAADRLNLTNS--TKVRIDFINVA 170


>gi|315499863|ref|YP_004088666.1| rare lipoprotein a [Asticcacaulis excentricus CB 48]
 gi|315417875|gb|ADU14515.1| rare lipoprotein A [Asticcacaulis excentricus CB 48]
          Length = 255

 Score =  102 bits (255), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 54/118 (45%), Positives = 74/118 (62%), Gaps = 2/118 (1%)

Query: 69  KPYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY++ G  Y P          G ASWYG    G LTA GE +    ++AAH T PLPS 
Sbjct: 53  RPYKVRGDTYSPYVPDIGDTLTGTASWYGHE-SGSLTATGEHFDPNALSAAHKTWPLPSV 111

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALL 185
           + VTN++NG SL +R+NDRGP+   RL+DLS  AAK L V + G ++V +++LG A+L
Sbjct: 112 IEVTNLDNGRSLRLRLNDRGPFVDGRLLDLSKGAAKALGVHQTGTARVRIKFLGPAVL 169


>gi|78355578|ref|YP_387027.1| rare lipoprotein A [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78217983|gb|ABB37332.1| rare lipoprotein A [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 370

 Score =  102 bits (255), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 69/98 (70%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           GMASWYG+ F GR TA+GE +    +TAAH TLPL S VRV N+ENG +++VR+NDRGP+
Sbjct: 39  GMASWYGEFFQGRPTASGEPFDMNALTAAHMTLPLGSIVRVVNLENGKTVIVRINDRGPF 98

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
               +IDLS  AA  L + ++G ++V +E L   +++G
Sbjct: 99  KKQYVIDLSRQAAVRLDMLQKGTARVRIEPLDRNVIDG 136


>gi|189347921|ref|YP_001944450.1| rare lipoprotein A [Chlorobium limicola DSM 245]
 gi|189342068|gb|ACD91471.1| rare lipoprotein A [Chlorobium limicola DSM 245]
          Length = 171

 Score =  102 bits (254), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 74/117 (63%), Gaps = 7/117 (5%)

Query: 69  KPYQIMGRWYVP---RQYTAYAAVGMASWYGK----AFHGRLTANGEVYGTEYITAAHPT 121
           KPY I G+ YVP   R+   Y   G+ASWYG+      + + TA GE +  +  +AAH  
Sbjct: 51  KPYVIDGKLYVPMDYRETAGYQETGIASWYGQETLDQHNNQPTAYGETFYPDKPSAAHKY 110

Query: 122 LPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           LPLP+ VRVTN+E   S++VRVNDRGP+  NR+IDLS  AAK L    +G +KV +E
Sbjct: 111 LPLPAIVRVTNLETNASVIVRVNDRGPFVGNRVIDLSAEAAKQLGFYGKGTAKVKLE 167


>gi|218682278|ref|ZP_03529879.1| rare lipoprotein A [Rhizobium etli CIAT 894]
          Length = 244

 Score =  102 bits (254), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 60/80 (75%)

Query: 117 AAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVH 176
           AAHPT P+PSY RVTN+E+G S++VRVNDRGPYH  R+IDLSN  A +L ++  G  KV 
Sbjct: 1   AAHPTFPMPSYARVTNLESGSSVIVRVNDRGPYHEGRIIDLSNKTADMLDLQHSGTGKVR 60

Query: 177 VEYLGMALLNGMDQEYLRST 196
           V+Y+G A ++G D  YL ++
Sbjct: 61  VQYVGRARMDGHDMPYLMAS 80


>gi|307721070|ref|YP_003892210.1| rare lipoprotein A [Sulfurimonas autotrophica DSM 16294]
 gi|306979163|gb|ADN09198.1| rare lipoprotein A [Sulfurimonas autotrophica DSM 16294]
          Length = 272

 Score =  102 bits (254), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 54/116 (46%), Positives = 71/116 (61%), Gaps = 1/116 (0%)

Query: 69  KPYQIMGRWYVPRQYTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY + G+ Y P   +      G ASWYG  FHG+ T+NGE Y    +TAAH TLP+ + 
Sbjct: 60  RPYVVHGKRYYPTVVSVGDRFRGNASWYGPNFHGKFTSNGERYNMWDMTAAHKTLPMNTI 119

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           V+V N  NG S VVR+NDRGP+ S R+IDLS AAA  + +   G + V +E LG  
Sbjct: 120 VKVINRRNGKSTVVRINDRGPFVSTRIIDLSKAAASKINMIGTGTAPVTLEVLGFT 175


>gi|78187861|ref|YP_375904.1| rare lipoprotein A [Chlorobium luteolum DSM 273]
 gi|78167763|gb|ABB24861.1| Rare lipoprotein A [Chlorobium luteolum DSM 273]
          Length = 165

 Score =  102 bits (254), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 48/89 (53%), Positives = 66/89 (74%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+AS+Y   FHGR+TANGE +  + +TAAH TLP  ++VRVTNMENG  ++VR+NDRGPY
Sbjct: 65  GLASYYADRFHGRMTANGERFNMDALTAAHRTLPFGTWVRVTNMENGKEVMVRINDRGPY 124

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVE 178
            + R+IDLS  AA+ L + + G  +V +E
Sbjct: 125 VNGRIIDLSRGAARELGLIKPGTGEVKLE 153


>gi|148259979|ref|YP_001234106.1| rare lipoprotein A [Acidiphilium cryptum JF-5]
 gi|146401660|gb|ABQ30187.1| Rare lipoprotein A [Acidiphilium cryptum JF-5]
          Length = 295

 Score =  102 bits (254), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 50/117 (42%), Positives = 74/117 (63%), Gaps = 1/117 (0%)

Query: 64  RYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLP 123
           RY +GKPY   G+W+ PR +  Y   G+++        RLTA+GE Y  + +TA  P LP
Sbjct: 31  RYTVGKPYNAGGQWHYPRVFGHYDRTGLSTLIAPG-PARLTADGEAYRADSLTAQSPVLP 89

Query: 124 LPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           LPS VR+TN++ G SL VRVNDRGP  + R++ ++   A++L +   GV++V V+ L
Sbjct: 90  LPSIVRITNLDTGRSLAVRVNDRGPMQAGRIVAVTPRVARLLGMPADGVAEVRVQLL 146


>gi|270263702|ref|ZP_06191971.1| rare lipoprotein A [Serratia odorifera 4Rx13]
 gi|270042586|gb|EFA15681.1| rare lipoprotein A [Serratia odorifera 4Rx13]
          Length = 220

 Score =  102 bits (254), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 57/137 (41%), Positives = 81/137 (59%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G  Y + +    ++  G+AS YG+   G  TA GE +    +TAAHPTLP+PSYVR
Sbjct: 58  YKVNGDTYRIVKDPQNFSQTGLASSYGEEARGNTTALGEQFDPNGLTAAHPTLPIPSYVR 117

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN+ NG  LVVRVNDRGPY + R+IDLS A A  L +     +KV V+++ +A    + 
Sbjct: 118 VTNLANGRQLVVRVNDRGPYTNGRIIDLSKAVADRLNLSNN--TKVKVDFINVAPDGTLS 175

Query: 190 QEYLRSTVMVNSATVLP 206
                 T++   +  LP
Sbjct: 176 GPGTIGTIVAKQSYALP 192


>gi|307294208|ref|ZP_07574052.1| rare lipoprotein A [Sphingobium chlorophenolicum L-1]
 gi|306880359|gb|EFN11576.1| rare lipoprotein A [Sphingobium chlorophenolicum L-1]
          Length = 190

 Score =  102 bits (254), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 73/115 (63%), Gaps = 2/115 (1%)

Query: 67  LGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
           +GKPY + G  YVP    AY  +G ASWYG    G  TANGE +    +TAAH TLPLPS
Sbjct: 38  VGKPYAVRGVTYVPAADPAYDYLGYASWYGHE-SGNRTANGERFVPRAVTAAHATLPLPS 96

Query: 127 YVRVTNMENGISLVVRVNDRGPYHS-NRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           YV VT++E G +++VRVNDRGP+    R+IDLS  AA+ L +   G + V V  +
Sbjct: 97  YVEVTSLETGRTILVRVNDRGPFAGRGRIIDLSRGAAEQLGIRAAGHAPVRVRVV 151


>gi|52425885|ref|YP_089022.1| RlpA protein [Mannheimia succiniciproducens MBEL55E]
 gi|52307937|gb|AAU38437.1| RlpA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 195

 Score =  102 bits (253), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 68/113 (60%), Gaps = 3/113 (2%)

Query: 71  YQIMGRWYV---PRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           Y + GR Y     R    Y+  G AS+Y   FHGR TA+GE Y  +  TAAH TLPL SY
Sbjct: 53  YVVNGRKYTTQTSRNAKNYSKEGKASYYHNKFHGRRTASGEKYSNQQYTAAHKTLPLGSY 112

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
             VTN+ N   ++VR+NDRGP+   R++DLS+AAA  L +   GV  V VE L
Sbjct: 113 ALVTNLRNNKKVIVRINDRGPFSKTRIMDLSHAAANELGLIRAGVGNVRVEAL 165


>gi|326403066|ref|YP_004283147.1| putative lipoprotein [Acidiphilium multivorum AIU301]
 gi|325049927|dbj|BAJ80265.1| putative lipoprotein [Acidiphilium multivorum AIU301]
          Length = 295

 Score =  102 bits (253), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 50/117 (42%), Positives = 74/117 (63%), Gaps = 1/117 (0%)

Query: 64  RYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLP 123
           RY +GKPY   G+W+ PR +  Y   G+++        RLTA+GE Y  + +TA  P LP
Sbjct: 31  RYTVGKPYNAGGQWHYPRVFGHYDRTGLSTLIAPG-PARLTADGEAYRADSLTAQSPVLP 89

Query: 124 LPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           LPS VR+TN++ G SL VRVNDRGP  + R++ ++   A++L +   GV++V V+ L
Sbjct: 90  LPSIVRITNLDTGHSLAVRVNDRGPMQAGRIVAVTPRVARLLGMPADGVAEVRVQLL 146


>gi|225872559|ref|YP_002754014.1| rare lipoprotein A family protein [Acidobacterium capsulatum ATCC
           51196]
 gi|225792151|gb|ACO32241.1| rare lipoprotein A family protein [Acidobacterium capsulatum ATCC
           51196]
          Length = 172

 Score =  102 bits (253), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 67/100 (67%)

Query: 81  RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLV 140
           R++  +  +G+ASWYGK F G+ TA+GE Y    +T AH TLPL S VRVTN+ N  S+V
Sbjct: 56  RRHHHWYQIGIASWYGKFFQGKETASGEPYNMNAMTCAHRTLPLGSLVRVTNLRNDKSVV 115

Query: 141 VRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VRVNDRGP   NR+IDLS AAA  L +   G + V +E +
Sbjct: 116 VRVNDRGPLPENRVIDLSYAAAGFLGLRHSGTAPVRIELI 155


>gi|254422015|ref|ZP_05035733.1| Rare lipoprotein A-like double-psi beta-barrel [Synechococcus sp.
           PCC 7335]
 gi|196189504|gb|EDX84468.1| Rare lipoprotein A-like double-psi beta-barrel [Synechococcus sp.
           PCC 7335]
          Length = 354

 Score =  102 bits (253), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 65/104 (62%), Gaps = 2/104 (1%)

Query: 80  PRQYTAY--AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGI 137
           P Q  A   + VG ASWYG  FHGR TANGE +    +TAAH TLP  + V VTN+  G 
Sbjct: 250 PAQQVAIVSSTVGTASWYGPGFHGRRTANGESFNQYALTAAHRTLPFGTRVLVTNLYTGR 309

Query: 138 SLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
            +VVR+NDRGP+  NR+IDLS  AA  + +   GV  V ++ LG
Sbjct: 310 QVVVRINDRGPFSGNRVIDLSAGAADQIGLTSAGVGTVQLDILG 353


>gi|261493868|ref|ZP_05990380.1| putative lipoprotein [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261310470|gb|EEY11661.1| putative lipoprotein [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 219

 Score =  102 bits (253), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 69/105 (65%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G+AS+Y   F+GR TANGE +    +TAAH TLP  + + VTN+ NG S+VVRVNDRGP
Sbjct: 113 TGVASYYANYFNGRRTANGETFNNAKMTAAHRTLPFGTLIEVTNLRNGRSVVVRVNDRGP 172

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYL 193
           Y   R++DLS+AAAK + +   G ++V +  +  + L   +Q Y+
Sbjct: 173 YAHARVLDLSSAAAKKIGMHHSGTARVKIAIVDKSKLGSTNQFYV 217


>gi|254360904|ref|ZP_04977050.1| possible lipoprotein [Mannheimia haemolytica PHL213]
 gi|153092383|gb|EDN73446.1| possible lipoprotein [Mannheimia haemolytica PHL213]
          Length = 219

 Score =  102 bits (253), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 69/105 (65%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G+AS+Y   F+GR TANGE +    +TAAH TLP  + + VTN+ NG S+VVRVNDRGP
Sbjct: 113 TGVASYYANYFNGRRTANGETFNNAKMTAAHRTLPFGTLIEVTNLRNGRSVVVRVNDRGP 172

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYL 193
           Y   R++DLS+AAAK + +   G ++V +  +  + L   +Q Y+
Sbjct: 173 YAHARVLDLSSAAAKKIGMHHSGTARVKIAIVDKSKLGSTNQFYV 217


>gi|189347839|ref|YP_001944368.1| rare lipoprotein A [Chlorobium limicola DSM 245]
 gi|189341986|gb|ACD91389.1| rare lipoprotein A [Chlorobium limicola DSM 245]
          Length = 163

 Score =  101 bits (252), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 46/91 (50%), Positives = 63/91 (69%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+Y   FHGR TANGE +     TAAHP+LP  ++VRVTN+ NG  ++VR+NDRGP+
Sbjct: 63  GKASYYANQFHGRKTANGETFNMNEFTAAHPSLPFGTWVRVTNLRNGKDVIVRINDRGPF 122

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R+IDLS  AAK + + + G ++V VE +
Sbjct: 123 IKGRVIDLSVGAAKQIGLFKSGTAQVRVEAI 153


>gi|315186065|gb|EFU19828.1| rare lipoprotein A [Spirochaeta thermophila DSM 6578]
          Length = 194

 Score =  101 bits (252), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 60/131 (45%), Positives = 77/131 (58%), Gaps = 4/131 (3%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG  F G+LTA+GEVY  E +TAAH +LP  + VRV   E G ++VVR+ DRGP+
Sbjct: 23  GLASWYGPGFAGKLTASGEVYNPEEMTAAHKSLPFGALVRVWCRETGHAVVVRITDRGPF 82

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM-ALLNGMDQE---YLRSTVMVNSATVL 205
              R+IDLS  AA++L   E G + V VE L    L  G + E   YL+       A  L
Sbjct: 83  VEGRVIDLSRRAAEMLGFLEEGTAHVKVELLAKEGLPQGGEGERVVYLQVGAFRKEANAL 142

Query: 206 PLGCQYREEIV 216
            LG +  EE V
Sbjct: 143 RLGVRLAEEGV 153


>gi|261495134|ref|ZP_05991598.1| putative lipoprotein [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261309204|gb|EEY10443.1| putative lipoprotein [Mannheimia haemolytica serotype A2 str.
           OVINE]
          Length = 219

 Score =  101 bits (252), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 69/105 (65%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G+AS+Y   F+GR TANGE +    +TAAH TLP  + + VTN+ NG S+VVRVNDRGP
Sbjct: 113 TGVASYYANYFNGRRTANGETFNNAKMTAAHRTLPFGTLIEVTNLRNGRSVVVRVNDRGP 172

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYL 193
           Y   R++DLS+AAAK + +   G ++V +  +  + L   +Q Y+
Sbjct: 173 YAHARVLDLSSAAAKKIGMHHSGTARVKIAIVDKSKLGSTNQFYV 217


>gi|312171709|emb|CBX79967.1| Rare lipoprotein A precursor [Erwinia amylovora ATCC BAA-2158]
          Length = 370

 Score =  101 bits (252), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 72/114 (63%), Gaps = 3/114 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + G  Y + +  + ++  G+A+ YG    G  TA GE +    +TAAHPTLPLPSYVR
Sbjct: 60  YTVNGTGYKIVKDPSNFSQTGIATSYGDEKAGNQTATGERFDANAMTAAHPTLPLPSYVR 119

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VTN+ NG  +VVRVNDRGPY   R+IDLS AAA  L       ++V ++Y+ +A
Sbjct: 120 VTNLANGRMIVVRVNDRGPYTPGRIIDLSRAAADRLNTSNN--TRVRIDYISVA 171


>gi|157369442|ref|YP_001477431.1| rare lipoprotein A [Serratia proteamaculans 568]
 gi|157321206|gb|ABV40303.1| rare lipoprotein A [Serratia proteamaculans 568]
          Length = 361

 Score =  101 bits (252), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 73/114 (64%), Gaps = 3/114 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G  Y + +    ++  G+AS YG+   G  TA GE +    +TAAHPTLP+PSYVR
Sbjct: 58  YKVNGDTYRIVKDPQNFSQTGLASSYGEEARGNTTALGEQFDPNGLTAAHPTLPIPSYVR 117

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VTN+ NG  LVVRVNDRGPY   R+IDLS A A  L +     +KV V+++ +A
Sbjct: 118 VTNLANGRQLVVRVNDRGPYTQGRIIDLSKAVADRLNLSNN--TKVKVDFINVA 169


>gi|187930530|ref|YP_001901017.1| rare lipoprotein A [Ralstonia pickettii 12J]
 gi|187727420|gb|ACD28585.1| rare lipoprotein A [Ralstonia pickettii 12J]
          Length = 250

 Score =  101 bits (252), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 70/111 (63%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG+ FHGR TA+GE +     T AHP+LPL S+V V N+ N   +V +V DRGPY
Sbjct: 114 GLASWYGRGFHGRRTASGERFDMHAFTVAHPSLPLQSWVLVRNLANDRVVVAKVTDRGPY 173

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRSTVMVN 200
           +  R++D+S AAAK L   +RG ++V +  L  A +  +  E  ++ V  N
Sbjct: 174 YGKRILDMSYAAAKRLDFVKRGSTQVEIRRLSRAEVEALRPELTQTDVASN 224


>gi|153003319|ref|YP_001377644.1| rare lipoprotein A [Anaeromyxobacter sp. Fw109-5]
 gi|152026892|gb|ABS24660.1| rare lipoprotein A [Anaeromyxobacter sp. Fw109-5]
          Length = 142

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 49/95 (51%), Positives = 67/95 (70%)

Query: 84  TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRV 143
            A   VG+AS+YGK FHGR TA+G  Y    +T AHP  P  + ++VT++ENG S+VV V
Sbjct: 45  AASGEVGLASFYGKRFHGRRTASGARYDMNAMTCAHPRAPFGARLKVTDLENGRSVVVTV 104

Query: 144 NDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           NDRGP+   R++DLS AAA+ L + ERG+++V VE
Sbjct: 105 NDRGPFKRGRVVDLSRAAARKLGMIERGLARVRVE 139


>gi|292487602|ref|YP_003530474.1| Rare lipoprotein A [Erwinia amylovora CFBP1430]
 gi|292898841|ref|YP_003538210.1| rare lipoprotein A precursor [Erwinia amylovora ATCC 49946]
 gi|291198689|emb|CBJ45798.1| rare lipoprotein A precursor [Erwinia amylovora ATCC 49946]
 gi|291553021|emb|CBA20066.1| Rare lipoprotein A precursor [Erwinia amylovora CFBP1430]
          Length = 370

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 56/137 (40%), Positives = 78/137 (56%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + G  Y + +  + ++  G+A+ YG    G  TA GE +    +TAAHPTLPLPSYVR
Sbjct: 60  YTVNGTGYKIVKDPSNFSQTGIATSYGDEKAGNQTATGERFDANAMTAAHPTLPLPSYVR 119

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN+ NG  +VVRVNDRGPY   R+IDLS AAA  L       ++V ++Y+ +A    + 
Sbjct: 120 VTNLANGRMIVVRVNDRGPYTPGRIIDLSRAAADRLNTSNN--TRVRIDYISVAADGSLS 177

Query: 190 QEYLRSTVMVNSATVLP 206
                 T +   +  LP
Sbjct: 178 GPGTIGTTVAKQSYALP 194


>gi|107024364|ref|YP_622691.1| rare lipoprotein A [Burkholderia cenocepacia AU 1054]
 gi|105894553|gb|ABF77718.1| rare lipoprotein A [Burkholderia cenocepacia AU 1054]
          Length = 213

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 65/100 (65%)

Query: 81  RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLV 140
           +  + +   G ASWYG+ FHGR TANGE +     TAAH TLPL S ++VTN   G  +V
Sbjct: 95  KDVSEFRQSGRASWYGRDFHGRRTANGERFNMNAFTAAHRTLPLSSCIKVTNASTGKWVV 154

Query: 141 VRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           V+VNDRGP+   R++DLS AAAK++ +   G  +V +E L
Sbjct: 155 VKVNDRGPFKRGRVLDLSYAAAKVIGLVHAGTGRVKIEGL 194


>gi|315633662|ref|ZP_07888952.1| lipoprotein [Aggregatibacter segnis ATCC 33393]
 gi|315477704|gb|EFU68446.1| lipoprotein [Aggregatibacter segnis ATCC 33393]
          Length = 287

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 72/115 (62%), Gaps = 3/115 (2%)

Query: 69  KPYQIMGRWYVPRQYTA---YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLP 125
           + YQ+ G  Y  R +     Y+  G+AS+Y   F+GR T++GE Y +   TAAH TLPL 
Sbjct: 47  QTYQVKGEVYTTRTHQDAKDYSKEGIASYYHNKFNGRRTSSGEPYNSTLFTAAHKTLPLN 106

Query: 126 SYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           SY  VTNM N   ++VR+NDRGP+   R+IDLS+AAAK + +   G+  V +E L
Sbjct: 107 SYAVVTNMSNQRKVIVRINDRGPFSKGRIIDLSHAAAKEIGIIGSGMGMVKIEAL 161


>gi|260912848|ref|ZP_05919334.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325]
 gi|260633226|gb|EEX51391.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325]
          Length = 298

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 51/95 (53%), Positives = 64/95 (67%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           Y+  G+AS+Y K F+GR TANGE+Y     TAAH TLPL SY  VTN+ N   ++VR+ND
Sbjct: 71  YSREGIASFYHKKFNGRKTANGEIYNENLYTAAHKTLPLNSYALVTNLRNNRKVIVRIND 130

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+   R+IDLS AAA  +     G+SKV VE L
Sbjct: 131 RGPFIKGRIIDLSRAAAGEIGAIGSGLSKVRVEAL 165


>gi|183222587|ref|YP_001840583.1| putative lipoprotein [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
 gi|189912622|ref|YP_001964177.1| RlpA-like lipoprotein [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|167777298|gb|ABZ95599.1| RlpA-like lipoprotein [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|167781009|gb|ABZ99307.1| Putative lipoprotein; putative signal peptide [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Paris)']
          Length = 293

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 67/97 (69%)

Query: 84  TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRV 143
           T +  VG++SWYG+ F GR TA+GE +    +T AH TLP+ + V++ N+EN    VVR+
Sbjct: 84  TQFDEVGLSSWYGQKFQGRPTASGEPFDRMKMTGAHRTLPIGTVVKIQNLENQKEAVVRI 143

Query: 144 NDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           NDRGP+   R++D+S   A+IL  +++G++KV ++ L
Sbjct: 144 NDRGPFVDERIVDVSEKTAEILEFKDKGITKVGIKVL 180


>gi|220908715|ref|YP_002484026.1| rare lipoprotein A [Cyanothece sp. PCC 7425]
 gi|219865326|gb|ACL45665.1| rare lipoprotein A [Cyanothece sp. PCC 7425]
          Length = 358

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 64/92 (69%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G+ASWYG  FHG  TA+GE +    +TAAH +LP  + VRVTN+ NG S+VVR+NDRGP
Sbjct: 266 TGVASWYGPGFHGARTASGEAFNQYDLTAAHRSLPFGTQVRVTNLNNGRSVVVRINDRGP 325

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +   R++DLS  AA++L V   GV+ V ++ L
Sbjct: 326 FSGGRILDLSKGAARVLGVLGSGVAPVRLDIL 357


>gi|103486545|ref|YP_616106.1| rare lipoprotein A [Sphingopyxis alaskensis RB2256]
 gi|98976622|gb|ABF52773.1| rare lipoprotein A [Sphingopyxis alaskensis RB2256]
          Length = 185

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 72/112 (64%), Gaps = 2/112 (1%)

Query: 67  LGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
           +G  Y I G  YVP     Y AVG ASWYG +  G  TANGE +  ++ITAAH TLPLP+
Sbjct: 37  IGPAYTIRGATYVPAAAPDYDAVGYASWYG-SESGDRTANGERFRPDWITAAHTTLPLPT 95

Query: 127 YVRVTNMENGISLVVRVNDRGPYHS-NRLIDLSNAAAKILRVEERGVSKVHV 177
           YV VT ++ G  ++VRVNDRGP+    R+IDLS  AA+ L +  +G + V V
Sbjct: 96  YVEVTALDTGRRIIVRVNDRGPFAGRGRIIDLSRGAAEALGLRAQGHAPVRV 147


>gi|78355566|ref|YP_387015.1| rare lipoprotein A [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78217971|gb|ABB37320.1| rare lipoprotein A [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 246

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/111 (47%), Positives = 71/111 (63%), Gaps = 1/111 (0%)

Query: 71  YQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y I G+ Y        Y   G+ASWYGK FHGR TANGEVY    +TAAH  LP  + +R
Sbjct: 51  YTIDGKSYTTMTSAHGYTEEGLASWYGKDFHGRRTANGEVYDMYGMTAAHKLLPFGTRLR 110

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VTN+ENG ++ V VNDRGP+  +R+IDL+   A+ L +   G+++V +E L
Sbjct: 111 VTNLENGKAINVVVNDRGPFVKDRIIDLTYTGAQRLDMVGPGIARVRIESL 161


>gi|325954201|ref|YP_004237861.1| lipoprotein A [Weeksella virosa DSM 16922]
 gi|323436819|gb|ADX67283.1| rare lipoprotein A [Weeksella virosa DSM 16922]
          Length = 168

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 66/99 (66%)

Query: 82  QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVV 141
           + ++  A G+ SWYG  FHGR TA+G++Y    +TAAH TLP  + VRVTN++NG S+VV
Sbjct: 68  EKSSEVATGIVSWYGDKFHGRKTASGKIYDKNELTAAHKTLPFGTKVRVTNIKNGKSVVV 127

Query: 142 RVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            +NDRGP+  +R++DLS AA   +     GV +V  E L
Sbjct: 128 EINDRGPFIKSRVLDLSKAAFSEIGKTSSGVMQVEYEVL 166


>gi|54298560|ref|YP_124929.1| hypothetical protein lpp2624 [Legionella pneumophila str. Paris]
 gi|296108200|ref|YP_003619901.1| Lipoprotein [Legionella pneumophila 2300/99 Alcoy]
 gi|53752345|emb|CAH13777.1| hypothetical protein lpp2624 [Legionella pneumophila str. Paris]
 gi|295650102|gb|ADG25949.1| Lipoprotein [Legionella pneumophila 2300/99 Alcoy]
          Length = 160

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 72/111 (64%), Gaps = 8/111 (7%)

Query: 68  GKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           GK Y +M      +    Y A G+ASWYG     + T+ GE Y    +TAAHPTLP+ + 
Sbjct: 56  GKTYHVM------KSAKHYKAKGIASWYGSHARHQKTSTGERYNMYAMTAAHPTLPIATR 109

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           VRV N+ NG S+VVR+NDRGP+ SNRLIDLS AAAK L +  +G++ V +E
Sbjct: 110 VRVKNLNNGRSVVVRINDRGPFLSNRLIDLSFAAAKKLGI--KGIAPVEIE 158


>gi|218529472|ref|YP_002420288.1| lipoprotein A [Methylobacterium chloromethanicum CM4]
 gi|218521775|gb|ACK82360.1| rare lipoprotein A [Methylobacterium chloromethanicum CM4]
          Length = 122

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 61/86 (70%), Gaps = 2/86 (2%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  FHGRLTANGE + T  +TAAH TLP  + V VTN  NG S+VVR+NDRGP+
Sbjct: 34  GAASWYGPGFHGRLTANGERFNTHALTAAHRTLPFGAQVLVTNKTNGRSVVVRINDRGPF 93

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKV 175
              R+IDLS  +A+ + V   GV+KV
Sbjct: 94  VGGRVIDLSKGSARAIGVS--GVAKV 117


>gi|289164980|ref|YP_003455118.1| rare lipoprotein A [Legionella longbeachae NSW150]
 gi|288858153|emb|CBJ12019.1| putative rare lipoprotein A [Legionella longbeachae NSW150]
          Length = 144

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 71/111 (63%), Gaps = 8/111 (7%)

Query: 68  GKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           GK Y +M      +    Y A G+ASWYG     + T+ GE Y    +TAAHPTLPL + 
Sbjct: 40  GKTYHVM------KSAKHYKAKGVASWYGAHSRHQKTSTGERYNMYAMTAAHPTLPLATR 93

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           VRV N+ NG S+VVR+NDRGP+ SNRLIDLS AAAK L +   G++ V +E
Sbjct: 94  VRVKNLNNGRSIVVRINDRGPFLSNRLIDLSFAAAKKLGIN--GIAPVEIE 142


>gi|52842762|ref|YP_096561.1| rare lipoprotein A [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|54295390|ref|YP_127805.1| hypothetical protein lpl2475 [Legionella pneumophila str. Lens]
 gi|52629873|gb|AAU28614.1| rare lipoprotein A [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|53755222|emb|CAH16715.1| hypothetical protein lpl2475 [Legionella pneumophila str. Lens]
          Length = 160

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 72/111 (64%), Gaps = 8/111 (7%)

Query: 68  GKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           GK Y +M      +    Y A G+ASWYG     + T+ GE Y    +TAAHPTLP+ + 
Sbjct: 56  GKTYHVM------KSAKHYKAKGIASWYGSHARHQKTSTGERYNMYAMTAAHPTLPIATR 109

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           VRV N+ NG S+VVR+NDRGP+ SNRLIDLS AAAK L +  +G++ V +E
Sbjct: 110 VRVKNLNNGRSVVVRINDRGPFLSNRLIDLSFAAAKKLGI--KGIAPVEIE 158


>gi|15603791|ref|NP_246865.1| hypothetical protein PM1926 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|20139707|sp|Q9CJR6|RLPA_PASMU RecName: Full=RlpA-like protein; Flags: Precursor
 gi|12722360|gb|AAK04010.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 294

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/107 (46%), Positives = 70/107 (65%)

Query: 76  RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMEN 135
           R    ++ + YA  G+AS+Y K F+GR TA+G++Y     TAAH TLPL SYV VTN+ N
Sbjct: 57  RTQTSKEASGYARDGIASFYHKKFNGRKTASGQIYNENLYTAAHKTLPLNSYVLVTNLRN 116

Query: 136 GISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
              ++VR+NDRGP+   R+IDLS AAA+ + +   GV  V VE + +
Sbjct: 117 QRKVIVRINDRGPFVKGRIIDLSRAAAREIGLIGSGVGHVRVELIQL 163


>gi|152978378|ref|YP_001344007.1| rare lipoprotein A [Actinobacillus succinogenes 130Z]
 gi|150840101|gb|ABR74072.1| rare lipoprotein A [Actinobacillus succinogenes 130Z]
          Length = 161

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 72/112 (64%), Gaps = 2/112 (1%)

Query: 71  YQIMGRWYVPRQYTA--YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           Y++ G+ Y  +  +   Y+  G AS+Y   F+GR TA+GEVY +   TAAH +LPL SY 
Sbjct: 45  YKVGGKTYSTKSGSVAHYSKNGRASYYHNKFNGRRTASGEVYNSRKYTAAHRSLPLGSYA 104

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            VTN+ N   +VV++NDRGPYH +R+IDLS AAA  L +   GV  V +E L
Sbjct: 105 LVTNLRNNRKVVVKINDRGPYHGSRIIDLSRAAASDLGMIRSGVGNVKIEKL 156


>gi|322437041|ref|YP_004219253.1| rare lipoprotein A [Acidobacterium sp. MP5ACTX9]
 gi|321164768|gb|ADW70473.1| rare lipoprotein A [Acidobacterium sp. MP5ACTX9]
          Length = 258

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 66/90 (73%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
           VG+ASWYG  +H R  A+G ++    +TAAH TLP+ S VRVTN++ G S+VV++ DRGP
Sbjct: 84  VGLASWYGPPYHNRQAADGSIFDQNAMTAAHRTLPMGSTVRVTNLDTGESVVVKITDRGP 143

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           +  NR++DLS AAAK   + ++GV+KV VE
Sbjct: 144 FVPNRILDLSLAAAKATGLYQKGVAKVKVE 173


>gi|258591256|emb|CBE67553.1| RlpA-like lipoprotein precursor (fragment) [NC10 bacterium 'Dutch
           sediment']
          Length = 219

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/91 (54%), Positives = 64/91 (70%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG  +HGR T+NGEVY    +TAAH  +PL S+V V N+ NG SL VRVNDRGP+
Sbjct: 41  GLASWYGHPYHGRRTSNGEVYDMYQLTAAHREIPLGSWVEVINLTNGRSLTVRVNDRGPF 100

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R+IDLS A+A++L V   GV+ V V  +
Sbjct: 101 VDGRIIDLSYASAQLLGVVGPGVAPVRVRLI 131


>gi|307611423|emb|CBX01090.1| hypothetical protein LPW_27891 [Legionella pneumophila 130b]
          Length = 144

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 72/111 (64%), Gaps = 8/111 (7%)

Query: 68  GKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           GK Y +M      +    Y A G+ASWYG     + T+ GE Y    +TAAHPTLP+ + 
Sbjct: 40  GKTYHVM------KSAKHYKAKGIASWYGSHARHQKTSTGERYNMYAMTAAHPTLPIATR 93

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           VRV N+ NG S+VVR+NDRGP+ SNRLIDLS AAAK L +  +G++ V +E
Sbjct: 94  VRVKNLNNGRSVVVRINDRGPFLSNRLIDLSFAAAKKLGI--KGIAPVEIE 142


>gi|148359979|ref|YP_001251186.1| rare lipoprotein A [Legionella pneumophila str. Corby]
 gi|148281752|gb|ABQ55840.1| rare lipoprotein A [Legionella pneumophila str. Corby]
          Length = 144

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 72/111 (64%), Gaps = 8/111 (7%)

Query: 68  GKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           GK Y +M      +    Y A G+ASWYG     + T+ GE Y    +TAAHPTLP+ + 
Sbjct: 40  GKTYHVM------KSAKHYKAKGIASWYGSHARHQKTSTGERYNMYAMTAAHPTLPIATR 93

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           VRV N+ NG S+VVR+NDRGP+ SNRLIDLS AAAK L +  +G++ V +E
Sbjct: 94  VRVKNLNNGRSVVVRINDRGPFLSNRLIDLSFAAAKKLGI--KGIAPVEIE 142


>gi|254432850|ref|ZP_05046553.1| rare lipoprotein A [Cyanobium sp. PCC 7001]
 gi|197627303|gb|EDY39862.1| rare lipoprotein A [Cyanobium sp. PCC 7001]
          Length = 172

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/91 (52%), Positives = 64/91 (70%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  F+GR TA+GE +    +TAAH TLP  + VRVTN+ NG S VVR+NDRGP+
Sbjct: 81  GQASWYGPGFYGRRTASGERFRRGTLTAAHRTLPFGTKVRVTNLRNGRSTVVRINDRGPF 140

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           H NR+IDL++ AA  + +   G++ V +E L
Sbjct: 141 HGNRVIDLAHGAASEVGLTASGLAPVKLEVL 171


>gi|85374398|ref|YP_458460.1| hypothetical protein ELI_07855 [Erythrobacter litoralis HTCC2594]
 gi|84787481|gb|ABC63663.1| hypothetical protein ELI_07855 [Erythrobacter litoralis HTCC2594]
          Length = 178

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/93 (53%), Positives = 63/93 (67%)

Query: 88  AVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRG 147
            +G+AS+YG+ FHGR TANGE +    +TAAH TLP  + VRVTN  NG S+VVR+NDRG
Sbjct: 85  GMGVASYYGRKFHGRRTANGERFDMNGMTAAHKTLPFGTKVRVTNASNGRSVVVRINDRG 144

Query: 148 PYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           P+   R IDLS  AA  L +  RG  +V +E L
Sbjct: 145 PFVRGRTIDLSRKAAGDLGIISRGHGRVEIEIL 177


>gi|21674887|ref|NP_662952.1| rare lipoprotein A [Chlorobium tepidum TLS]
 gi|21648111|gb|AAM73294.1| rare lipoprotein A [Chlorobium tepidum TLS]
          Length = 160

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/91 (51%), Positives = 63/91 (69%)

Query: 88  AVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRG 147
           A+G AS+Y   F G+ TANGE +  +  TAAH +LP  + VRVTN+ NG  + V++NDRG
Sbjct: 67  AIGKASYYTNRFRGQTTANGETFDMKEFTAAHRSLPFGTIVRVTNLNNGKMVFVKINDRG 126

Query: 148 PYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           PY  NR+IDLS AAAK L + + GV +V +E
Sbjct: 127 PYVKNRIIDLSKAAAKQLDLVDSGVGRVKIE 157


>gi|240950036|ref|ZP_04754344.1| rare lipoprotein A RlpA-like protein [Actinobacillus minor NM305]
 gi|240295514|gb|EER46257.1| rare lipoprotein A RlpA-like protein [Actinobacillus minor NM305]
          Length = 190

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/97 (51%), Positives = 63/97 (64%), Gaps = 5/97 (5%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+AS+Y   F+GR TANGE +    +TAAH TLP  + V VTNM NG  +VVRVNDRGPY
Sbjct: 86  GVASYYADKFNGRRTANGETFNNAAMTAAHKTLPFGTLVEVTNMRNGKKVVVRVNDRGPY 145

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLN 186
              R+IDLS  AA+ L +   G +KV      +A+LN
Sbjct: 146 AHARVIDLSKTAARQLGMHHSGTAKV-----KLAILN 177


>gi|257456348|ref|ZP_05621545.1| lipoprotein, RlpA family [Treponema vincentii ATCC 35580]
 gi|257446434|gb|EEV21480.1| lipoprotein, RlpA family [Treponema vincentii ATCC 35580]
          Length = 303

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/128 (44%), Positives = 80/128 (62%), Gaps = 4/128 (3%)

Query: 92  ASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHS 151
           AS+YG+AF+GR T++GE++     TAAH TLP  +++ VTN+ENG  +VVRVNDRGP+ +
Sbjct: 31  ASYYGEAFNGRPTSSGEIFDMNAYTAAHKTLPFGTFLEVTNLENGKKVVVRVNDRGPFVA 90

Query: 152 NRLIDLSNAAAKILRVEERGVSKV---HVEYLGMALLNGMDQEYLRSTVMVNSATVLPLG 208
           NR IDLS AAA+ L +  RGV++V    V+ L  A L   +  Y       N+ T  P  
Sbjct: 91  NREIDLSKAAAESLGMISRGVTRVSIKKVDSLDHAALVATNDVYSNEPAE-NAQTEAPNV 149

Query: 209 CQYREEIV 216
              + E+V
Sbjct: 150 SNTQPEVV 157


>gi|218886638|ref|YP_002435959.1| lipoprotein A [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218757592|gb|ACL08491.1| rare lipoprotein A [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 217

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/102 (50%), Positives = 67/102 (65%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWY    HG+ TA+GE Y    +TAAH TLPL + VRVTN+ NG S++V VNDRGPY
Sbjct: 36  GRASWYSDDLHGKKTASGESYDMNALTAAHKTLPLGTVVRVTNLSNGRSVLVTVNDRGPY 95

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQE 191
             NR ID+S +AAK L + + G + V +E LG A    +D +
Sbjct: 96  RGNRDIDVSYSAAKQLGIVKPGSAAVRIEVLGDAKGRPLDPD 137


>gi|310766970|gb|ADP11920.1| rare lipoprotein A [Erwinia sp. Ejp617]
          Length = 374

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/114 (45%), Positives = 74/114 (64%), Gaps = 3/114 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G  Y + +  + ++  G+A+ YG+      TA GE+     +TAAHPTLPLPSYVR
Sbjct: 60  YKVNGNSYKIVKDPSNFSQTGIATSYGEERGSNQTATGELLDANAMTAAHPTLPLPSYVR 119

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VTN+ NG  +VVRVNDRGPY   R+IDLS AAA  L +     ++V ++Y+ +A
Sbjct: 120 VTNLANGRMIVVRVNDRGPYTPGRIIDLSRAAADRLNISNH--TRVRIDYISVA 171


>gi|259909130|ref|YP_002649486.1| rare lipoprotein A [Erwinia pyrifoliae Ep1/96]
 gi|224964752|emb|CAX56269.1| Rare lipoprotein A [Erwinia pyrifoliae Ep1/96]
 gi|283479158|emb|CAY75074.1| Rare lipoprotein A precursor [Erwinia pyrifoliae DSM 12163]
          Length = 374

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/114 (45%), Positives = 74/114 (64%), Gaps = 3/114 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G  Y + +  + ++  G+A+ YG+      TA GE+     +TAAHPTLPLPSYVR
Sbjct: 60  YKVNGNSYKIVKDPSNFSQTGIATSYGEERGSNQTATGELLDANAMTAAHPTLPLPSYVR 119

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VTN+ NG  +VVRVNDRGPY   R+IDLS AAA  L +     ++V ++Y+ +A
Sbjct: 120 VTNLANGRMIVVRVNDRGPYTPGRIIDLSRAAADRLNISNH--TRVRIDYISVA 171


>gi|85708991|ref|ZP_01040057.1| Rare lipoprotein A [Erythrobacter sp. NAP1]
 gi|85690525|gb|EAQ30528.1| Rare lipoprotein A [Erythrobacter sp. NAP1]
          Length = 204

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 63/92 (68%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+AS+YG+ FHGR TANGE +    +TAAH TLP  S VRVTN  NG S+ VR+NDRGP+
Sbjct: 112 GVASYYGRRFHGRRTANGERFDMGAMTAAHKTLPFGSLVRVTNTRNGKSVTVRINDRGPF 171

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
              R IDLS AAA+ + +  RG + V +E L 
Sbjct: 172 IRGRTIDLSRAAAREIGMISRGHASVEMELLA 203


>gi|322513156|ref|ZP_08066288.1| RlpA protein [Actinobacillus ureae ATCC 25976]
 gi|322121088|gb|EFX92911.1| RlpA protein [Actinobacillus ureae ATCC 25976]
          Length = 188

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/91 (52%), Positives = 63/91 (69%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+AS+Y   F+GR TANGE +    +TAAH TLP  + V VTNM NG S+VVRVNDRGPY
Sbjct: 84  GIASYYADKFNGRRTANGEKFSNSAMTAAHKTLPFGTLVEVTNMRNGRSVVVRVNDRGPY 143

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R++DLS AAA+ L +   G+++V +  L
Sbjct: 144 VHARVVDLSKAAARQLGMHHSGIARVKLAVL 174


>gi|313680005|ref|YP_004057744.1| rare lipoprotein a [Oceanithermus profundus DSM 14977]
 gi|313152720|gb|ADR36571.1| rare lipoprotein A [Oceanithermus profundus DSM 14977]
          Length = 188

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 65/96 (67%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           Y   G+ASWYG  FHGR TA+GEV+     TAAH TLP  S VRVT ++ G  + VR+ND
Sbjct: 90  YVEEGVASWYGPNFHGRRTASGEVFDMYAYTAAHRTLPFGSVVRVTRLDTGARVTVRIND 149

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           RGP+  NR++DLS AAA+ + +   G ++V +E +G
Sbjct: 150 RGPFKKNRILDLSYAAAREIGLIRTGTARVRIEVVG 185


>gi|242281190|ref|YP_002993319.1| rare lipoprotein A [Desulfovibrio salexigens DSM 2638]
 gi|242124084|gb|ACS81780.1| rare lipoprotein A [Desulfovibrio salexigens DSM 2638]
          Length = 289

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 71/111 (63%), Gaps = 3/111 (2%)

Query: 70  PYQIMGRWYVPR-QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
           PY + GR Y+P      Y A G+ASWYG  FHG+ TANGE Y    +TAAH TLP+ + +
Sbjct: 52  PYTVHGRTYIPHLSSKGYKAQGLASWYGDDFHGKTTANGETYNMYAMTAAHRTLPMGTML 111

Query: 129 RVTNMENGISLVVRVNDRGPYHSN--RLIDLSNAAAKILRVEERGVSKVHV 177
            VT+  +G  ++VR+NDRGP+     R+IDLS +AA  L +  +G++ V +
Sbjct: 112 EVTDRSSGRKVIVRINDRGPFADPDLRIIDLSYSAASKLGIVNKGITPVEL 162


>gi|269123389|ref|YP_003305966.1| rare lipoprotein A [Streptobacillus moniliformis DSM 12112]
 gi|268314715|gb|ACZ01089.1| rare lipoprotein A [Streptobacillus moniliformis DSM 12112]
          Length = 167

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 69/97 (71%)

Query: 84  TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRV 143
           T     G+AS+YG+ ++GR TANGE++ T  ++AAH  LP  + V+VTN+ NG S++VR+
Sbjct: 70  TEIYQTGIASYYGERWNGRKTANGEIFDTWKVSAAHKKLPFGTKVKVTNLSNGKSVIVRI 129

Query: 144 NDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           NDRGPY   R+IDLS AA K +   ++G++KV ++ +
Sbjct: 130 NDRGPYIKGRVIDLSKAAFKEIENFDKGITKVKLQII 166


>gi|293391083|ref|ZP_06635417.1| lipoprotein [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290951617|gb|EFE01736.1| lipoprotein [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 285

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 51/116 (43%), Positives = 73/116 (62%), Gaps = 3/116 (2%)

Query: 68  GKPYQIMGRWYVPRQYTA---YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
            + Y + G  Y  + +     Y+  G+AS+Y   F+GR T+NG++Y +   TAAH TLPL
Sbjct: 46  AQTYNVKGETYTTKPHQTAKNYSKQGIASYYHHKFNGRKTSNGDIYDSTLYTAAHKTLPL 105

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            SY  VTNM N   ++VR+NDRGP+  +R+IDLS+AAAK + +   G+  V VE L
Sbjct: 106 NSYAVVTNMYNQRKVIVRINDRGPFAKDRIIDLSHAAAKEIGIVNYGMGLVKVEAL 161


>gi|261868789|ref|YP_003256711.1| lipoprotein [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261414121|gb|ACX83492.1| lipoprotein [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 285

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 51/116 (43%), Positives = 73/116 (62%), Gaps = 3/116 (2%)

Query: 68  GKPYQIMGRWYVPRQYTA---YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
            + Y + G  Y  + +     Y+  G+AS+Y   F+GR T+NG++Y +   TAAH TLPL
Sbjct: 46  AQTYNVKGETYTTKPHQTAKNYSKQGIASYYHHKFNGRKTSNGDIYDSTLYTAAHKTLPL 105

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            SY  VTNM N   ++VR+NDRGP+  +R+IDLS+AAAK + +   G+  V VE L
Sbjct: 106 NSYAVVTNMYNQRKVIVRINDRGPFAKDRIIDLSHAAAKEIGIVNYGMGLVKVEAL 161


>gi|327399450|ref|YP_004340319.1| rare lipoprotein A [Hippea maritima DSM 10411]
 gi|327182079|gb|AEA34260.1| rare lipoprotein A [Hippea maritima DSM 10411]
          Length = 247

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 63/97 (64%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
            Y   G+ASWYG  FHG+ TANGEVY     TAA  TLP  + VRV N+ NG S VVR+N
Sbjct: 41  GYTQEGIASWYGPNFHGKRTANGEVYNMYDHTAASKTLPFNTIVRVINLNNGKSTVVRIN 100

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           DRGP+  NR+IDLS AAAK + +   G + V +  +G
Sbjct: 101 DRGPFVKNRIIDLSYAAAKDIGMIGTGTAPVKIVVIG 137


>gi|148243169|ref|YP_001228326.1| rare lipoprotein A [Synechococcus sp. RCC307]
 gi|147851479|emb|CAK28973.1| Rare lipoprotein A [Synechococcus sp. RCC307]
          Length = 177

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 50/91 (54%), Positives = 62/91 (68%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  F G LTANGE+Y    +TAAH TLP  + VRVTN+ NG S VVR+NDRGPY
Sbjct: 86  GEASWYGPGFFGNLTANGEIYSPGTMTAAHRTLPFGTRVRVTNLWNGRSAVVRINDRGPY 145

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R+IDL + AA  L +   G+++V +E L
Sbjct: 146 VGQRVIDLGHGAAGELGLFHSGIAQVKLEVL 176


>gi|317968766|ref|ZP_07970156.1| rare lipoprotein A [Synechococcus sp. CB0205]
          Length = 166

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 47/93 (50%), Positives = 65/93 (69%)

Query: 88  AVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRG 147
           + G ASWYG  F+G  TANGE++    +TAAH TLP  + VRVTN+ NG S +VR+NDRG
Sbjct: 71  STGEASWYGPGFYGNRTANGELFRPGTLTAAHRTLPFGTKVRVTNLWNGRSAIVRINDRG 130

Query: 148 PYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           P+H  R+IDL++ AA  L +   G+++V +E L
Sbjct: 131 PFHGRRVIDLAHGAASQLGLISSGIAQVKLEVL 163


>gi|257465149|ref|ZP_05629520.1| rare lipoprotein A RlpA-like protein [Actinobacillus minor 202]
 gi|257450809|gb|EEV24852.1| rare lipoprotein A RlpA-like protein [Actinobacillus minor 202]
          Length = 190

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/91 (52%), Positives = 60/91 (65%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+AS+Y   F+GR TANGE +    +TAAH TLP  + V VTNM NG  +VVRVNDRGPY
Sbjct: 86  GVASYYADKFNGRRTANGETFNNAAMTAAHKTLPFGTLVEVTNMRNGKKVVVRVNDRGPY 145

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R+IDLS  AA+ L +   G +KV +  L
Sbjct: 146 AHARVIDLSKTAARQLGMHHSGTAKVKLAIL 176


>gi|317491122|ref|ZP_07949558.1| rare lipoprotein A double-psi beta-barrel protein
           [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316920669|gb|EFV41992.1| rare lipoprotein A double-psi beta-barrel protein
           [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 363

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 57/137 (41%), Positives = 81/137 (59%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + G  Y V +  + ++ VG A+ YG+   G +TA GE +    +TAAH TLPLPSYVR
Sbjct: 60  YSVNGTQYKVVQDPSNFSQVGYATSYGEENGGNMTAIGEQFDPNAMTAAHATLPLPSYVR 119

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           VTN+ NG  LVVR+NDRGPY + ++IDLS AAA  L +     +KV ++++ +A    M 
Sbjct: 120 VTNLANGRRLVVRLNDRGPYTAGKVIDLSRAAADRLNISNN--TKVRIDFISVAPDGTMS 177

Query: 190 QEYLRSTVMVNSATVLP 206
                 T +   +  LP
Sbjct: 178 GPGTIGTTIAKQSYALP 194


>gi|187735424|ref|YP_001877536.1| rare lipoprotein A [Akkermansia muciniphila ATCC BAA-835]
 gi|187425476|gb|ACD04755.1| rare lipoprotein A [Akkermansia muciniphila ATCC BAA-835]
          Length = 173

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 73/117 (62%), Gaps = 4/117 (3%)

Query: 70  PYQIMGRWYVPRQYT---AYAAVGMASWYGKAFHGRLTANGE-VYGTEYITAAHPTLPLP 125
           PY++ G+ Y P        Y   G ASWYG       T++GE +     +TAAH TLP+P
Sbjct: 47  PYRVRGKRYTPMSVADALQYHETGYASWYGGKARRLKTSSGEYINPQRSMTAAHKTLPMP 106

Query: 126 SYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
             V+VT +E G S VVR+N+RGP+HSNRLIDL+ AAA  + +  RGVS+V +E + +
Sbjct: 107 CKVKVTCLETGKSTVVRINNRGPFHSNRLIDLTTAAASRIGLHRRGVSRVRLEVISV 163


>gi|78213147|ref|YP_381926.1| rare lipoprotein A [Synechococcus sp. CC9605]
 gi|78197606|gb|ABB35371.1| rare lipoprotein A [Synechococcus sp. CC9605]
          Length = 157

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/91 (52%), Positives = 64/91 (70%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  F+GR TANGE +    +TAAH TLP  + VRVTN+ NG S+VVR+NDRGP+
Sbjct: 63  GAASWYGPGFYGRTTANGERFSKGTLTAAHRTLPFGTKVRVTNLSNGRSVVVRINDRGPF 122

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
             +R+IDL++ AA  L++ + G   V +E L
Sbjct: 123 KHHRVIDLAHGAASQLQMMQAGEVPVKLEIL 153


>gi|294011157|ref|YP_003544617.1| rare lipoprotein A [Sphingobium japonicum UT26S]
 gi|292674487|dbj|BAI96005.1| rare lipoprotein A [Sphingobium japonicum UT26S]
          Length = 190

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 56/115 (48%), Positives = 72/115 (62%), Gaps = 2/115 (1%)

Query: 67  LGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
           +GKPY + G  YVP     Y  +G ASWYG    G  TANGE +  + +TAAH TLPLPS
Sbjct: 38  VGKPYSVRGVTYVPAADPGYDYLGYASWYG-GESGNRTANGERFRPKAVTAAHVTLPLPS 96

Query: 127 YVRVTNMENGISLVVRVNDRGPYHS-NRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           YV VT +E G +++VRVNDRGP+    R+IDLS  AA+ L +   G + V V  +
Sbjct: 97  YVEVTALETGRTILVRVNDRGPFAGRGRIIDLSRGAAEQLGIRAVGHAPVRVRVV 151


>gi|87124921|ref|ZP_01080768.1| possible rare lipoprotein A [Synechococcus sp. RS9917]
 gi|86167241|gb|EAQ68501.1| possible rare lipoprotein A [Synechococcus sp. RS9917]
          Length = 189

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 50/91 (54%), Positives = 63/91 (69%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  F G  TA+GEV+    +TAAH TLP  + VRVTN+ NG S VVR+NDRGP+
Sbjct: 98  GEASWYGPGFFGNRTASGEVFRPGTLTAAHRTLPFGTRVRVTNLWNGRSTVVRINDRGPF 157

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           H  R+IDL++ AA  L +   GV+KV +E L
Sbjct: 158 HGARVIDLAHGAATQLGLVASGVAKVKLEVL 188


>gi|332705909|ref|ZP_08425983.1| rare lipoprotein A [Lyngbya majuscula 3L]
 gi|332355313|gb|EGJ34779.1| rare lipoprotein A [Lyngbya majuscula 3L]
          Length = 228

 Score = 99.4 bits (246), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 47/91 (51%), Positives = 62/91 (68%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG  FHGR TA+GE +    +TAAH TL   + V+VTN+ NG S++VR+NDRGPY
Sbjct: 137 GIASWYGSGFHGRRTASGERFNQYALTAAHRTLRFGTRVKVTNLRNGRSVIVRINDRGPY 196

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R+IDLS  AA+I+ +   G   V +E L
Sbjct: 197 VRGRIIDLSRGAARIIGLVRSGTGSVRIEIL 227


>gi|163782333|ref|ZP_02177331.1| rare lipoprotein A [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882366|gb|EDP75872.1| rare lipoprotein A [Hydrogenivirga sp. 128-5-R1-1]
          Length = 182

 Score = 99.4 bits (246), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 59/88 (67%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG  FHGR TANGE+Y     TAA  TLPL +YV V N ENG  + VRVNDRGPY
Sbjct: 69  GIASWYGGRFHGRKTANGEIYDLFKFTAASRTLPLGTYVLVRNEENGKVITVRVNDRGPY 128

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHV 177
              R+IDLS AAA  L +   GV+ V V
Sbjct: 129 IDGRIIDLSQAAAYKLGMMLDGVAMVQV 156


>gi|298492596|ref|YP_003722773.1| rare lipoprotein A ['Nostoc azollae' 0708]
 gi|298234514|gb|ADI65650.1| rare lipoprotein A ['Nostoc azollae' 0708]
          Length = 367

 Score = 99.4 bits (246), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 64/92 (69%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           GMASWYG  + G  TA+GE +  E +TAAH +LPL + VRV N  NG S+VVR+NDRGPY
Sbjct: 275 GMASWYGYDWSGNKTASGERFNPEAMTAAHRSLPLGTKVRVINTRNGRSVVVRINDRGPY 334

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
              R+IDLS  AA++L +   G++ V +E LG
Sbjct: 335 IGGRIIDLSAGAARLLGIIGSGIAPVRLEVLG 366


>gi|193213665|ref|YP_001999618.1| rare lipoprotein A [Chlorobaculum parvum NCIB 8327]
 gi|193087142|gb|ACF12418.1| rare lipoprotein A [Chlorobaculum parvum NCIB 8327]
          Length = 171

 Score = 99.4 bits (246), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 76/125 (60%), Gaps = 11/125 (8%)

Query: 65  YFLGK----PYQIMGRWYVP---RQYTAYAAVGMASWYGKAF----HGRLTANGEVYGTE 113
           Y LGK    PY I  + YVP    Q  AY   G+ASWYG+      + + TA GE++   
Sbjct: 43  YRLGKLKNTPYLIDNKLYVPMSFEQVYAYEETGIASWYGRETLEKNNSQPTAYGEIFDPG 102

Query: 114 YITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVS 173
             +AAH  LPLP  VRVTN++N  S++VRVNDRGP+   R+IDLS  AAK L   E+G +
Sbjct: 103 QPSAAHKYLPLPMLVRVTNLDNNRSIIVRVNDRGPFVDGRVIDLSAQAAKELGFYEKGTA 162

Query: 174 KVHVE 178
           +V +E
Sbjct: 163 RVKIE 167


>gi|242238536|ref|YP_002986717.1| lipoprotein A [Dickeya dadantii Ech703]
 gi|242130593|gb|ACS84895.1| rare lipoprotein A [Dickeya dadantii Ech703]
          Length = 388

 Score = 99.4 bits (246), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 63/98 (64%), Gaps = 2/98 (2%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           ++  G ASW  +   G  TA GE +      AAHPTLP+PSYVRVTN+ NG  LVVRVND
Sbjct: 75  FSEAGFASWQNRGSAGTRTAIGEEFNPNAFAAAHPTLPIPSYVRVTNLSNGRRLVVRVND 134

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           RGPY   R+IDL+ AAA  L +     +KV V+++ +A
Sbjct: 135 RGPYTPGRIIDLTRAAADRLNLSNN--TKVKVDFISVA 170


>gi|212704851|ref|ZP_03312979.1| hypothetical protein DESPIG_02918 [Desulfovibrio piger ATCC 29098]
 gi|212671693|gb|EEB32176.1| hypothetical protein DESPIG_02918 [Desulfovibrio piger ATCC 29098]
          Length = 194

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 71/116 (61%), Gaps = 5/116 (4%)

Query: 77  WYVPRQYTAYA-AVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMEN 135
           W    Q  A A   GMASWYG  FH + TA+GE Y     TAAH TLP+ + VRVT+  N
Sbjct: 35  WLKRAQSNADAFMTGMASWYGADFHNKKTASGEGYDMYTFTAAHRTLPIGTVVRVTDKSN 94

Query: 136 GISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL----GMALLNG 187
           G S++V V DRGPY   R+IDLS AAA+ + + +RGV KV +E +    G  L NG
Sbjct: 95  GKSVMVCVTDRGPYVRGRIIDLSYAAAQQINMNDRGVGKVDLEVVSDPSGTPLQNG 150


>gi|270160372|ref|ZP_06189023.1| rare lipoprotein A family [Legionella longbeachae D-4968]
 gi|269987125|gb|EEZ93385.1| rare lipoprotein A family [Legionella longbeachae D-4968]
          Length = 99

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 52/93 (55%), Positives = 65/93 (69%), Gaps = 2/93 (2%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           Y A G+ASWYG     + T+ GE Y    +TAAHPTLPL + VRV N+ NG S+VVR+ND
Sbjct: 7   YKAKGVASWYGAHSRHQKTSTGERYNMYAMTAAHPTLPLATRVRVKNLNNGRSIVVRIND 66

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           RGP+ SNRLIDLS AAAK L +   G++ V +E
Sbjct: 67  RGPFLSNRLIDLSFAAAKKLGIN--GIAPVEIE 97


>gi|119356062|ref|YP_910706.1| rare lipoprotein A [Chlorobium phaeobacteroides DSM 266]
 gi|119353411|gb|ABL64282.1| rare lipoprotein A [Chlorobium phaeobacteroides DSM 266]
          Length = 171

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 46/91 (50%), Positives = 62/91 (68%)

Query: 88  AVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRG 147
           A G AS+Y   FHGR TANGE +    +TAAHP+LP  ++VRV N+ NG  +VVR+NDRG
Sbjct: 69  AEGKASYYSNQFHGRRTANGETFDMNELTAAHPSLPFGTWVRVINLRNGKDVVVRINDRG 128

Query: 148 PYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           P+   R+IDLS  AAK + + + G + V +E
Sbjct: 129 PFVRGRIIDLSAGAAKRIGLFKSGTANVRIE 159


>gi|269122225|ref|YP_003310402.1| lipoprotein A [Sebaldella termitidis ATCC 33386]
 gi|268616103|gb|ACZ10471.1| rare lipoprotein A [Sebaldella termitidis ATCC 33386]
          Length = 163

 Score = 99.0 bits (245), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 48/95 (50%), Positives = 64/95 (67%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           Y   G AS+YG  +HGR TANGE++ T  +TAAH TLP  + V+VTN+ NG S+VVR+N+
Sbjct: 68  YYETGKASFYGGKWHGRKTANGEIFDTYTMTAAHKTLPFGTKVKVTNLNNGKSVVVRINN 127

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGPY   R+IDLS AA   +     GV+ V +E +
Sbjct: 128 RGPYVKGRVIDLSTAAFGAIESLNTGVTSVKLEII 162


>gi|86147000|ref|ZP_01065318.1| Rare lipoprotein A [Vibrio sp. MED222]
 gi|85835250|gb|EAQ53390.1| Rare lipoprotein A [Vibrio sp. MED222]
          Length = 150

 Score = 99.0 bits (245), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 63/94 (67%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
           ++A VG ASWYG  FHG+LTA+GE Y     TAAH TLP  + VRVTN +NG S+ V++N
Sbjct: 45  SHALVGKASWYGDKFHGKLTASGETYNMNAYTAAHKTLPFGTIVRVTNTDNGKSVDVKIN 104

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           DRGPY   R+IDLS+ A   +   ++G   V +E
Sbjct: 105 DRGPYVKGRVIDLSHKAFAQIGNVKQGTVPVKIE 138


>gi|284049880|ref|ZP_06380090.1| rare lipoprotein A [Arthrospira platensis str. Paraca]
 gi|291571611|dbj|BAI93883.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 315

 Score = 99.0 bits (245), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 49/91 (53%), Positives = 61/91 (67%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  FHG  TANGE Y  + +TAAH  LP  + VRVTN  NG S+VVR+NDRGP+
Sbjct: 221 GWASWYGPGFHGNRTANGERYNQDAMTAAHRYLPFGTEVRVTNQHNGRSVVVRINDRGPF 280

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R+IDLS  AA+ + +   GV+ V VE +
Sbjct: 281 IGGRIIDLSAGAAQAIGMISSGVAPVTVEVI 311


>gi|268315691|ref|YP_003289410.1| rare lipoprotein A [Rhodothermus marinus DSM 4252]
 gi|262333225|gb|ACY47022.1| rare lipoprotein A [Rhodothermus marinus DSM 4252]
          Length = 142

 Score = 99.0 bits (245), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 50/99 (50%), Positives = 67/99 (67%)

Query: 82  QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVV 141
           Q   Y A G AS+YG  + G+ TA+GE +  E +TAAHPTLP  + VRVTN+ NG S+VV
Sbjct: 38  QVALYVAEGRASYYGTRWAGQRTASGEAFDPEALTAAHPTLPFGARVRVTNLRNGRSVVV 97

Query: 142 RVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           R+NDRGP+   R+ID+S AAA+ L +   G   V +E+L
Sbjct: 98  RINDRGPHVPGRIIDVSYAAARALGMVRSGTVPVRIEWL 136


>gi|307727817|ref|YP_003911030.1| rare lipoprotein A [Burkholderia sp. CCGE1003]
 gi|307588342|gb|ADN61739.1| rare lipoprotein A [Burkholderia sp. CCGE1003]
          Length = 201

 Score = 99.0 bits (245), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 69/101 (68%), Gaps = 2/101 (1%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G+ASWYGK F GR TA+GE Y    +TAAH TLPL + VRVT++    S+VVR+NDRGP
Sbjct: 91  TGLASWYGKIFQGRRTASGERYDMHALTAAHRTLPLGACVRVTSLARMRSVVVRINDRGP 150

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +   R+IDLS AAA+ L V   G ++V +E++  A + G D
Sbjct: 151 FVRGRIIDLSYAAAEALGVRGAGSAQVRIEHI--APVRGAD 189


>gi|152992818|ref|YP_001358539.1| hypothetical protein SUN_1228 [Sulfurovum sp. NBC37-1]
 gi|151424679|dbj|BAF72182.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 261

 Score = 99.0 bits (245), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 72/118 (61%), Gaps = 9/118 (7%)

Query: 71  YQIMGRWYVPRQYTAYAAVG-----MASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLP 125
           Y + G+ Y P     Y  VG     ++SWYG  FHG+ T+NGE Y     TAAH T P+ 
Sbjct: 49  YTVRGKRYNP----TYVKVGQKMNGISSWYGPNFHGKYTSNGERYNMYARTAAHKTWPMD 104

Query: 126 SYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           + VRV N++NG + +VRVNDRGP+   R+ID S  A K + ++  G++KV +E +G A
Sbjct: 105 TMVRVHNLQNGKNTIVRVNDRGPFVRGRIIDCSYKAGKEIGLDRLGIAKVQIEVVGFA 162


>gi|170076972|ref|YP_001733610.1| rare lipoprotein A [Synechococcus sp. PCC 7002]
 gi|169884641|gb|ACA98354.1| possible rare lipoprotein A [Synechococcus sp. PCC 7002]
          Length = 288

 Score = 98.6 bits (244), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 47/91 (51%), Positives = 63/91 (69%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  FHGR TA+GE +    +TAAH +LP  + VRVTN+ NG S+VVR+NDRGP+
Sbjct: 197 GRASWYGPGFHGRRTASGEPFNQYAMTAAHKSLPFGTKVRVTNVRNGRSVVVRINDRGPF 256

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R+IDLS  +A+ + +   GV+ V +E L
Sbjct: 257 TPGRIIDLSKGSAQQIGLVSAGVATVKLEVL 287


>gi|302390632|ref|YP_003826453.1| rare lipoprotein A [Thermosediminibacter oceani DSM 16646]
 gi|302201260|gb|ADL08830.1| rare lipoprotein A [Thermosediminibacter oceani DSM 16646]
          Length = 157

 Score = 98.6 bits (244), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 48/89 (53%), Positives = 62/89 (69%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  FHG+ TA+G+V+  E +TAAH  LP  + V+VTN+ENG S+ V +NDRGPY
Sbjct: 67  GKASWYGPGFHGKRTASGQVFNQESLTAAHRYLPFGTRVKVTNLENGKSVAVVINDRGPY 126

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVE 178
              R IDLS  AA++L + E GV  V +E
Sbjct: 127 VKGRHIDLSKKAAEMLGMIESGVVPVMIE 155


>gi|254497011|ref|ZP_05109843.1| rare lipoprotein A [Legionella drancourtii LLAP12]
 gi|254353765|gb|EET12468.1| rare lipoprotein A [Legionella drancourtii LLAP12]
          Length = 142

 Score = 98.6 bits (244), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 66/96 (68%), Gaps = 1/96 (1%)

Query: 71  YQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y++ G+ Y P R    Y A G+AS+Y K  H   T+NGE Y    +TAAHPTLP  + +R
Sbjct: 33  YKVKGKVYTPLRSAKGYKARGLASFYSKRLHHHKTSNGERYNMYSMTAAHPTLPFNTRLR 92

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKIL 165
           V N++NG ++VVR+NDRGP++S R+IDLS AAA  L
Sbjct: 93  VKNIKNGRTVVVRINDRGPFYSMRIIDLSYAAASRL 128


>gi|33866560|ref|NP_898119.1| rare lipoprotein A [Synechococcus sp. WH 8102]
 gi|33633338|emb|CAE08543.1| possible rare lipoprotein A [Synechococcus sp. WH 8102]
          Length = 207

 Score = 98.6 bits (244), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 47/91 (51%), Positives = 63/91 (69%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  F+G  TANGE+Y    +TAAH TLP  + VRVTN+ NG S V+R+NDRGP+
Sbjct: 116 GEASWYGPGFYGNHTANGEIYRQGTMTAAHRTLPFGTKVRVTNIRNGRSAVIRINDRGPF 175

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
             +R+IDL + AA  L +   G+++V +E L
Sbjct: 176 VDHRVIDLGHGAASTLGLISSGIAQVKLEVL 206


>gi|307155362|ref|YP_003890746.1| rare lipoprotein A [Cyanothece sp. PCC 7822]
 gi|306985590|gb|ADN17471.1| rare lipoprotein A [Cyanothece sp. PCC 7822]
          Length = 348

 Score = 98.6 bits (244), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 48/91 (52%), Positives = 61/91 (67%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           GMASWYG  FHGR TANGE +    +TAAH  LP  + VRVTN+ N  S+ VR+NDRGP+
Sbjct: 254 GMASWYGPGFHGRRTANGERFNQRDLTAAHRYLPFGTLVRVTNLNNNRSVTVRINDRGPF 313

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R+IDLS  AA +L +   GV+ V +E +
Sbjct: 314 VRGRIIDLSAGAANVLGLFGSGVAPVSLEIV 344


>gi|320450631|ref|YP_004202727.1| rare lipoprotein A [Thermus scotoductus SA-01]
 gi|320150800|gb|ADW22178.1| rare lipoprotein A [Thermus scotoductus SA-01]
          Length = 165

 Score = 98.6 bits (244), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 59/82 (71%)

Query: 84  TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRV 143
           T +   G+A WYG  FHGR TA+GE Y    +TAAHP+LP  + VRVTN++NG S+VVR+
Sbjct: 68  TRFLQEGLAVWYGPGFHGRRTASGERYDMHALTAAHPSLPFGTRVRVTNLKNGKSVVVRI 127

Query: 144 NDRGPYHSNRLIDLSNAAAKIL 165
           NDRGP+    +IDLS AAAK +
Sbjct: 128 NDRGPFGGRYIIDLSYAAAKTI 149


>gi|218549791|ref|YP_002383582.1| rare lipoprotein A [Escherichia fergusonii ATCC 35469]
 gi|218357332|emb|CAQ89969.1| minor lipoprotein [Escherichia fergusonii ATCC 35469]
          Length = 382

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 82/137 (59%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE++ +  +TAAHPTLP+PSY R
Sbjct: 80  YQRDGKSYKIVQDPSRFSQAGLAAIYDTESGSNLTASGEMFDSTQLTAAHPTLPIPSYAR 139

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGP+ S+R+I LS AAA   R+     +KV V+ + +A    M 
Sbjct: 140 ITNLANGRMIVVRINDRGPFGSDRVIALSRAAAD--RLNTSNNTKVRVDPIIVAQDGSMS 197

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +     VLP
Sbjct: 198 GPGMACTTVAKQTYVLP 214


>gi|94967820|ref|YP_589868.1| rare lipoprotein A [Candidatus Koribacter versatilis Ellin345]
 gi|94549870|gb|ABF39794.1| rare lipoprotein A [Candidatus Koribacter versatilis Ellin345]
          Length = 253

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/101 (49%), Positives = 63/101 (62%)

Query: 80  PRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISL 139
           P   + +   G ASWYG  FH R  +NGEVY    +TAAH   PL S VRVTN + G S 
Sbjct: 68  PNGNSLFTQEGYASWYGPGFHNRRASNGEVYDMNAMTAAHRDFPLNSVVRVTNEQTGHSA 127

Query: 140 VVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VVR+ DRGP+  NR+IDLS AAAK + V + G + V +E +
Sbjct: 128 VVRITDRGPFVPNRIIDLSLAAAKQVDVWKSGTAMVKLEVI 168


>gi|218295054|ref|ZP_03495890.1| rare lipoprotein A [Thermus aquaticus Y51MC23]
 gi|218244257|gb|EED10782.1| rare lipoprotein A [Thermus aquaticus Y51MC23]
          Length = 163

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 58/76 (76%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+A WYG  FHG+ TA+GE+Y    +TAAHPTLP+ + VRVTN +NG S+VVR+NDRGP+
Sbjct: 73  GLAVWYGPGFHGKRTASGEIYDMHALTAAHPTLPIGTRVRVTNPKNGRSVVVRINDRGPF 132

Query: 150 HSNRLIDLSNAAAKIL 165
               +IDLS AAAK +
Sbjct: 133 GGRYIIDLSYAAAKAI 148


>gi|116075807|ref|ZP_01473066.1| possible rare lipoprotein A [Synechococcus sp. RS9916]
 gi|116067122|gb|EAU72877.1| possible rare lipoprotein A [Synechococcus sp. RS9916]
          Length = 197

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/93 (51%), Positives = 65/93 (69%)

Query: 88  AVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRG 147
           + G ASWYG  F+G  TANGEV+    +TAAH TLP  + VRVTN+ NG S VVR+NDRG
Sbjct: 104 STGEASWYGPGFYGNRTANGEVFRPGTLTAAHRTLPFGTKVRVTNLWNGRSTVVRINDRG 163

Query: 148 PYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           P+  +R+IDL++ AA  L +   G+++V +E L
Sbjct: 164 PFIGHRVIDLAHGAANKLGLVASGIAQVRLEVL 196


>gi|323530055|ref|YP_004232207.1| rare lipoprotein A [Burkholderia sp. CCGE1001]
 gi|323387057|gb|ADX59147.1| rare lipoprotein A [Burkholderia sp. CCGE1001]
          Length = 215

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/95 (51%), Positives = 65/95 (68%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           +   G ASWYGK F GR TA+GE Y    +TAAH TLPL + VRVT++    S+VVR+ND
Sbjct: 104 FQQTGFASWYGKIFQGRRTASGERYDMHALTAAHRTLPLGACVRVTSLVRTRSVVVRIND 163

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+   R+IDLS AAA+ L V   G ++V +E++
Sbjct: 164 RGPFVRGRIIDLSYAAAEALGVRRAGSAQVRLEHV 198


>gi|325498187|gb|EGC96046.1| rare lipoprotein A [Escherichia fergusonii ECD227]
          Length = 349

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 82/137 (59%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE++ +  +TAAHPTLP+PSY R
Sbjct: 47  YQRDGKSYKIVQDPSRFSQAGLAAIYDTESGSNLTASGEMFDSTQLTAAHPTLPIPSYAR 106

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGP+ S+R+I LS AAA   R+     +KV V+ + +A    M 
Sbjct: 107 ITNLANGRMIVVRINDRGPFGSDRVIALSRAAAD--RLNTSNNTKVRVDPIIVAQDGSMS 164

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +     VLP
Sbjct: 165 GPGMACTTVAKQTYVLP 181


>gi|260435716|ref|ZP_05789686.1| rare lipoprotein A [Synechococcus sp. WH 8109]
 gi|260413590|gb|EEX06886.1| rare lipoprotein A [Synechococcus sp. WH 8109]
          Length = 173

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/91 (50%), Positives = 64/91 (70%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  F+G LTANGE+Y    +TAAH +LP  + VRVTN+ NG + V+R+NDRGP+
Sbjct: 82  GEASWYGPGFYGNLTANGEIYKPGTMTAAHRSLPFGTKVRVTNLWNGRTAVIRINDRGPF 141

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
             +R+IDL + AA  L +   G+++V +E L
Sbjct: 142 IDHRVIDLGHGAASDLGLTASGIAQVMLEVL 172


>gi|288940029|ref|YP_003442269.1| rare lipoprotein A [Allochromatium vinosum DSM 180]
 gi|288895401|gb|ADC61237.1| rare lipoprotein A [Allochromatium vinosum DSM 180]
          Length = 130

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 66/91 (72%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+AS+Y  + HGR TA+G+VY    ++AAH TLPL + +RVT+   G S++VRVNDRGP+
Sbjct: 33  GIASFYHDSLHGRKTASGQVYDKRRLSAAHRTLPLGTKIRVTDTRTGRSVIVRVNDRGPF 92

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R++DLS  AAK L + +RG+++V ++ L
Sbjct: 93  AKGRIVDLSKEAAKELGIVDRGIARVDLKVL 123


>gi|158522685|ref|YP_001530555.1| rare lipoprotein A [Desulfococcus oleovorans Hxd3]
 gi|158511511|gb|ABW68478.1| rare lipoprotein A [Desulfococcus oleovorans Hxd3]
          Length = 249

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 70/114 (61%), Gaps = 6/114 (5%)

Query: 67  LGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
            GK Y+++           +   GMASWYG+ FHGR TA+GEVY     +AAH TLPL +
Sbjct: 53  FGKEYRLL------PSAAGFTEEGMASWYGEPFHGRKTASGEVYDMHKPSAAHKTLPLGT 106

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            V V N +NG SL VR+NDRGP+ + R+IDLS AAA+ L V   G + V +  L
Sbjct: 107 RVTVYNKQNGKSLEVRINDRGPFVAGRVIDLSYAAARELGVIGPGTAPVRITAL 160


>gi|307130042|ref|YP_003882058.1| minor lipoprotein [Dickeya dadantii 3937]
 gi|306527571|gb|ADM97501.1| minor lipoprotein [Dickeya dadantii 3937]
          Length = 387

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/114 (43%), Positives = 71/114 (62%), Gaps = 3/114 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + G+ Y + +    ++  G A+W+ +   G  TA GE +    + AAHPTLP+PSYVR
Sbjct: 59  YSMNGKTYRIVKNPENFSESGFAAWHDRESVGNRTATGEEFDVNAMAAAHPTLPIPSYVR 118

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VTN+ NG  LVVRVNDRGPY   R+IDL+  AA  L +     +KV V+++ +A
Sbjct: 119 VTNLSNGRRLVVRVNDRGPYTPGRIIDLTKGAADRLNLSNN--TKVKVDFISVA 170


>gi|327479575|gb|AEA82885.1| lipoprotein [Pseudomonas stutzeri DSM 4166]
          Length = 133

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 63/95 (66%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           +   G AS+Y +  HG+ TANGE +    + AAH +LP  + VRVTN +NG  +VVR+ND
Sbjct: 38  FTQSGKASYYARMHHGQRTANGETHDQNALVAAHRSLPFGTRVRVTNQQNGKQVVVRIND 97

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+   R+ID+S AAA  L + +RGV +V +E L
Sbjct: 98  RGPFRRGRIIDVSRAAAAQLDMLDRGVVRVRIETL 132


>gi|116626445|ref|YP_828601.1| rare lipoprotein A [Candidatus Solibacter usitatus Ellin6076]
 gi|116229607|gb|ABJ88316.1| rare lipoprotein A [Candidatus Solibacter usitatus Ellin6076]
          Length = 218

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 65/91 (71%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG  +HGR  ANGE+Y  E +TAAH TLP  ++VRV +++N  +  VR+ DRGP+
Sbjct: 40  GIASWYGHPYHGRAAANGEIYDMEKMTAAHRTLPFNTWVRVYDLDNNKTTEVRIIDRGPF 99

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R+IDLS+AAA+ + +   GV+KV +E +
Sbjct: 100 IDGRIIDLSHAAAREIEMIGPGVAKVRIEVI 130


>gi|271499699|ref|YP_003332724.1| rare lipoprotein A [Dickeya dadantii Ech586]
 gi|270343254|gb|ACZ76019.1| rare lipoprotein A [Dickeya dadantii Ech586]
          Length = 382

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/114 (42%), Positives = 71/114 (62%), Gaps = 3/114 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + G+ Y + +    ++  G A+W+ +   G  TA GE +    + AAHPTLP+PSYVR
Sbjct: 59  YSMNGKTYRIVKNPENFSESGFAAWHDRESVGNRTATGEEFDVNAMAAAHPTLPIPSYVR 118

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VTN+ NG  LVVR+NDRGPY   R+IDL+  AA  L +     +KV V+++ +A
Sbjct: 119 VTNLSNGRRLVVRINDRGPYTPGRIIDLTKGAADRLNLSNN--TKVKVDFINVA 170


>gi|146281397|ref|YP_001171550.1| lipoprotein [Pseudomonas stutzeri A1501]
 gi|145569602|gb|ABP78708.1| lipoprotein [Pseudomonas stutzeri A1501]
          Length = 166

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 63/95 (66%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           +   G AS+Y +  HG+ TANGE +    + AAH +LP  + VRVTN +NG  +VVR+ND
Sbjct: 71  FTQSGKASYYARMHHGQRTANGETHDQNALVAAHRSLPFGTRVRVTNQQNGKQVVVRIND 130

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+   R+ID+S AAA  L + +RGV +V +E L
Sbjct: 131 RGPFRRGRIIDVSRAAAAQLDMLDRGVVRVRIETL 165


>gi|319956684|ref|YP_004167947.1| rare lipoprotein a [Nitratifractor salsuginis DSM 16511]
 gi|319419088|gb|ADV46198.1| rare lipoprotein A [Nitratifractor salsuginis DSM 16511]
          Length = 256

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 70/120 (58%), Gaps = 9/120 (7%)

Query: 69  KPYQIMGRWYVPRQYTAYAAVG-----MASWYGKAFHGRLTANGEVYGTEYITAAHPTLP 123
           + Y + GR Y P     Y  VG     +ASWYG  FHG+ T+NGE Y    +TAAH T P
Sbjct: 45  RTYTVRGRTYHP----TYVRVGDTMSGIASWYGPNFHGKQTSNGERYNMNAMTAAHKTWP 100

Query: 124 LPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           + + VRV N  NG S VVR+NDRGP+   R+ID S AA K L ++  G + V +  +G A
Sbjct: 101 MDTMVRVENRANGRSCVVRINDRGPFVKGRVIDCSYAAGKRLGLDRTGTAPVKLTVVGFA 160


>gi|119510540|ref|ZP_01629671.1| Rare lipoprotein A [Nodularia spumigena CCY9414]
 gi|119464807|gb|EAW45713.1| Rare lipoprotein A [Nodularia spumigena CCY9414]
          Length = 368

 Score = 97.1 bits (240), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 64/92 (69%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+AS+YG+ F G+ TA GE +  E +TAAH TLP  + VRVTN  NG S+VVR+NDRGP+
Sbjct: 276 GIASFYGRGFAGKPTATGERFNPEAMTAAHRTLPFGTRVRVTNTRNGRSVVVRINDRGPF 335

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
              R+ID+S  AA+ + +   G++ V +E LG
Sbjct: 336 IRGRIIDVSTGAARAIGMINSGIAPVKIEVLG 367


>gi|218442225|ref|YP_002380554.1| lipoprotein A [Cyanothece sp. PCC 7424]
 gi|218174953|gb|ACK73686.1| rare lipoprotein A [Cyanothece sp. PCC 7424]
          Length = 324

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/91 (51%), Positives = 61/91 (67%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG  FHGR TANGE Y    +TAAH  LP  + VRVTN+ NG S+ VR+NDRGP+
Sbjct: 233 GIASWYGPGFHGRRTANGERYNQNGLTAAHRYLPFGTKVRVTNLNNGRSVTVRINDRGPF 292

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R+IDLS  AA  + +   G++ V +E +
Sbjct: 293 IGGRIIDLSAGAAGAIGMFGSGIAPVSLEII 323


>gi|84386682|ref|ZP_00989708.1| Rare lipoprotein A [Vibrio splendidus 12B01]
 gi|84378488|gb|EAP95345.1| Rare lipoprotein A [Vibrio splendidus 12B01]
          Length = 150

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/95 (53%), Positives = 64/95 (67%), Gaps = 2/95 (2%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
           ++A  G ASWYG  FHGRLTA+GE Y     TAAH TLP  + VRVTN +N  S+ V++N
Sbjct: 45  SHALAGKASWYGDKFHGRLTASGETYNMNANTAAHKTLPFGTIVRVTNTDNNKSVDVKIN 104

Query: 145 DRGPYHSNRLIDLSNAA-AKILRVEERGVSKVHVE 178
           DRGPY   R+IDLS+ A AKI  V++ G   V +E
Sbjct: 105 DRGPYVKGRVIDLSHKAFAKIGNVKQ-GTVPVKIE 138


>gi|78184924|ref|YP_377359.1| rare lipoprotein A [Synechococcus sp. CC9902]
 gi|78169218|gb|ABB26315.1| Rare lipoprotein A [Synechococcus sp. CC9902]
          Length = 162

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 65/95 (68%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           +  +G+ASWYG  F+GR TANGE++    +TAAH TLP  + VRV N+ENG S+ VR+ND
Sbjct: 67  HLGIGVASWYGPGFYGRRTANGEIFRKGTLTAAHRTLPFGTIVRVINLENGRSVNVRIND 126

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+  +R+IDL++ AA  L +   G   V +E +
Sbjct: 127 RGPFKYHRVIDLAHGAASELNMMHAGEINVRLEVI 161


>gi|324114755|gb|EGC08723.1| rare lipoprotein A double-psi beta-barrel [Escherichia fergusonii
           B253]
          Length = 362

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 81/137 (59%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE++    +TAAHPTLP+PSY R
Sbjct: 60  YQRDGKSYKIVQDPSRFSQAGLAAIYDTESGSNLTASGEMFDPTQLTAAHPTLPIPSYAR 119

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGP+ S+R+I LS AAA   R+     +KV V+ + +A    M 
Sbjct: 120 ITNLANGRMIVVRINDRGPFGSDRVIALSRAAAD--RLNTSNNTKVRVDPIIVAQDGSMS 177

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +     VLP
Sbjct: 178 GPGMACTTVAKQTYVLP 194


>gi|209524227|ref|ZP_03272777.1| rare lipoprotein A [Arthrospira maxima CS-328]
 gi|209495318|gb|EDZ95623.1| rare lipoprotein A [Arthrospira maxima CS-328]
          Length = 315

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 49/91 (53%), Positives = 60/91 (65%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  FHG  TANGE Y    +TAAH  LP  + VRVTN  NG S+VVR+NDRGP+
Sbjct: 221 GWASWYGPGFHGNRTANGERYNQYAMTAAHRYLPFGTEVRVTNQHNGRSVVVRINDRGPF 280

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R+IDLS  AA+ + +   GV+ V VE +
Sbjct: 281 IGGRIIDLSAGAAQAIGMISSGVAPVTVEVI 311


>gi|148978078|ref|ZP_01814625.1| hypothetical protein VSWAT3_02286 [Vibrionales bacterium SWAT-3]
 gi|145962762|gb|EDK28036.1| hypothetical protein VSWAT3_02286 [Vibrionales bacterium SWAT-3]
          Length = 141

 Score = 96.7 bits (239), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 51/95 (53%), Positives = 64/95 (67%), Gaps = 2/95 (2%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
           ++A  G ASWYG  FHGRLTA+GE Y     TAAH TLP  + VRVTN +N  S+ V++N
Sbjct: 36  SHALAGKASWYGDKFHGRLTASGETYNMNANTAAHKTLPFGTIVRVTNTDNNKSVDVKIN 95

Query: 145 DRGPYHSNRLIDLSNAA-AKILRVEERGVSKVHVE 178
           DRGPY   R+IDLS+ A AKI  V++ G   V +E
Sbjct: 96  DRGPYVKGRVIDLSHKAFAKIGNVKQ-GTVPVRIE 129


>gi|218710103|ref|YP_002417724.1| lipoprotein A family protein [Vibrio splendidus LGP32]
 gi|218323122|emb|CAV19299.1| Lipoprotein A family protein [Vibrio splendidus LGP32]
          Length = 150

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 51/95 (53%), Positives = 64/95 (67%), Gaps = 2/95 (2%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
           ++A VG ASWYG  FHG+LTA+GE Y     TAAH TLP  + VRVTN  N  S+ V++N
Sbjct: 45  SHALVGKASWYGDKFHGKLTASGETYNMNAYTAAHKTLPFGTIVRVTNTANNKSVEVKIN 104

Query: 145 DRGPYHSNRLIDLSNAA-AKILRVEERGVSKVHVE 178
           DRGPY   R+IDLS+ A AKI  V++ G   V +E
Sbjct: 105 DRGPYVKGRVIDLSHKAFAKIGNVKQ-GTVPVKIE 138


>gi|325983510|ref|YP_004295912.1| rare lipoprotein A [Nitrosomonas sp. AL212]
 gi|325533029|gb|ADZ27750.1| rare lipoprotein A [Nitrosomonas sp. AL212]
          Length = 167

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 59/129 (45%), Positives = 76/129 (58%), Gaps = 6/129 (4%)

Query: 53  VSGKRVPRGGGRYFLGKPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYG 111
           +S +R P     Y   KPY++ G  Y P R    Y  +G ASWYG    G  TA G  + 
Sbjct: 37  ISKQRAPNLTAPY--NKPYKVRGVTYYPLRTAVGYREIGHASWYGSES-GNRTAMGTRFV 93

Query: 112 TEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERG 171
              +TAAH TLPLPS VRVTN++NG  + V VNDRGP+   R+IDLS  AA+  ++   G
Sbjct: 94  PHGLTAAHKTLPLPSRVRVTNLKNGRHVDVLVNDRGPFTKGRIIDLSRGAAQ--KIGLHG 151

Query: 172 VSKVHVEYL 180
           V KV +E+L
Sbjct: 152 VDKVKIEHL 160


>gi|291286001|ref|YP_003502817.1| rare lipoprotein A [Denitrovibrio acetiphilus DSM 12809]
 gi|290883161|gb|ADD66861.1| rare lipoprotein A [Denitrovibrio acetiphilus DSM 12809]
          Length = 240

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 82/141 (58%), Gaps = 10/141 (7%)

Query: 55  GKRVPRGG---GRYFLGKPYQIMG-RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVY 110
           G +VP G    G  F  +PY + G  +Y  +   ++   G+ASWYG+  HG+LTA+GE Y
Sbjct: 31  GYKVPEGAVMSGAVF-DRPYTVRGITYYRLKSVKSFNQTGLASWYGRQEHGKLTASGERY 89

Query: 111 GTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEER 170
               +TAAH  LPL S V V  ME    ++V +NDRGP+   R+IDLS   A  L + ++
Sbjct: 90  NMYAMTAAHKQLPLGSKVLVRCMETNREVIVTINDRGPHVPGRVIDLSYTGAAKLGIVDK 149

Query: 171 GVSKVHVEYLGMALLNGMDQE 191
           G++KV +E     LLNG + E
Sbjct: 150 GLTKVTLE-----LLNGEETE 165


>gi|17230427|ref|NP_486975.1| hypothetical protein alr2935 [Nostoc sp. PCC 7120]
 gi|20139491|sp|Q8YSZ4|RLPA_ANASP RecName: Full=RlpA-like protein
 gi|17132029|dbj|BAB74634.1| alr2935 [Nostoc sp. PCC 7120]
          Length = 371

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 65/94 (69%), Gaps = 2/94 (2%)

Query: 90  GMASWYGKA--FHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRG 147
           G+AS+YG+   F GR TA GE +  E +TAAH +LP  + VRVTN  NG S+VVR+NDRG
Sbjct: 277 GIASFYGRGDGFAGRPTATGERFNPEAMTAAHRSLPFGTRVRVTNTRNGRSVVVRINDRG 336

Query: 148 PYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           P+   R+IDLS  AA++L +   GV+ V +E LG
Sbjct: 337 PFTRGRVIDLSTGAARVLGMIGSGVAPVRIEVLG 370


>gi|116072607|ref|ZP_01469873.1| Rare lipoprotein A [Synechococcus sp. BL107]
 gi|116064494|gb|EAU70254.1| Rare lipoprotein A [Synechococcus sp. BL107]
          Length = 195

 Score = 96.3 bits (238), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 48/91 (52%), Positives = 62/91 (68%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  F G  TANGEVY    +TAAH TLP  + VRVTN+ NG S V+R+NDRGP+
Sbjct: 104 GEASWYGPGFFGNRTANGEVYQRGTMTAAHRTLPFGTKVRVTNLWNGRSEVIRINDRGPF 163

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
             +R+IDL + AA  L +   G+++V +E L
Sbjct: 164 VHHRVIDLGHGAASSLGLTASGIAQVRLEVL 194


>gi|148238809|ref|YP_001224196.1| rare lipoprotein A [Synechococcus sp. WH 7803]
 gi|147847348|emb|CAK22899.1| Rare lipoprotein A [Synechococcus sp. WH 7803]
          Length = 183

 Score = 96.3 bits (238), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 48/91 (52%), Positives = 63/91 (69%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  F+G  TANGEV+    +TAAH TLP  + VRVTN+ NG   VVR+NDRGP+
Sbjct: 92  GEASWYGPGFYGNRTANGEVFRRGTMTAAHRTLPFGTKVRVTNLWNGRRAVVRINDRGPF 151

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
             +R+IDL + AA+ L +   GV++V +E L
Sbjct: 152 IGHRVIDLGHGAAQELGLTSSGVAQVKLEVL 182


>gi|78185481|ref|YP_377916.1| rare lipoprotein A [Synechococcus sp. CC9902]
 gi|78169775|gb|ABB26872.1| Rare lipoprotein A [Synechococcus sp. CC9902]
          Length = 196

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 48/91 (52%), Positives = 62/91 (68%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  F G  TANGEVY    +TAAH TLP  + VRVTN+ NG S V+R+NDRGP+
Sbjct: 105 GEASWYGPGFFGNRTANGEVYQRGTMTAAHRTLPFGTKVRVTNLWNGRSEVIRINDRGPF 164

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
             +R+IDL + AA  L +   G+++V +E L
Sbjct: 165 VHHRVIDLGHGAASSLGLTASGIAQVRLEVL 195


>gi|296535554|ref|ZP_06897735.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
 gi|296264070|gb|EFH10514.1| conserved hypothetical protein [Roseomonas cervicalis ATCC 49957]
          Length = 169

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 51/120 (42%), Positives = 70/120 (58%)

Query: 64  RYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLP 123
           RY LG+PY + G W  PR+  A    G+A+       GR T NGE++    + AAH TL 
Sbjct: 30  RYMLGEPYAMGGVWSYPREDFALQETGLAAVIADPRAGRRTTNGEIWDPAALVAAHRTLQ 89

Query: 124 LPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           LP+ + VTN+ENG  L VRVNDRGP    R++ LS  AA++L V   G +++ +   G A
Sbjct: 90  LPAILLVTNLENGRQLRVRVNDRGPAQPGRVLGLSRRAAELLGVPAAGGTQLAIAVDGEA 149


>gi|332975651|gb|EGK12540.1| rare lipoprotein A [Psychrobacter sp. 1501(2011)]
          Length = 114

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 68/111 (61%), Gaps = 7/111 (6%)

Query: 70  PYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           P+ +M    +    T  A  GMASWYG  FHG+ TA+G +Y    +TAAH +LP  S V+
Sbjct: 7   PFTLM----LATMLTVPANAGMASWYGPGFHGKKTASGAIYNMYAMTAAHKSLPFGSKVK 62

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VTN+ N  S+VV++NDRGP+   R+IDLS  A +++      + KV VE L
Sbjct: 63  VTNLNNNKSVVVKINDRGPFKPGRIIDLSKKANQMISCN---LCKVDVEVL 110


>gi|303326543|ref|ZP_07356986.1| rare lipoprotein A family protein [Desulfovibrio sp. 3_1_syn3]
 gi|302864459|gb|EFL87390.1| rare lipoprotein A family protein [Desulfovibrio sp. 3_1_syn3]
          Length = 261

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 63/92 (68%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWYG+ FHG  TA+G  Y     TAAH TLP+ + V+VT+ +NG S++V V DRGP
Sbjct: 112 TGKASWYGRDFHGGSTASGVDYDMYTFTAAHRTLPIGTVVKVTDQDNGKSVMVCVTDRGP 171

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           Y   R+IDLS AAAK L + +RGV KV +E +
Sbjct: 172 YVRGRIIDLSYAAAKQLDLSKRGVGKVDLEVV 203


>gi|42527535|ref|NP_972633.1| RlpA family lipoprotein [Treponema denticola ATCC 35405]
 gi|41818120|gb|AAS12544.1| lipoprotein, RlpA family [Treponema denticola ATCC 35405]
          Length = 261

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 61/86 (70%)

Query: 92  ASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHS 151
           AS+YG+AF+GR TANGE++     TAAH TLP  + V VTN+ENG  ++VR+NDRGP+  
Sbjct: 31  ASYYGEAFNGRPTANGEIFDMNAYTAAHKTLPFGTLVEVTNLENGRKVIVRINDRGPFVG 90

Query: 152 NRLIDLSNAAAKILRVEERGVSKVHV 177
           NR ID+S AAA  L +   GV +V +
Sbjct: 91  NREIDVSKAAAAALDMLSYGVVRVSL 116


>gi|251790546|ref|YP_003005267.1| rare lipoprotein A [Dickeya zeae Ech1591]
 gi|247539167|gb|ACT07788.1| rare lipoprotein A [Dickeya zeae Ech1591]
          Length = 381

 Score = 95.9 bits (237), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 71/114 (62%), Gaps = 3/114 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + G+ Y + +    ++  G A+W+ +   G  TA GE +    + AAHPTLP+PSYVR
Sbjct: 59  YSMNGKSYRIVKNPENFSESGFAAWHDRKSVGNRTATGEEFDANAMAAAHPTLPIPSYVR 118

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VTN+ NG  +VVR+NDRGPY   R+IDL+  AA  L +     +KV V+++ +A
Sbjct: 119 VTNLSNGRRVVVRINDRGPYTPGRIIDLTKGAADRLNLSNN--TKVKVDFINVA 170


>gi|307719189|ref|YP_003874721.1| hypothetical protein STHERM_c15080 [Spirochaeta thermophila DSM
           6192]
 gi|306532914|gb|ADN02448.1| hypothetical protein STHERM_c15080 [Spirochaeta thermophila DSM
           6192]
          Length = 202

 Score = 95.9 bits (237), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 73/129 (56%), Gaps = 4/129 (3%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG  F G+ TA+GEVY  E +TAAH +LP  + VRV   E G ++VVR+ DRGP+
Sbjct: 31  GVASWYGPGFAGKATASGEVYDPEEMTAAHRSLPFGALVRVWCRETGHAVVVRITDRGPF 90

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLG-MALLNGMDQE---YLRSTVMVNSATVL 205
              R+IDLS  AA++L   E G + V VE L       G + E   YL+       A  L
Sbjct: 91  VEGRVIDLSRRAAEMLGFLEEGTAHVKVELLARQGFPQGGEGERPVYLQVGAFRKEANAL 150

Query: 206 PLGCQYREE 214
            LG +   E
Sbjct: 151 RLGVRLARE 159


>gi|94313213|ref|YP_586422.1| rare lipoprotein A [Cupriavidus metallidurans CH34]
 gi|93357065|gb|ABF11153.1| rare lipoprotein A [Cupriavidus metallidurans CH34]
 gi|222834253|gb|EEE72730.1| predicted protein [Populus trichocarpa]
          Length = 94

 Score = 95.9 bits (237), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 48/89 (53%), Positives = 62/89 (69%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWY   F G LTANGE Y +  +TAAH TLPL S+VRV ++  G S+VVR+NDRGPY
Sbjct: 5   GEASWYSATFQGHLTANGERYDSSALTAAHRTLPLGSHVRVRSLATGKSVVVRINDRGPY 64

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVE 178
            + R+IDLS AAA+ L + +    +V +E
Sbjct: 65  VNGRIIDLSYAAAEALGLPDARSMRVEIE 93


>gi|325474505|gb|EGC77692.1| RlpA family Lipoprotein [Treponema denticola F0402]
          Length = 261

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 61/86 (70%)

Query: 92  ASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHS 151
           AS+YG+AF+GR TANGE++     TAAH TLP  + V VTN+ENG  ++VR+NDRGP+  
Sbjct: 31  ASYYGEAFNGRPTANGEIFDMNAYTAAHKTLPFGTLVEVTNLENGRKVIVRINDRGPFVG 90

Query: 152 NRLIDLSNAAAKILRVEERGVSKVHV 177
           NR ID+S AAA  L +   GV +V +
Sbjct: 91  NREIDVSKAAAAALDMLSYGVVRVSL 116


>gi|220903790|ref|YP_002479102.1| rare lipoprotein A [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219868089|gb|ACL48424.1| rare lipoprotein A [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 266

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 50/103 (48%), Positives = 66/103 (64%)

Query: 78  YVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGI 137
           ++ R   +    G ASWYG+ FHG  TA+G  Y     TAAH TLP+ + VRVT+ ENG 
Sbjct: 106 WLKRAQQSEVFTGKASWYGRDFHGGATASGLNYDMYTFTAAHRTLPMGTVVRVTDQENGK 165

Query: 138 SLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           S++V V DRGP+   R+IDLS AAA+ L +  RGV KV +E +
Sbjct: 166 SVMVCVTDRGPFVRGRIIDLSFAAAQQLDLGTRGVGKVELEVV 208


>gi|255292030|dbj|BAH90513.1| rare lipoprotein A [uncultured bacterium]
 gi|255292931|dbj|BAH90029.1| rare lipoprotein A [uncultured bacterium]
 gi|255293201|dbj|BAH90291.1| rare lipoprotein A [uncultured bacterium]
          Length = 222

 Score = 95.5 bits (236), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 47/86 (54%), Positives = 56/86 (65%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG  FHGR TANGE +    +TAAH TLP  + V V N   G  +VVR+NDRGP+
Sbjct: 116 GIASWYGPGFHGRTTANGERFDMHELTAAHKTLPFGTRVLVHNPRTGKQVVVRINDRGPF 175

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKV 175
              R+IDLS AAAK L  + RG   V
Sbjct: 176 IKGRVIDLSKAAAKALGFKSRGHDTV 201


>gi|78187862|ref|YP_375905.1| rare lipoprotein A [Chlorobium luteolum DSM 273]
 gi|78167764|gb|ABB24862.1| Rare lipoprotein A [Chlorobium luteolum DSM 273]
          Length = 139

 Score = 95.5 bits (236), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 47/101 (46%), Positives = 66/101 (65%)

Query: 80  PRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISL 139
           P+   A+   G AS+Y   F+GR TA+GE +    +TAAH TLP  + VRVTN+ NG  +
Sbjct: 38  PQPSAAFVDEGRASYYALRFNGRRTASGEKHDGAELTAAHRTLPFGTSVRVTNLRNGKQV 97

Query: 140 VVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VVR+NDRGP+   R+ID+S AAA+ + +   G +KV +E L
Sbjct: 98  VVRINDRGPFRKGRIIDISPAAAREIGLIRSGTAKVRIETL 138


>gi|51245842|ref|YP_065726.1| hypothetical protein DP1990 [Desulfotalea psychrophila LSv54]
 gi|50876879|emb|CAG36719.1| hypothetical protein DP1990 [Desulfotalea psychrophila LSv54]
          Length = 241

 Score = 95.5 bits (236), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 73/111 (65%), Gaps = 1/111 (0%)

Query: 69  KPYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY +    Y P   +A ++  G+ASWYG  F GRLT+NGE Y    +TAAH TLP+ + 
Sbjct: 30  RPYIVKHVKYYPLPTSAGFSQWGVASWYGGKFQGRLTSNGERYDMFSMTAAHKTLPMQTV 89

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           + VTN++N   ++VRVNDRGP+   R+IDLS  A++ L + E G++ V ++
Sbjct: 90  LVVTNLKNSRRVLVRVNDRGPFIRGRIIDLSYEASRRLGMSEDGIANVLIQ 140


>gi|309700871|emb|CBJ00168.1| rare lipoprotein A [Escherichia coli ETEC H10407]
          Length = 362

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 80/137 (58%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +AL   + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVALDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|255292891|dbj|BAH89991.1| rare lipoprotein A [uncultured bacterium]
          Length = 263

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 47/86 (54%), Positives = 56/86 (65%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG  FHGR TANGE +    +TAAH TLP  + V V N   G  +VVR+NDRGP+
Sbjct: 157 GIASWYGPGFHGRTTANGERFDMHELTAAHKTLPFGTRVLVHNPRTGKQVVVRINDRGPF 216

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKV 175
              R+IDLS AAAK L  + RG   V
Sbjct: 217 IKGRVIDLSKAAAKALGFKSRGHDTV 242


>gi|149910118|ref|ZP_01898765.1| Lipoprotein A family protein [Moritella sp. PE36]
 gi|149806843|gb|EDM66805.1| Lipoprotein A family protein [Moritella sp. PE36]
          Length = 143

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 61/96 (63%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
           ++  VG ASWYGK FHG+LTA+GE Y     TAAH TLP  + VRV N  N  S+ V++N
Sbjct: 38  SHDLVGQASWYGKRFHGKLTASGETYNMRAYTAAHKTLPFGTVVRVINTANSKSVDVKIN 97

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGP+   R+IDLS  A + +    +GV  V +E L
Sbjct: 98  DRGPFVRGRVIDLSQKAFEQIGNTNQGVVPVRIEIL 133


>gi|207722179|ref|YP_002252616.1| hypothetical protein (partial sequence n terminus)) [Ralstonia
           solanacearum MolK2]
 gi|206587354|emb|CAQ17937.1| hypothetical protein (partial sequence n terminus)) [Ralstonia
           solanacearum MolK2]
          Length = 336

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 59/88 (67%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG+ FHGR TA+GE +     T AHP+LPL S+V V N+ N   +V +V DRGPY
Sbjct: 98  GLASWYGRGFHGRRTASGERFDMNAFTVAHPSLPLSSWVLVRNLSNDRVVVAKVTDRGPY 157

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHV 177
           H  R++DLS AAAK L     G ++V +
Sbjct: 158 HGKRIMDLSYAAAKRLDFVRGGSTQVEI 185


>gi|170693765|ref|ZP_02884922.1| rare lipoprotein A [Burkholderia graminis C4D1M]
 gi|170141183|gb|EDT09354.1| rare lipoprotein A [Burkholderia graminis C4D1M]
          Length = 234

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 67/104 (64%), Gaps = 2/104 (1%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           +   G ASWYGK F GR TA+GE Y    +TAAH TLPL + VRVT      S+VVR+ND
Sbjct: 123 FQQTGFASWYGKLFDGRRTASGERYNMHALTAAHRTLPLGACVRVTAHGRPRSVVVRIND 182

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           RGP+   R+IDLS AAA+ L V   G ++V +E++  A + G D
Sbjct: 183 RGPFARGRIIDLSYAAAEALGVRAAGHAQVTLEHI--APVRGAD 224


>gi|53729244|ref|ZP_00133774.2| COG0797: Lipoproteins [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
 gi|126209061|ref|YP_001054286.1| rare lipoprotein A RlpA-like protein [Actinobacillus
           pleuropneumoniae L20]
 gi|126097853|gb|ABN74681.1| possible rare lipoprotein A RlpA-like protein [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
          Length = 187

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/91 (51%), Positives = 60/91 (65%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+AS+Y   F+GR TANGE +    +TAAH TLP  + V VTN  NG S+VVRVNDRGPY
Sbjct: 84  GVASYYADKFNGRRTANGERFSNSAMTAAHKTLPFGTLVEVTNTRNGRSVVVRVNDRGPY 143

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R++DLS AAA+ L +   G + V +  L
Sbjct: 144 AHARVVDLSKAAARQLGMYSSGTAHVKLAVL 174


>gi|165977033|ref|YP_001652626.1| rare lipoprotein A [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
 gi|303253459|ref|ZP_07339601.1| rare lipoprotein A [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
 gi|165877134|gb|ABY70182.1| possible rare lipoprotein A [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|302647703|gb|EFL77917.1| rare lipoprotein A [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
          Length = 187

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/91 (51%), Positives = 60/91 (65%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+AS+Y   F+GR TANGE +    +TAAH TLP  + V VTN  NG S+VVRVNDRGPY
Sbjct: 84  GVASYYADKFNGRRTANGERFSNSAMTAAHKTLPFGTLVEVTNTRNGRSVVVRVNDRGPY 143

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R++DLS AAA+ L +   G + V +  L
Sbjct: 144 AHARVVDLSKAAARQLGMYSSGTAHVKLAVL 174


>gi|242278183|ref|YP_002990312.1| rare lipoprotein A [Desulfovibrio salexigens DSM 2638]
 gi|242121077|gb|ACS78773.1| rare lipoprotein A [Desulfovibrio salexigens DSM 2638]
          Length = 240

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/93 (51%), Positives = 62/93 (66%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           Y   GMASWYG+ F G+LTA+GE Y  E +TAAH  LPL   V VTN+ N   + V +ND
Sbjct: 44  YKEEGMASWYGEKFQGKLTASGEPYDMERMTAAHNYLPLGVKVNVTNLSNKKKVAVIIND 103

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           RGP+  +R+IDLS AAA+ L   + G +KV +E
Sbjct: 104 RGPFVPDRIIDLSRAAAQKLGFIDAGKAKVLIE 136


>gi|307250876|ref|ZP_07532804.1| Possible rare lipoprotein A RlpA-like protein [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306857126|gb|EFM89254.1| Possible rare lipoprotein A RlpA-like protein [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
          Length = 168

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/97 (51%), Positives = 65/97 (67%), Gaps = 5/97 (5%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+AS+Y   F+GR TANGE +    +TAAH TLP  + V VTN  NG S+VVRVNDRGPY
Sbjct: 65  GVASYYADKFNGRRTANGERFSNSAMTAAHKTLPFGTLVEVTNTRNGRSVVVRVNDRGPY 124

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLN 186
              R++DLS AAA+ L +   G +  HV+   +A+LN
Sbjct: 125 AHARVVDLSKAAARQLGMYSSGTA--HVK---LAVLN 156


>gi|190150928|ref|YP_001969453.1| lipoprotein A RlpA-like protein [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303250837|ref|ZP_07337031.1| rare lipoprotein A [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|189916059|gb|ACE62311.1| possible rare lipoprotein A RlpA-like protein [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|302650350|gb|EFL80512.1| rare lipoprotein A [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
          Length = 187

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/91 (51%), Positives = 60/91 (65%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+AS+Y   F+GR TANGE +    +TAAH TLP  + V VTN  NG S+VVRVNDRGPY
Sbjct: 84  GVASYYADKFNGRRTANGERFSNSAMTAAHKTLPFGTLVEVTNTRNGRSVVVRVNDRGPY 143

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R++DLS AAA+ L +   G + V +  L
Sbjct: 144 AHARVVDLSKAAARQLGMYSSGTAHVKLAVL 174


>gi|114704743|ref|ZP_01437651.1| rare lipoprotein A [Fulvimarina pelagi HTCC2506]
 gi|114539528|gb|EAU42648.1| rare lipoprotein A [Fulvimarina pelagi HTCC2506]
          Length = 126

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/87 (50%), Positives = 58/87 (66%)

Query: 94  WYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNR 153
           +YGK FHGR TANGE +    +TAAH TLP  + V+VTN  NG S+VVR+NDRGP+   R
Sbjct: 40  YYGKRFHGRTTANGETFNMNAMTAAHKTLPFGTKVKVTNRNNGKSVVVRINDRGPFVGGR 99

Query: 154 LIDLSNAAAKILRVEERGVSKVHVEYL 180
           +IDLS  AA  + +   G + V ++ L
Sbjct: 100 VIDLSRGAAAKIGMINSGTADVSIDIL 126


>gi|118580737|ref|YP_901987.1| rare lipoprotein A [Pelobacter propionicus DSM 2379]
 gi|118503447|gb|ABK99929.1| rare lipoprotein A [Pelobacter propionicus DSM 2379]
          Length = 255

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 52/119 (43%), Positives = 71/119 (59%), Gaps = 1/119 (0%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY I G  Y P   +  +   G AS YG  FHGR T++GE +    +TAAH TLPL  Y
Sbjct: 45  RPYSINGIRYEPLASHKGFQQEGTASSYGADFHGRATSSGEPFDMNAMTAAHKTLPLGVY 104

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLN 186
           VRV +  +   + VR+NDRGP+  +R+IDLS AAA+ L +   G++ V V  LG   L+
Sbjct: 105 VRVRHKRSNREVEVRINDRGPFVGDRIIDLSEAAAEKLGMLREGLAPVRVTALGYRSLD 163


>gi|22297876|ref|NP_681123.1| hypothetical protein tlr0333 [Thermosynechococcus elongatus BP-1]
 gi|22294054|dbj|BAC07885.1| tlr0333 [Thermosynechococcus elongatus BP-1]
          Length = 311

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/91 (50%), Positives = 60/91 (65%), Gaps = 5/91 (5%)

Query: 68  GKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           G P +++    +  Q+T     G+ASWYG  FHG  TANGE +  + +TAAH TLP    
Sbjct: 203 GSPNRVVAMGPIRMQFT-----GLASWYGPGFHGARTANGERFDQDALTAAHRTLPFGKR 257

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLS 158
           VRVTN++NG S+VVR+NDRGP+   R IDLS
Sbjct: 258 VRVTNLQNGRSVVVRINDRGPFTGGREIDLS 288


>gi|310820546|ref|YP_003952904.1| lipoprotein, RlpA family [Stigmatella aurantiaca DW4/3-1]
 gi|309393618|gb|ADO71077.1| lipoprotein, RlpA family [Stigmatella aurantiaca DW4/3-1]
          Length = 152

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/92 (48%), Positives = 63/92 (68%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           Y   G+AS+YG   HGR TA+GE +  E +TAAH T    + +RV NMENG S+ VRVND
Sbjct: 41  YLGEGLASFYGPGLHGRKTASGERFDQEALTAAHRTARFGTCMRVVNMENGRSVKVRVND 100

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           RGP+   R+ID+S  AA+ L + E+G+++V +
Sbjct: 101 RGPFKQGRIIDVSQGAARKLGMLEKGLARVRL 132


>gi|88807844|ref|ZP_01123355.1| rare lipoprotein A [Synechococcus sp. WH 7805]
 gi|88787883|gb|EAR19039.1| rare lipoprotein A [Synechococcus sp. WH 7805]
          Length = 226

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/91 (51%), Positives = 63/91 (69%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  F+G  TA+GEV+    +TAAH +LP  + VRVTN+ NG   VVR+NDRGP+
Sbjct: 135 GEASWYGPGFYGNRTASGEVFRPGTMTAAHRSLPFGTKVRVTNLWNGRKAVVRINDRGPF 194

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
             +R+IDL + AAK L +   GV++V +E L
Sbjct: 195 VGHRVIDLGHGAAKQLGLTSSGVAQVKLEVL 225


>gi|307246519|ref|ZP_07528591.1| Possible rare lipoprotein A RlpA-like protein [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307253260|ref|ZP_07535134.1| Possible rare lipoprotein A RlpA-like protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307255505|ref|ZP_07537311.1| Possible rare lipoprotein A RlpA-like protein [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307259956|ref|ZP_07541669.1| Possible rare lipoprotein A RlpA-like protein [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307262082|ref|ZP_07543736.1| Possible rare lipoprotein A RlpA-like protein [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|307264282|ref|ZP_07545871.1| Possible rare lipoprotein A RlpA-like protein [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|306852582|gb|EFM84815.1| Possible rare lipoprotein A RlpA-like protein [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306859247|gb|EFM91286.1| Possible rare lipoprotein A RlpA-like protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306861547|gb|EFM93535.1| Possible rare lipoprotein A RlpA-like protein [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306865984|gb|EFM97859.1| Possible rare lipoprotein A RlpA-like protein [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306868261|gb|EFN00084.1| Possible rare lipoprotein A RlpA-like protein [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306870346|gb|EFN02101.1| Possible rare lipoprotein A RlpA-like protein [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 168

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/97 (51%), Positives = 65/97 (67%), Gaps = 5/97 (5%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+AS+Y   F+GR TANGE +    +TAAH TLP  + V VTN  NG S+VVRVNDRGPY
Sbjct: 65  GVASYYADKFNGRRTANGERFSNSAMTAAHKTLPFGTLVEVTNTRNGRSVVVRVNDRGPY 124

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLN 186
              R++DLS AAA+ L +   G +  HV+   +A+LN
Sbjct: 125 AHARVVDLSKAAARQLGMYSSGTA--HVK---LAVLN 156


>gi|307248644|ref|ZP_07530658.1| Possible rare lipoprotein A RlpA-like protein [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|307257675|ref|ZP_07539434.1| Possible rare lipoprotein A RlpA-like protein [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306854855|gb|EFM87044.1| Possible rare lipoprotein A RlpA-like protein [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|306863850|gb|EFM95774.1| Possible rare lipoprotein A RlpA-like protein [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
          Length = 168

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/97 (51%), Positives = 65/97 (67%), Gaps = 5/97 (5%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+AS+Y   F+GR TANGE +    +TAAH TLP  + V VTN  NG S+VVRVNDRGPY
Sbjct: 65  GVASYYADKFNGRRTANGERFSNSAMTAAHKTLPFGTLVEVTNTRNGRSVVVRVNDRGPY 124

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLN 186
              R++DLS AAA+ L +   G +  HV+   +A+LN
Sbjct: 125 AHARVVDLSKAAARQLGMYSSGTA--HVK---LAVLN 156


>gi|187919693|ref|YP_001888724.1| rare lipoprotein A [Burkholderia phytofirmans PsJN]
 gi|187718131|gb|ACD19354.1| rare lipoprotein A [Burkholderia phytofirmans PsJN]
          Length = 227

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 63/95 (66%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            GMA+WYGK F GR TA+GE Y    +TAAH T PL + VRVT +    S++VR+NDRGP
Sbjct: 125 TGMATWYGKPFQGRRTASGERYDMHALTAAHRTFPLGACVRVTVLNGARSVIVRINDRGP 184

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           +   R+IDLS AAA+ L +   G ++V +E +  A
Sbjct: 185 FVRGRIIDLSYAAAQALGLVSTGNAQVMLERVATA 219


>gi|78211967|ref|YP_380746.1| rare lipoprotein A [Synechococcus sp. CC9605]
 gi|78196426|gb|ABB34191.1| rare lipoprotein A [Synechococcus sp. CC9605]
          Length = 179

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/91 (50%), Positives = 62/91 (68%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  F+G  TANGEVY    +TAAH  LP  + VRVTN+ NG + V+R+NDRGP+
Sbjct: 88  GEASWYGPGFYGNRTANGEVYRRGTMTAAHRALPFGTKVRVTNLWNGRTAVIRINDRGPF 147

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
             +R+IDL + AA  L +   G+++V +E L
Sbjct: 148 IDHRVIDLGHGAASDLGLTASGIAQVKLEVL 178


>gi|193214295|ref|YP_001995494.1| rare lipoprotein A [Chloroherpeton thalassium ATCC 35110]
 gi|193087772|gb|ACF13047.1| rare lipoprotein A [Chloroherpeton thalassium ATCC 35110]
          Length = 193

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/91 (51%), Positives = 62/91 (68%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+Y   FHG+ TA+GE Y     TAAH TLP  + +RVTN+EN  S+VVRV DRGP+
Sbjct: 102 GEASYYANKFHGKTTASGEPYDMYSFTAAHRTLPFGTVLRVTNLENQKSVVVRVTDRGPW 161

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            ++R+IDLS  AAK L +   G ++V +E L
Sbjct: 162 KAHRIIDLSFMAAKSLDMLGSGTAQVRIEKL 192


>gi|186686503|ref|YP_001869699.1| lipoprotein A [Nostoc punctiforme PCC 73102]
 gi|186468955|gb|ACC84756.1| rare lipoprotein A [Nostoc punctiforme PCC 73102]
          Length = 368

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 64/92 (69%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           GMAS+YG    G  TA+G+ +  E +TAAH +LP  + VRVTN  NG S+V+R+NDRGPY
Sbjct: 276 GMASFYGYDGSGTQTASGQRFNPEAMTAAHRSLPFGTQVRVTNTRNGRSVVLRINDRGPY 335

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
              R+ID+S  AA++L +   GV+ VH+E LG
Sbjct: 336 IRGRVIDVSAGAARVLGMMGSGVAPVHIEVLG 367


>gi|113954712|ref|YP_729709.1| lipoprotein A [Synechococcus sp. CC9311]
 gi|113882063|gb|ABI47021.1| possible rare lipoprotein A [Synechococcus sp. CC9311]
          Length = 169

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 63/93 (67%)

Query: 88  AVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRG 147
           + G ASWYG  F G  TANGEV+    +TAAH TLP  + V+VTN+ NG   +VR+NDRG
Sbjct: 76  STGEASWYGPGFFGNRTANGEVFRPGTMTAAHRTLPFGTKVKVTNLRNGKETIVRINDRG 135

Query: 148 PYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           P+  +R+ID+++ AA  L +   G+++V +E L
Sbjct: 136 PFSGHRVIDIAHGAAHHLGLVSSGIAQVRLEVL 168


>gi|15606566|ref|NP_213946.1| rare lipoprotein A [Aquifex aeolicus VF5]
 gi|2983784|gb|AAC07342.1| rare lipoprotein A [Aquifex aeolicus VF5]
          Length = 171

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 60/89 (67%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
           VG ASWYG  FH R TANGE +    +TAA  T  L +YV V N+ENG   VVR+NDRGP
Sbjct: 57  VGYASWYGPKFHYRKTANGERFNMFKLTAASRTFSLGTYVLVYNLENGKFTVVRINDRGP 116

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           Y   R+IDLS AAA  + + ++GV+KV V
Sbjct: 117 YVDGRIIDLSMAAADEIGMLKKGVAKVLV 145


>gi|225874409|ref|YP_002755868.1| rare lipoprotein A family protein [Acidobacterium capsulatum ATCC
           51196]
 gi|225792191|gb|ACO32281.1| rare lipoprotein A family protein [Acidobacterium capsulatum ATCC
           51196]
          Length = 259

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/101 (46%), Positives = 65/101 (64%)

Query: 78  YVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGI 137
           YV      Y  +GMASWYG  ++    A+G+VY  + I+AAH TLPL S ++VTNM  G 
Sbjct: 73  YVQTHRPLYYQIGMASWYGPQYNHHRAADGQVYDQDSISAAHRTLPLGSIIKVTNMSTGQ 132

Query: 138 SLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           + V+RV DRGP+   R++DLS AAAK + +   GV KV ++
Sbjct: 133 TSVMRVTDRGPFVPGRILDLSEAAAKQVGIWREGVGKVRID 173


>gi|319956880|ref|YP_004168143.1| rare lipoprotein a [Nitratifractor salsuginis DSM 16511]
 gi|319419284|gb|ADV46394.1| rare lipoprotein A [Nitratifractor salsuginis DSM 16511]
          Length = 125

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 67/102 (65%)

Query: 80  PRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISL 139
           PR       VG+AS YG  + GR TA+GE++  + +TAAH TLP  + VRVT +  G S+
Sbjct: 23  PRPKARRFYVGLASHYGPEWEGRRTASGEIFHNKAMTAAHKTLPFGTRVRVTLLSTGKSV 82

Query: 140 VVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
            VR+NDRGP+   R+IDLS+ AA+ + +  RGV+ V +E LG
Sbjct: 83  TVRINDRGPFVKGRIIDLSDEAARRIGMGSRGVAPVRLEVLG 124


>gi|58038913|ref|YP_190877.1| rare lipoprotein A [Gluconobacter oxydans 621H]
 gi|58001327|gb|AAW60221.1| Rare lipoprotein A [Gluconobacter oxydans 621H]
          Length = 235

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 67/98 (68%), Gaps = 3/98 (3%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
           A++  GMASWYG+ FHGR TA+G  + T  +TAAHP+LPL + + VT+ + G S+VV VN
Sbjct: 88  AWSQHGMASWYGRHFHGRRTASGTTFNTNDLTAAHPSLPLGTKLLVTSQDTGRSVVVTVN 147

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
           DRGP++S R+IDLS+AAA   ++   G    HV    M
Sbjct: 148 DRGPFNS-RIIDLSHAAAA--KIGMLGAGTAHVTIAKM 182


>gi|320107153|ref|YP_004182743.1| rare lipoprotein A [Terriglobus saanensis SP1PR4]
 gi|319925674|gb|ADV82749.1| rare lipoprotein A [Terriglobus saanensis SP1PR4]
          Length = 191

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 64/92 (69%), Gaps = 2/92 (2%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
           A VG ASWYG+   G LTANGE +    +T AH TLPL S +RVTN+ N  +++VRVNDR
Sbjct: 68  AEVGKASWYGEELQGHLTANGERFDMNTLTCAHRTLPLGSLLRVTNLRNHRAVLVRVNDR 127

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           GP   +RL+DLS AAA+  R+   G+++V +E
Sbjct: 128 GPVPEDRLLDLSRAAAQ--RIGLGGLARVRIE 157


>gi|320109004|ref|YP_004184594.1| rare lipoprotein A [Terriglobus saanensis SP1PR4]
 gi|319927525|gb|ADV84600.1| rare lipoprotein A [Terriglobus saanensis SP1PR4]
          Length = 273

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 64/104 (61%)

Query: 78  YVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGI 137
           +V     + +  G+ASWYG  +H R  ANGE+Y    +TAAH TLP+ + VRVTN+    
Sbjct: 86  HVDNNSVSSSETGLASWYGPPYHNRTGANGEIYDQNAMTAAHRTLPMGTIVRVTNLSTNQ 145

Query: 138 SLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           S+ V++ DRGP+   R+IDLS AAAK   +   GV+KV VE   
Sbjct: 146 SVTVKITDRGPFVQGRIIDLSLAAAKETGLYRMGVAKVRVEVFA 189


>gi|83592361|ref|YP_426113.1| rare lipoprotein A [Rhodospirillum rubrum ATCC 11170]
 gi|83575275|gb|ABC21826.1| Rare lipoprotein A [Rhodospirillum rubrum ATCC 11170]
          Length = 202

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 62/86 (72%)

Query: 93  SWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSN 152
           SWYG++  G+ TA+GE++    +TAAHP LP  S V++ N E+G S+VVRVNDRGP+ S 
Sbjct: 95  SWYGRSHQGKRTASGEIFDANGMTAAHPKLPFGSKVKMRNPESGQSVVVRVNDRGPFVST 154

Query: 153 RLIDLSNAAAKILRVEERGVSKVHVE 178
           R +D+S AAAK L +  +G++ V VE
Sbjct: 155 RGMDVSEAAAKALGIWAKGIALVEVE 180


>gi|333029155|ref|ZP_08457216.1| rare lipoprotein A [Bacteroides coprosuis DSM 18011]
 gi|332739752|gb|EGJ70234.1| rare lipoprotein A [Bacteroides coprosuis DSM 18011]
          Length = 149

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 61/96 (63%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
           A   VG AS+Y   FHG  TA+GE Y    +T AHP+ P  + +++TN  NG  + V+VN
Sbjct: 20  AQEEVGSASFYNNRFHGNKTASGERYNKNLLTCAHPSYPFGTKLKITNQHNGKEVYVKVN 79

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGP+ S R+IDLS  AAK L +  RG++ V VE +
Sbjct: 80  DRGPFKSKRIIDLSYLAAKELDIIRRGIASVKVEVI 115


>gi|238911588|ref|ZP_04655425.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
          Length = 377

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 80/137 (58%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GEV+    +TAAHPTLP+PSY R
Sbjct: 63  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEVFDPMQLTAAHPTLPIPSYAR 122

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 123 ITNLANGRMIVVRINDRGPYGTDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAPDGSLS 180

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 181 GPGMACTTVAKQTYALP 197


>gi|149185523|ref|ZP_01863839.1| rare lipoprotein A [Erythrobacter sp. SD-21]
 gi|148830743|gb|EDL49178.1| rare lipoprotein A [Erythrobacter sp. SD-21]
          Length = 173

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/93 (50%), Positives = 62/93 (66%)

Query: 88  AVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRG 147
           A G AS+YG    G LTA+GE +    +TAAH  LPL S VRVTN  +G ++VVR+NDRG
Sbjct: 79  ADGEASYYGSELAGNLTASGEAFDPSQLTAAHRFLPLGSKVRVTNPRSGQAVVVRINDRG 138

Query: 148 PYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           P+H NR+IDLS AAA+ + +   G  +V +  L
Sbjct: 139 PFHGNRVIDLSTAAARKIGLIRSGTGRVRLALL 171


>gi|317485900|ref|ZP_07944759.1| rare lipoprotein A [Bilophila wadsworthia 3_1_6]
 gi|316922822|gb|EFV44049.1| rare lipoprotein A [Bilophila wadsworthia 3_1_6]
          Length = 236

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 61/93 (65%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G A++Y  +FHG+ TANGE Y     TAAH +LPL + VRVTN+ NG +L+VR+NDRGP
Sbjct: 36  TGGATFYSDSFHGKKTANGERYNKNEFTAAHRSLPLGTIVRVTNLSNGNNLLVRINDRGP 95

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
                ++D+S AAA  L +  RGV  V VE + 
Sbjct: 96  GKKKLILDVSRAAASKLNMIRRGVISVQVEVVA 128


>gi|26987665|ref|NP_743090.1| rare lipoprotein A [Pseudomonas putida KT2440]
 gi|24982349|gb|AAN66554.1|AE016284_2 lipoprotein, putative [Pseudomonas putida KT2440]
          Length = 124

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 63/96 (65%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
            Y   G AS+YG   HG+ TA+GE +    +TAAH +LP  + VRVTNM N  S+VVR+N
Sbjct: 27  GYDQTGTASYYGSRHHGKRTASGEPFNQHALTAAHRSLPFGTRVRVTNMANQRSVVVRIN 86

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGP+   RLIDLS AAA+ + +   G ++V V+ L
Sbjct: 87  DRGPHTRGRLIDLSRAAAEKIGMLRSGTARVRVQGL 122


>gi|170767994|ref|ZP_02902447.1| rare lipoprotein A [Escherichia albertii TW07627]
 gi|170123482|gb|EDS92413.1| rare lipoprotein A [Escherichia albertii TW07627]
          Length = 362

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 80/137 (58%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQAPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +     VLP
Sbjct: 179 GPGMACTTVAKQTYVLP 195


>gi|187730890|ref|YP_001879356.1| rare lipoprotein A [Shigella boydii CDC 3083-94]
 gi|187427882|gb|ACD07156.1| rare lipoprotein A [Shigella boydii CDC 3083-94]
          Length = 362

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLPLPSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPLPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|157146750|ref|YP_001454069.1| rare lipoprotein A [Citrobacter koseri ATCC BAA-895]
 gi|157083955|gb|ABV13633.1| hypothetical protein CKO_02524 [Citrobacter koseri ATCC BAA-895]
          Length = 374

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 78/137 (56%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  GR Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 63  YQRDGRSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPMQLTAAHPTLPIPSYAR 122

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA  L       +KV V+ + +A    + 
Sbjct: 123 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAADRLNTSNN--TKVRVDPIIVAQDGSLS 180

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 181 GPGMACTTVAKQTYALP 197


>gi|148546212|ref|YP_001266314.1| rare lipoprotein A [Pseudomonas putida F1]
 gi|148510270|gb|ABQ77130.1| rare lipoprotein A [Pseudomonas putida F1]
 gi|313497298|gb|ADR58664.1| Rare lipoprotein A [Pseudomonas putida BIRD-1]
          Length = 124

 Score = 93.6 bits (231), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 63/96 (65%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
            Y   G AS+YG   HG+ TA+GE +    +TAAH +LP  + VRVTNM N  S+VVR+N
Sbjct: 27  GYDQTGTASYYGSRHHGKRTASGEPFNQHGLTAAHRSLPFGTRVRVTNMANQRSVVVRIN 86

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGP+   RLIDLS AAA+ + +   G ++V V+ L
Sbjct: 87  DRGPHTRGRLIDLSRAAAEKIGMLRSGTARVRVQGL 122


>gi|53802847|ref|YP_115361.1| lipoprotein A domain-containing protein [Methylococcus capsulatus
           str. Bath]
 gi|53756608|gb|AAU90899.1| rare lipoprotein A domain protein [Methylococcus capsulatus str.
           Bath]
          Length = 143

 Score = 93.6 bits (231), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 71/113 (62%), Gaps = 4/113 (3%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           + Y++ GR Y P      Y   G+ASWYG+   GR TA G  +    ++AAH TLPLP+ 
Sbjct: 33  RAYRVKGRVYRPLASAKGYRERGIASWYGEE-SGRRTAMGTRFDPHGLSAAHRTLPLPTR 91

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VRVTN+ N  S+++ VNDRGP+   RLIDLS  AAK LR+   G+ +V VE L
Sbjct: 92  VRVTNLGNRRSIILVVNDRGPFIDGRLIDLSRGAAKALRLN--GLGRVEVEAL 142


>gi|332094305|gb|EGI99356.1| rare lipoprotein A [Shigella boydii 5216-82]
          Length = 362

 Score = 93.6 bits (231), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSQFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|114797813|ref|YP_760519.1| rare lipoprotein A [Hyphomonas neptunium ATCC 15444]
 gi|114737987|gb|ABI76112.1| rare lipoprotein A [Hyphomonas neptunium ATCC 15444]
          Length = 410

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 61/100 (61%)

Query: 84  TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRV 143
            A+A  G+A  YG  F G  TANGEV+    +TAAHP+LPLPS V VTN++ G  +VVRV
Sbjct: 164 AAFAETGIAIVYGDEFAGLPTANGEVFSQTELTAAHPSLPLPSLVSVTNVDTGREVVVRV 223

Query: 144 NDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           NDRGP+     + LS  AA+ L +   G   V + YL  A
Sbjct: 224 NDRGPFEDGANVQLSRKAAETLGMNGAGKGNVRLRYLSPA 263


>gi|255594984|ref|XP_002536203.1| conserved hypothetical protein [Ricinus communis]
 gi|223520473|gb|EEF26179.1| conserved hypothetical protein [Ricinus communis]
          Length = 154

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 58/90 (64%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWY + F GR TANGE Y  + +TAAH TLP  +YVRVT++    ++VVR+NDRGP
Sbjct: 48  TGQASWYARKFEGRRTANGERYNGQALTAAHRTLPFGTYVRVTSLSTAKTVVVRINDRGP 107

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           +   R+IDLS AAA  L +       V +E
Sbjct: 108 FVKGRVIDLSYAAASALGLTRAPSMNVQIE 137


>gi|77457061|ref|YP_346566.1| rare lipoprotein A [Pseudomonas fluorescens Pf0-1]
 gi|77381064|gb|ABA72577.1| putative lipoprotein A-like protein [Pseudomonas fluorescens Pf0-1]
          Length = 124

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 64/95 (67%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           Y   G+AS+YG   HG+ TA+GE +    +TAAH  LP  + V+VTN++N  S+VVR+ND
Sbjct: 28  YDQTGVASYYGAKHHGKRTASGEAFNQNSLTAAHRQLPFGTRVKVTNLKNDESVVVRIND 87

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+   RLID+S AAA+ L +   G ++V V+ L
Sbjct: 88  RGPHTRGRLIDVSRAAAEQLGMLRSGTARVRVQAL 122


>gi|323170760|gb|EFZ56410.1| rare lipoprotein A [Escherichia coli LT-68]
          Length = 349

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 48  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR 107

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 108 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 165

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 166 GPGMACTTVAKQTYALP 182


>gi|297518993|ref|ZP_06937379.1| rare lipoprotein A [Escherichia coli OP50]
          Length = 222

 Score = 93.2 bits (230), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|300722313|ref|YP_003711598.1| a minor lipoprotein [Xenorhabdus nematophila ATCC 19061]
 gi|297628815|emb|CBJ89393.1| a minor lipoprotein [Xenorhabdus nematophila ATCC 19061]
          Length = 334

 Score = 93.2 bits (230), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 84/138 (60%), Gaps = 4/138 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + ++   +   G ASW+G+  +G+LTA GE      +TAAHPTLP+PSYVR
Sbjct: 56  YQRDGQTYRIVQEPAHFTQTGYASWFGEEANGKLTAIGERVSPYTLTAAHPTLPIPSYVR 115

Query: 130 VTNMENGISLVVRVNDRGPYHS-NRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGM 188
           VTN+ NG  ++VR+NDRGPY+   ++I+LS A A+ L +  +  S+V ++ + +A  + +
Sbjct: 116 VTNLSNGRMMIVRINDRGPYNKPGKIIELSRAVAERLNLMPQ--SRVKLDGIQVASDDSL 173

Query: 189 DQEYLRSTVMVNSATVLP 206
                    +V  +  LP
Sbjct: 174 SGLGTEGATIVKQSFALP 191


>gi|108758400|ref|YP_630777.1| lipoprotein [Myxococcus xanthus DK 1622]
 gi|108462280|gb|ABF87465.1| putative lipoprotein, RlpA family [Myxococcus xanthus DK 1622]
          Length = 167

 Score = 93.2 bits (230), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 66/102 (64%), Gaps = 3/102 (2%)

Query: 76  RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMEN 135
           R  +PR Y      G+AS+YG   HGR TA+GE +  E +TAAH  L   S +RV NMEN
Sbjct: 50  REQMPRSYLGE---GLASFYGPGLHGRPTASGERFDQEAMTAAHRKLRFGSCLRVVNMEN 106

Query: 136 GISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           G ++ VRVNDRGP+   R++DLS  AA+ L + ++GV +V +
Sbjct: 107 GRAVKVRVNDRGPFIDGRIVDLSKGAARKLDMLDKGVVRVRL 148


>gi|75907188|ref|YP_321484.1| rare lipoprotein A [Anabaena variabilis ATCC 29413]
 gi|75700913|gb|ABA20589.1| Rare lipoprotein A [Anabaena variabilis ATCC 29413]
          Length = 371

 Score = 93.2 bits (230), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 64/94 (68%), Gaps = 2/94 (2%)

Query: 90  GMASWYG--KAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRG 147
           G+AS+YG    F G+ TA GE +  E +TAAH +LP  + VRVTN  NG S+VVR+NDRG
Sbjct: 277 GIASFYGHGDGFAGKPTATGERFNPEAMTAAHRSLPFGTRVRVTNTRNGRSVVVRINDRG 336

Query: 148 PYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           P+   R+IDLS  AA++L +   GV+ V +E LG
Sbjct: 337 PFTRGRVIDLSTGAARLLGMIGSGVAPVRIEVLG 370


>gi|121997802|ref|YP_001002589.1| rare lipoprotein A [Halorhodospira halophila SL1]
 gi|121589207|gb|ABM61787.1| rare lipoprotein A [Halorhodospira halophila SL1]
          Length = 352

 Score = 93.2 bits (230), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 69/119 (57%), Gaps = 5/119 (4%)

Query: 64  RYFLGKPYQIMGRWYVP---RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHP 120
           RY   + Y++ G  Y      +   +   G ASWYG  FHGR T++G  Y    +TAAH 
Sbjct: 70  RYGNPEQYEVFGETYATMSREEAEGFTQRGRASWYGTKFHGRRTSSGTPYDMYAMTAAHR 129

Query: 121 TLPLPSYVRVTNMENGISLVVRVNDRGPY--HSNRLIDLSNAAAKILRVEERGVSKVHV 177
            LPLP++V V N+EN    VV+VNDRGP+     R++DLS AAA  L + ++G + V +
Sbjct: 130 ELPLPTWVEVVNLENDRRAVVKVNDRGPFVDPDERILDLSYAAAVRLDIADQGTAPVQI 188


>gi|293408759|ref|ZP_06652598.1| rare lipoprotein A [Escherichia coli B354]
 gi|291471937|gb|EFF14420.1| rare lipoprotein A [Escherichia coli B354]
          Length = 362

 Score = 93.2 bits (230), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|149184374|ref|ZP_01862692.1| hypothetical protein ED21_26688 [Erythrobacter sp. SD-21]
 gi|148831694|gb|EDL50127.1| hypothetical protein ED21_26688 [Erythrobacter sp. SD-21]
          Length = 170

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 49/91 (53%), Positives = 59/91 (64%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+AS+YGK FHGR TANGE +     TAAH TLP  S VRVTN   G S+ VR+NDRGP+
Sbjct: 79  GVASYYGKRFHGRRTANGERFDMHGYTAAHRTLPFGSLVRVTNPSTGKSVTVRINDRGPF 138

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R IDLS AAA  + +  RG   V ++ L
Sbjct: 139 TRGRTIDLSRAAATEIGLIARGHGTVELDLL 169


>gi|301643954|ref|ZP_07243980.1| sporulation and cell division repeat protein [Escherichia coli MS
           146-1]
 gi|301077689|gb|EFK92495.1| sporulation and cell division repeat protein [Escherichia coli MS
           146-1]
          Length = 362

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|191167350|ref|ZP_03029166.1| rare lipoprotein A [Escherichia coli B7A]
 gi|218553175|ref|YP_002386088.1| rare lipoprotein A [Escherichia coli IAI1]
 gi|256020585|ref|ZP_05434450.1| rare lipoprotein A [Shigella sp. D9]
 gi|260853885|ref|YP_003227776.1| minor lipoprotein RlpA [Escherichia coli O26:H11 str. 11368]
 gi|260866781|ref|YP_003233183.1| minor lipoprotein RlpA [Escherichia coli O111:H- str. 11128]
 gi|293418744|ref|ZP_06661179.1| rare lipoprotein A [Escherichia coli B088]
 gi|300907808|ref|ZP_07125425.1| sporulation and cell division repeat protein [Escherichia coli MS
           84-1]
 gi|300927268|ref|ZP_07142996.1| sporulation and cell division repeat protein [Escherichia coli MS
           182-1]
 gi|301302113|ref|ZP_07208246.1| sporulation and cell division repeat protein [Escherichia coli MS
           124-1]
 gi|301329155|ref|ZP_07222152.1| sporulation and cell division repeat protein [Escherichia coli MS
           78-1]
 gi|307312651|ref|ZP_07592283.1| rare lipoprotein A [Escherichia coli W]
 gi|309795500|ref|ZP_07689917.1| sporulation and cell division repeat protein [Escherichia coli MS
           145-7]
 gi|331666986|ref|ZP_08367860.1| rare lipoprotein A [Escherichia coli TA271]
 gi|332281772|ref|ZP_08394185.1| rare lipoprotein A [Shigella sp. D9]
 gi|190902599|gb|EDV62332.1| rare lipoprotein A [Escherichia coli B7A]
 gi|218359943|emb|CAQ97487.1| minor lipoprotein [Escherichia coli IAI1]
 gi|257752534|dbj|BAI24036.1| minor lipoprotein RlpA [Escherichia coli O26:H11 str. 11368]
 gi|257763137|dbj|BAI34632.1| minor lipoprotein RlpA [Escherichia coli O111:H- str. 11128]
 gi|291325272|gb|EFE64687.1| rare lipoprotein A [Escherichia coli B088]
 gi|300400497|gb|EFJ84035.1| sporulation and cell division repeat protein [Escherichia coli MS
           84-1]
 gi|300416756|gb|EFK00067.1| sporulation and cell division repeat protein [Escherichia coli MS
           182-1]
 gi|300842665|gb|EFK70425.1| sporulation and cell division repeat protein [Escherichia coli MS
           124-1]
 gi|300844502|gb|EFK72262.1| sporulation and cell division repeat protein [Escherichia coli MS
           78-1]
 gi|306907353|gb|EFN37858.1| rare lipoprotein A [Escherichia coli W]
 gi|308120875|gb|EFO58137.1| sporulation and cell division repeat protein [Escherichia coli MS
           145-7]
 gi|315059888|gb|ADT74215.1| minor lipoprotein [Escherichia coli W]
 gi|315255063|gb|EFU35031.1| sporulation and cell division repeat protein [Escherichia coli MS
           85-1]
 gi|323153645|gb|EFZ39893.1| rare lipoprotein A [Escherichia coli EPECa14]
 gi|323179890|gb|EFZ65447.1| rare lipoprotein A [Escherichia coli 1180]
 gi|323185012|gb|EFZ70379.1| rare lipoprotein A [Escherichia coli 1357]
 gi|323379548|gb|ADX51816.1| rare lipoprotein A [Escherichia coli KO11]
 gi|323945108|gb|EGB41170.1| rare lipoprotein A double-psi beta-barrel [Escherichia coli H120]
 gi|331066210|gb|EGI38094.1| rare lipoprotein A [Escherichia coli TA271]
 gi|332104124|gb|EGJ07470.1| rare lipoprotein A [Shigella sp. D9]
          Length = 362

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|70728274|ref|YP_258023.1| rplA family protein [Pseudomonas fluorescens Pf-5]
 gi|68342573|gb|AAY90179.1| rplA family protein [Pseudomonas fluorescens Pf-5]
          Length = 124

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 48/95 (50%), Positives = 62/95 (65%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           Y A G AS+YG   HG  TA+GE +    +TAAH  LP  + V+VTN+ N  S+VVR+ND
Sbjct: 28  YDATGTASYYGARHHGNRTASGEPFDQNGLTAAHRELPFGTRVQVTNLGNDKSVVVRIND 87

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+   RLIDLS AAA+ L +   G +KV V+ L
Sbjct: 88  RGPHTRGRLIDLSRAAAQQLDMLRSGTAKVRVQAL 122


>gi|74311169|ref|YP_309588.1| rare lipoprotein A [Shigella sonnei Ss046]
 gi|157158068|ref|YP_001461801.1| rare lipoprotein A [Escherichia coli E24377A]
 gi|157160128|ref|YP_001457446.1| rare lipoprotein A [Escherichia coli HS]
 gi|170683228|ref|YP_001742749.1| rare lipoprotein A [Escherichia coli SMS-3-5]
 gi|188495794|ref|ZP_03003064.1| rare lipoprotein A [Escherichia coli 53638]
 gi|193063389|ref|ZP_03044479.1| rare lipoprotein A [Escherichia coli E22]
 gi|193069022|ref|ZP_03049980.1| rare lipoprotein A [Escherichia coli E110019]
 gi|194430717|ref|ZP_03063144.1| rare lipoprotein A [Escherichia coli B171]
 gi|209917892|ref|YP_002291976.1| rare lipoprotein A [Escherichia coli SE11]
 gi|218694073|ref|YP_002401740.1| rare lipoprotein A [Escherichia coli 55989]
 gi|218699005|ref|YP_002406634.1| rare lipoprotein A [Escherichia coli IAI39]
 gi|218703967|ref|YP_002411486.1| rare lipoprotein A [Escherichia coli UMN026]
 gi|253774381|ref|YP_003037212.1| lipoprotein A [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254160715|ref|YP_003043823.1| rare lipoprotein A [Escherichia coli B str. REL606]
 gi|260842859|ref|YP_003220637.1| minor lipoprotein RlpA [Escherichia coli O103:H2 str. 12009]
 gi|293403895|ref|ZP_06647889.1| rare lipoprotein A [Escherichia coli FVEC1412]
 gi|293413929|ref|ZP_06656578.1| rare lipoprotein A [Escherichia coli B185]
 gi|298379671|ref|ZP_06989276.1| rare lipoprotein A [Escherichia coli FVEC1302]
 gi|300817849|ref|ZP_07098063.1| sporulation and cell division repeat protein [Escherichia coli MS
           107-1]
 gi|300823052|ref|ZP_07103186.1| sporulation and cell division repeat protein [Escherichia coli MS
           119-7]
 gi|300901141|ref|ZP_07119248.1| sporulation and cell division repeat protein [Escherichia coli MS
           198-1]
 gi|300920554|ref|ZP_07136979.1| sporulation and cell division repeat protein [Escherichia coli MS
           115-1]
 gi|300931566|ref|ZP_07146880.1| sporulation and cell division repeat protein [Escherichia coli MS
           187-1]
 gi|312970714|ref|ZP_07784895.1| rare lipoprotein A [Escherichia coli 1827-70]
 gi|331661998|ref|ZP_08362921.1| rare lipoprotein A [Escherichia coli TA143]
 gi|331672172|ref|ZP_08372964.1| rare lipoprotein A [Escherichia coli TA280]
 gi|331676292|ref|ZP_08377004.1| rare lipoprotein A [Escherichia coli H591]
 gi|331682057|ref|ZP_08382681.1| rare lipoprotein A [Escherichia coli H299]
 gi|73854646|gb|AAZ87353.1| minor lipoprotein [Shigella sonnei Ss046]
 gi|157065808|gb|ABV05063.1| rare lipoprotein A [Escherichia coli HS]
 gi|157080098|gb|ABV19806.1| rare lipoprotein A [Escherichia coli E24377A]
 gi|170520946|gb|ACB19124.1| rare lipoprotein A [Escherichia coli SMS-3-5]
 gi|188490993|gb|EDU66096.1| rare lipoprotein A [Escherichia coli 53638]
 gi|192930973|gb|EDV83577.1| rare lipoprotein A [Escherichia coli E22]
 gi|192957566|gb|EDV88011.1| rare lipoprotein A [Escherichia coli E110019]
 gi|194411241|gb|EDX27636.1| rare lipoprotein A [Escherichia coli B171]
 gi|209911151|dbj|BAG76225.1| minor lipoprotein [Escherichia coli SE11]
 gi|218350805|emb|CAU96497.1| minor lipoprotein [Escherichia coli 55989]
 gi|218368991|emb|CAR16745.1| minor lipoprotein [Escherichia coli IAI39]
 gi|218431064|emb|CAR11940.1| minor lipoprotein [Escherichia coli UMN026]
 gi|242376409|emb|CAQ31108.1| rare lipoprotein RlpA [Escherichia coli BL21(DE3)]
 gi|253325425|gb|ACT30027.1| Rare lipoprotein A [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253972616|gb|ACT38287.1| minor lipoprotein [Escherichia coli B str. REL606]
 gi|253976810|gb|ACT42480.1| minor lipoprotein [Escherichia coli BL21(DE3)]
 gi|257758006|dbj|BAI29503.1| minor lipoprotein RlpA [Escherichia coli O103:H2 str. 12009]
 gi|284920433|emb|CBG33494.1| rare lipoprotein A [Escherichia coli 042]
 gi|291428481|gb|EFF01506.1| rare lipoprotein A [Escherichia coli FVEC1412]
 gi|291433987|gb|EFF06960.1| rare lipoprotein A [Escherichia coli B185]
 gi|298279369|gb|EFI20877.1| rare lipoprotein A [Escherichia coli FVEC1302]
 gi|300355408|gb|EFJ71278.1| sporulation and cell division repeat protein [Escherichia coli MS
           198-1]
 gi|300412456|gb|EFJ95766.1| sporulation and cell division repeat protein [Escherichia coli MS
           115-1]
 gi|300460635|gb|EFK24128.1| sporulation and cell division repeat protein [Escherichia coli MS
           187-1]
 gi|300524401|gb|EFK45470.1| sporulation and cell division repeat protein [Escherichia coli MS
           119-7]
 gi|300529546|gb|EFK50608.1| sporulation and cell division repeat protein [Escherichia coli MS
           107-1]
 gi|310337363|gb|EFQ02501.1| rare lipoprotein A [Escherichia coli 1827-70]
 gi|320185391|gb|EFW60161.1| Rare lipoprotein A precursor [Shigella flexneri CDC 796-83]
 gi|320198241|gb|EFW72845.1| Rare lipoprotein A precursor [Escherichia coli EC4100B]
 gi|323158913|gb|EFZ44924.1| rare lipoprotein A [Escherichia coli E128010]
 gi|323164089|gb|EFZ49897.1| rare lipoprotein A [Shigella sonnei 53G]
 gi|323191272|gb|EFZ76536.1| rare lipoprotein A [Escherichia coli RN587/1]
 gi|323963202|gb|EGB58770.1| rare lipoprotein A double-psi beta-barrel [Escherichia coli H489]
 gi|323967580|gb|EGB62996.1| rare lipoprotein A double-psi beta-barrel [Escherichia coli M863]
 gi|323976384|gb|EGB71474.1| rare lipoprotein A double-psi beta-barrel [Escherichia coli
           TW10509]
 gi|324016089|gb|EGB85308.1| sporulation and cell division repeat protein [Escherichia coli MS
           117-3]
 gi|324116707|gb|EGC10622.1| rare lipoprotein A double-psi beta-barrel [Escherichia coli E1167]
 gi|327254317|gb|EGE65939.1| rare lipoprotein A [Escherichia coli STEC_7v]
 gi|331060420|gb|EGI32384.1| rare lipoprotein A [Escherichia coli TA143]
 gi|331070639|gb|EGI42002.1| rare lipoprotein A [Escherichia coli TA280]
 gi|331076350|gb|EGI47632.1| rare lipoprotein A [Escherichia coli H591]
 gi|331080736|gb|EGI51910.1| rare lipoprotein A [Escherichia coli H299]
 gi|332097709|gb|EGJ02683.1| rare lipoprotein A [Shigella boydii 3594-74]
          Length = 362

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|331651645|ref|ZP_08352664.1| rare lipoprotein A [Escherichia coli M718]
 gi|331049923|gb|EGI21981.1| rare lipoprotein A [Escherichia coli M718]
          Length = 362

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|300937895|ref|ZP_07152686.1| sporulation and cell division repeat protein [Escherichia coli MS
           21-1]
 gi|300457095|gb|EFK20588.1| sporulation and cell division repeat protein [Escherichia coli MS
           21-1]
          Length = 362

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|300959201|ref|ZP_07171280.1| sporulation and cell division repeat protein [Escherichia coli MS
           175-1]
 gi|300314186|gb|EFJ63970.1| sporulation and cell division repeat protein [Escherichia coli MS
           175-1]
          Length = 362

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFSQAGLATIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|170021010|ref|YP_001725964.1| rare lipoprotein A [Escherichia coli ATCC 8739]
 gi|169755938|gb|ACA78637.1| rare lipoprotein A [Escherichia coli ATCC 8739]
          Length = 362

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|16128616|ref|NP_415166.1| septal ring protein, suppressor of prc, minor lipoprotein
           [Escherichia coli str. K-12 substr. MG1655]
 gi|89107502|ref|AP_001282.1| minor lipoprotein [Escherichia coli str. K-12 substr. W3110]
 gi|170080212|ref|YP_001729532.1| minor lipoprotein [Escherichia coli str. K-12 substr. DH10B]
 gi|170080313|ref|YP_001729633.1| minor lipoprotein [Escherichia coli str. K-12 substr. DH10B]
 gi|238899910|ref|YP_002925706.1| minor lipoprotein [Escherichia coli BW2952]
 gi|256023755|ref|ZP_05437620.1| rare lipoprotein A [Escherichia sp. 4_1_40B]
 gi|300951130|ref|ZP_07164995.1| sporulation and cell division repeat protein [Escherichia coli MS
           116-1]
 gi|301028890|ref|ZP_07192062.1| sporulation and cell division repeat protein [Escherichia coli MS
           196-1]
 gi|307137250|ref|ZP_07496606.1| rare lipoprotein A [Escherichia coli H736]
 gi|331641136|ref|ZP_08342271.1| rare lipoprotein A [Escherichia coli H736]
 gi|133097|sp|P10100|RLPA_ECOLI RecName: Full=Rare lipoprotein A; Flags: Precursor
 gi|147660|gb|AAA24552.1| 36kd lipoprotein (rlpA) precursor [Escherichia coli]
 gi|1651260|dbj|BAA35276.1| minor lipoprotein [Escherichia coli str. K12 substr. W3110]
 gi|1778550|gb|AAB40833.1| rare lipoprotein A precursor [Escherichia coli]
 gi|1786852|gb|AAC73734.1| septal ring protein, suppressor of prc, minor lipoprotein
           [Escherichia coli str. K-12 substr. MG1655]
 gi|169888047|gb|ACB01754.1| minor lipoprotein [Escherichia coli str. K-12 substr. DH10B]
 gi|169888148|gb|ACB01855.1| minor lipoprotein [Escherichia coli str. K-12 substr. DH10B]
 gi|238861778|gb|ACR63776.1| minor lipoprotein [Escherichia coli BW2952]
 gi|260450200|gb|ACX40622.1| rare lipoprotein A [Escherichia coli DH1]
 gi|299878138|gb|EFI86349.1| sporulation and cell division repeat protein [Escherichia coli MS
           196-1]
 gi|300449585|gb|EFK13205.1| sporulation and cell division repeat protein [Escherichia coli MS
           116-1]
 gi|315135299|dbj|BAJ42458.1| rare lipoprotein A [Escherichia coli DH1]
 gi|315616448|gb|EFU97065.1| rare lipoprotein A [Escherichia coli 3431]
 gi|323938395|gb|EGB34649.1| rare lipoprotein A double-psi beta-barrel [Escherichia coli E1520]
 gi|323943048|gb|EGB39207.1| rare lipoprotein A double-psi beta-barrel [Escherichia coli E482]
 gi|323972088|gb|EGB67302.1| rare lipoprotein A double-psi beta-barrel [Escherichia coli TA007]
 gi|331037934|gb|EGI10154.1| rare lipoprotein A [Escherichia coli H736]
 gi|332341980|gb|AEE55314.1| rare lipoprotein A RlpA [Escherichia coli UMNK88]
          Length = 362

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|332096776|gb|EGJ01766.1| rare lipoprotein A [Shigella dysenteriae 155-74]
          Length = 362

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|320537421|ref|ZP_08037371.1| sporulation and cell division repeat protein [Treponema phagedenis
           F0421]
 gi|320145747|gb|EFW37413.1| sporulation and cell division repeat protein [Treponema phagedenis
           F0421]
          Length = 381

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 43/90 (47%), Positives = 66/90 (73%)

Query: 91  MASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYH 150
            AS+YG+AF+G+ TA+GE++     TAAH TLP  + V VTN++NG  ++VRVNDRGP+ 
Sbjct: 30  FASYYGEAFNGKPTASGELFNMNAYTAAHKTLPFGTLVEVTNLDNGKKVLVRVNDRGPFV 89

Query: 151 SNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            +R IDLS AAA  + + +RG+++V ++ +
Sbjct: 90  GDREIDLSKAAAIAIGMTDRGIARVSLKKI 119


>gi|282599610|ref|ZP_05971203.2| lipoprotein A [Providencia rustigianii DSM 4541]
 gi|282568707|gb|EFB74242.1| lipoprotein A [Providencia rustigianii DSM 4541]
          Length = 329

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 72/114 (63%), Gaps = 3/114 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + R    ++ VG A+ YG+   G LTA GE      +TA+HPTLP+PSYVR
Sbjct: 60  YQRNGQTYQIVRDPAQFSQVGYAAIYGQEASGHLTAIGERVNPVELTASHPTLPIPSYVR 119

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VTNM NG  +VVRVNDRGPY   + I LS AAA  L + +   +K+ ++ + +A
Sbjct: 120 VTNMMNGRMMVVRVNDRGPYIPGKSIALSRAAADRLNLMQ--TTKIKIDAIQVA 171


>gi|215485673|ref|YP_002328104.1| rare lipoprotein A [Escherichia coli O127:H6 str. E2348/69]
 gi|312965079|ref|ZP_07779316.1| rare lipoprotein A [Escherichia coli 2362-75]
 gi|215263745|emb|CAS08081.1| minor lipoprotein [Escherichia coli O127:H6 str. E2348/69]
 gi|312290170|gb|EFR18053.1| rare lipoprotein A [Escherichia coli 2362-75]
          Length = 362

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|16764015|ref|NP_459630.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|167990645|ref|ZP_02571745.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|197262469|ref|ZP_03162543.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|20139510|sp|Q8ZR01|RLPA_SALTY RecName: Full=Rare lipoprotein A; Flags: Precursor
 gi|16419150|gb|AAL19589.1| a minor lipoprotein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|197240724|gb|EDY23344.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|205330918|gb|EDZ17682.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|261245911|emb|CBG23712.1| rare lipoprotein A precursor [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267992373|gb|ACY87258.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|312911669|dbj|BAJ35643.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|321226218|gb|EFX51269.1| Rare lipoprotein A precursor [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|332987583|gb|AEF06566.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 381

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 80/137 (58%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE++    +TAAHPTLP+PSY R
Sbjct: 63  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEMFDPMQLTAAHPTLPIPSYAR 122

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 123 ITNLANGRMIVVRINDRGPYGTDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAPDGSLS 180

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 181 GPGMACTTVAKQTYALP 197


>gi|161615146|ref|YP_001589111.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|161364510|gb|ABX68278.1| hypothetical protein SPAB_02914 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 381

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 80/137 (58%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE++    +TAAHPTLP+PSY R
Sbjct: 63  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEMFDPMQLTAAHPTLPIPSYAR 122

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 123 ITNLANGRMIVVRINDRGPYGTDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAPDGSLS 180

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 181 GPGMACTTVAKQTYALP 197


>gi|289548558|ref|YP_003473546.1| lipoprotein A [Thermocrinis albus DSM 14484]
 gi|289182175|gb|ADC89419.1| rare lipoprotein A [Thermocrinis albus DSM 14484]
          Length = 133

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 58/88 (65%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYGK FHGR TA+GE++     TAA    P+ SYV V NM NG  +VVR+NDRGP 
Sbjct: 23  GLASWYGKEFHGRRTASGELFNKYKYTAASKVFPIGSYVLVRNMNNGKEVVVRINDRGPL 82

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHV 177
              R++DLS +AA  L +   GV+ V +
Sbjct: 83  KGGRILDLSKSAAHKLGMVAHGVAPVEI 110


>gi|26246614|ref|NP_752654.1| rare lipoprotein A [Escherichia coli CFT073]
 gi|110640862|ref|YP_668590.1| rare lipoprotein A [Escherichia coli 536]
 gi|191172273|ref|ZP_03033815.1| rare lipoprotein A [Escherichia coli F11]
 gi|218688456|ref|YP_002396668.1| rare lipoprotein A [Escherichia coli ED1a]
 gi|227884387|ref|ZP_04002192.1| rare lipoprotein A [Escherichia coli 83972]
 gi|300990037|ref|ZP_07179079.1| sporulation and cell division repeat protein [Escherichia coli MS
           45-1]
 gi|300996736|ref|ZP_07181523.1| sporulation and cell division repeat protein [Escherichia coli MS
           200-1]
 gi|301049828|ref|ZP_07196768.1| sporulation and cell division repeat protein [Escherichia coli MS
           185-1]
 gi|306812935|ref|ZP_07447128.1| rare lipoprotein A [Escherichia coli NC101]
 gi|331645791|ref|ZP_08346894.1| rare lipoprotein A [Escherichia coli M605]
 gi|331656660|ref|ZP_08357622.1| rare lipoprotein A [Escherichia coli TA206]
 gi|26107013|gb|AAN79197.1|AE016757_101 Rare lipoprotein A precursor [Escherichia coli CFT073]
 gi|110342454|gb|ABG68691.1| rare lipoprotein A precursor [Escherichia coli 536]
 gi|190907372|gb|EDV66969.1| rare lipoprotein A [Escherichia coli F11]
 gi|218426020|emb|CAR06837.1| minor lipoprotein [Escherichia coli ED1a]
 gi|222032393|emb|CAP75132.1| Rare lipoprotein A [Escherichia coli LF82]
 gi|227838473|gb|EEJ48939.1| rare lipoprotein A [Escherichia coli 83972]
 gi|281177782|dbj|BAI54112.1| minor lipoprotein [Escherichia coli SE15]
 gi|300298423|gb|EFJ54808.1| sporulation and cell division repeat protein [Escherichia coli MS
           185-1]
 gi|300304451|gb|EFJ58971.1| sporulation and cell division repeat protein [Escherichia coli MS
           200-1]
 gi|300407209|gb|EFJ90747.1| sporulation and cell division repeat protein [Escherichia coli MS
           45-1]
 gi|305853698|gb|EFM54137.1| rare lipoprotein A [Escherichia coli NC101]
 gi|307552503|gb|ADN45278.1| lipoprotein A [Escherichia coli ABU 83972]
 gi|312945180|gb|ADR26007.1| rare lipoprotein A [Escherichia coli O83:H1 str. NRG 857C]
 gi|315292100|gb|EFU51452.1| sporulation and cell division repeat protein [Escherichia coli MS
           153-1]
 gi|315299176|gb|EFU58430.1| sporulation and cell division repeat protein [Escherichia coli MS
           16-3]
 gi|324006312|gb|EGB75531.1| sporulation and cell division repeat protein [Escherichia coli MS
           57-2]
 gi|324010474|gb|EGB79693.1| sporulation and cell division repeat protein [Escherichia coli MS
           60-1]
 gi|330910395|gb|EGH38905.1| rare lipoprotein A precursor [Escherichia coli AA86]
 gi|331044543|gb|EGI16670.1| rare lipoprotein A [Escherichia coli M605]
 gi|331054908|gb|EGI26917.1| rare lipoprotein A [Escherichia coli TA206]
          Length = 362

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|91209680|ref|YP_539666.1| rare lipoprotein A [Escherichia coli UTI89]
 gi|218557571|ref|YP_002390484.1| rare lipoprotein A [Escherichia coli S88]
 gi|237707393|ref|ZP_04537874.1| rare lipoprotein A [Escherichia sp. 3_2_53FAA]
 gi|91071254|gb|ABE06135.1| rare lipoprotein A precursor [Escherichia coli UTI89]
 gi|218364340|emb|CAR02015.1| minor lipoprotein [Escherichia coli S88]
 gi|226898603|gb|EEH84862.1| rare lipoprotein A [Escherichia sp. 3_2_53FAA]
 gi|294490947|gb|ADE89703.1| rare lipoprotein A [Escherichia coli IHE3034]
 gi|307627929|gb|ADN72233.1| rare lipoprotein A [Escherichia coli UM146]
 gi|315287074|gb|EFU46488.1| sporulation and cell division repeat protein [Escherichia coli MS
           110-3]
 gi|323952789|gb|EGB48657.1| rare lipoprotein A double-psi beta-barrel [Escherichia coli H252]
 gi|323958392|gb|EGB54098.1| rare lipoprotein A double-psi beta-barrel [Escherichia coli H263]
          Length = 362

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|332760997|gb|EGJ91285.1| rare lipoprotein A [Shigella flexneri 4343-70]
 gi|333007917|gb|EGK27393.1| rare lipoprotein A [Shigella flexneri K-218]
          Length = 362

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTKLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|168231651|ref|ZP_02656709.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|168465813|ref|ZP_02699695.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|194471205|ref|ZP_03077189.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|197247493|ref|YP_002145613.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|198246252|ref|YP_002214627.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|194457569|gb|EDX46408.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|195631979|gb|EDX50499.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197211196|gb|ACH48593.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197940768|gb|ACH78101.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|205334122|gb|EDZ20886.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|326622382|gb|EGE28727.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
          Length = 377

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 80/137 (58%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE++    +TAAHPTLP+PSY R
Sbjct: 63  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEMFDPMQLTAAHPTLPIPSYAR 122

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 123 ITNLANGRMIVVRINDRGPYGTDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAPDGSLS 180

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 181 GPGMACTTVAKQTYALP 197


>gi|62179238|ref|YP_215655.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|224582474|ref|YP_002636272.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|62126871|gb|AAX64574.1| minor lipoprotein [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|224467001|gb|ACN44831.1| rare lipoprotein A precursor [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|322713703|gb|EFZ05274.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 381

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 80/137 (58%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE++    +TAAHPTLP+PSY R
Sbjct: 63  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEMFDPMQLTAAHPTLPIPSYAR 122

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 123 ITNLANGRMIVVRINDRGPYGTDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAPDGSLS 180

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 181 GPGMACTTVAKQTYALP 197


>gi|301025236|ref|ZP_07188803.1| sporulation and cell division repeat protein [Escherichia coli MS
           69-1]
 gi|300396139|gb|EFJ79677.1| sporulation and cell division repeat protein [Escherichia coli MS
           69-1]
          Length = 362

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|205351926|ref|YP_002225727.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207856104|ref|YP_002242755.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|205271707|emb|CAR36538.1| rare lipoprotein A precursor [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|206707907|emb|CAR32195.1| rare lipoprotein A precursor [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|326626965|gb|EGE33308.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
          Length = 377

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 80/137 (58%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE++    +TAAHPTLP+PSY R
Sbjct: 63  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEMFDPMQLTAAHPTLPIPSYAR 122

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 123 ITNLANGRMIVVRINDRGPYGTDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAPDGSLS 180

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 181 GPGMACTTVAKQTYALP 197


>gi|24112067|ref|NP_706577.1| rare lipoprotein A [Shigella flexneri 2a str. 301]
 gi|30062178|ref|NP_836349.1| rare lipoprotein A [Shigella flexneri 2a str. 2457T]
 gi|110804718|ref|YP_688238.1| rare lipoprotein A [Shigella flexneri 5 str. 8401]
 gi|24050893|gb|AAN42284.1| minor lipoprotein [Shigella flexneri 2a str. 301]
 gi|30040423|gb|AAP16155.1| minor lipoprotein [Shigella flexneri 2a str. 2457T]
 gi|110614266|gb|ABF02933.1| RlpA [Shigella flexneri 5 str. 8401]
 gi|281600031|gb|ADA73015.1| Minor lipoprotein [Shigella flexneri 2002017]
 gi|313649722|gb|EFS14146.1| rare lipoprotein A [Shigella flexneri 2a str. 2457T]
 gi|332761200|gb|EGJ91486.1| rare lipoprotein A [Shigella flexneri 2747-71]
 gi|332763368|gb|EGJ93608.1| rare lipoprotein A [Shigella flexneri K-671]
 gi|332768265|gb|EGJ98450.1| rare lipoA family protein [Shigella flexneri 2930-71]
 gi|333021473|gb|EGK40723.1| rare lipoprotein A [Shigella flexneri K-304]
          Length = 362

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTKLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|301157239|emb|CBW16726.1| rare lipoprotein A precursor [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|323128955|gb|ADX16385.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
          Length = 355

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 80/137 (58%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE++    +TAAHPTLP+PSY R
Sbjct: 63  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEMFDPMQLTAAHPTLPIPSYAR 122

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 123 ITNLANGRMIVVRINDRGPYGTDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAPDGSLS 180

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 181 GPGMACTTVAKQTYALP 197


>gi|82543079|ref|YP_407026.1| rare lipoprotein A [Shigella boydii Sb227]
 gi|81244490|gb|ABB65198.1| RlpA [Shigella boydii Sb227]
 gi|333010044|gb|EGK29479.1| rare lipoprotein A [Shigella flexneri K-272]
 gi|333020877|gb|EGK40137.1| rare lipoprotein A [Shigella flexneri K-227]
          Length = 362

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTKLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|320194185|gb|EFW68817.1| Rare lipoprotein A precursor [Escherichia coli WV_060327]
          Length = 362

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|168240486|ref|ZP_02665418.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|168823259|ref|ZP_02835259.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|194451207|ref|YP_002044672.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|200391020|ref|ZP_03217631.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|194409511|gb|ACF69730.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|199603465|gb|EDZ02011.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|205340414|gb|EDZ27178.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|205340476|gb|EDZ27240.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|320084908|emb|CBY94698.1| RlpA-like protein Flags: Precursor [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
          Length = 377

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 80/137 (58%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE++    +TAAHPTLP+PSY R
Sbjct: 63  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEMFDPMQLTAAHPTLPIPSYAR 122

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 123 ITNLANGRMIVVRINDRGPYGTDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAPDGSLS 180

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 181 GPGMACTTVAKQTYALP 197


>gi|46578823|ref|YP_009631.1| rare lipoprotein A family protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120603570|ref|YP_967970.1| rare lipoprotein A [Desulfovibrio vulgaris DP4]
 gi|46448235|gb|AAS94890.1| rare lipoprotein A family protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120563799|gb|ABM29543.1| rare lipoprotein A [Desulfovibrio vulgaris DP4]
 gi|311232686|gb|ADP85540.1| rare lipoprotein A [Desulfovibrio vulgaris RCH1]
          Length = 214

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 63/94 (67%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG+  HG  TA+GE +  +  TAAH  LPL S V+VTN+ NG S++V VNDRGPY
Sbjct: 33  GKASWYGEEQHGLPTASGEDFDMKAFTAAHRKLPLGSVVKVTNVRNGRSVLVTVNDRGPY 92

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
             NR+IDLS  AA  L +  +GV+ V ++ +  A
Sbjct: 93  AGNRIIDLSYVAASRLGMVRQGVASVKLDVMANA 126


>gi|322613230|gb|EFY10173.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322621298|gb|EFY18155.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322623718|gb|EFY20556.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322628990|gb|EFY25769.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322631712|gb|EFY28466.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322637552|gb|EFY34254.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322641892|gb|EFY38522.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322646736|gb|EFY43242.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322651437|gb|EFY47817.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322653112|gb|EFY49446.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322658832|gb|EFY55087.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322664898|gb|EFY61091.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322668900|gb|EFY65052.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322670594|gb|EFY66727.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322675335|gb|EFY71411.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322682194|gb|EFY78219.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322684976|gb|EFY80973.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323193965|gb|EFZ79167.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323197943|gb|EFZ83065.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323202010|gb|EFZ87070.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323207143|gb|EFZ92096.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323210408|gb|EFZ95299.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323214330|gb|EFZ99081.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323221481|gb|EGA05895.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323225524|gb|EGA09754.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323231083|gb|EGA15199.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323234085|gb|EGA18174.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323238220|gb|EGA22278.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323242546|gb|EGA26570.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323248477|gb|EGA32411.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323251308|gb|EGA35180.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323259235|gb|EGA42878.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323261643|gb|EGA45218.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323264825|gb|EGA48326.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323272338|gb|EGA55745.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
          Length = 363

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 80/137 (58%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE++    +TAAHPTLP+PSY R
Sbjct: 63  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEMFDPMQLTAAHPTLPIPSYAR 122

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 123 ITNLANGRMIVVRINDRGPYGTDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAPDGSLS 180

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 181 GPGMACTTVAKQTYALP 197


>gi|167550826|ref|ZP_02344582.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|205324290|gb|EDZ12129.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
          Length = 377

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 80/137 (58%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE++    +TAAHPTLP+PSY R
Sbjct: 63  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEMFDPMQLTAAHPTLPIPSYAR 122

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 123 ITNLANGRMIVVRINDRGPYGTDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAPDGSLS 180

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 181 GPGMACTTVAKQTYALP 197


>gi|56414227|ref|YP_151302.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197363150|ref|YP_002142787.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|56128484|gb|AAV77990.1| rare lipoprotein A precursor [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197094627|emb|CAR60149.1| rare lipoprotein A precursor [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 377

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 80/137 (58%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE++    +TAAHPTLP+PSY R
Sbjct: 63  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEMFDPMQLTAAHPTLPIPSYAR 122

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 123 ITNLANGRMIVVRINDRGPYGTDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAPDGSLS 180

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 181 GPGMACTTVAKQTYALP 197


>gi|333007456|gb|EGK26936.1| rare lipoprotein A [Shigella flexneri VA-6]
          Length = 362

 Score = 92.4 bits (228), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTKLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|204930497|ref|ZP_03221427.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|204320431|gb|EDZ05634.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
          Length = 377

 Score = 92.4 bits (228), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 80/137 (58%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE++    +TAAHPTLP+PSY R
Sbjct: 63  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEMFDPMQLTAAHPTLPIPSYAR 122

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 123 ITNLANGRMIVVRINDRGPYGTDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAPDGSLS 180

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 181 GPGMACTTVAKQTYALP 197


>gi|161504187|ref|YP_001571299.1| rare lipoprotein A [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|160865534|gb|ABX22157.1| hypothetical protein SARI_02294 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 362

 Score = 92.4 bits (228), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 80/137 (58%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE++    +TAAHPTLP+PSY R
Sbjct: 63  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEMFDPMQLTAAHPTLPIPSYAR 122

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 123 ITNLANGRMIVVRINDRGPYGTDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAPDGSLS 180

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 181 GPGMACTTVAKQTYALP 197


>gi|168264430|ref|ZP_02686403.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|205347099|gb|EDZ33730.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
          Length = 377

 Score = 92.4 bits (228), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 80/137 (58%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE++    +TAAHPTLP+PSY R
Sbjct: 63  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEMFDPMQLTAAHPTLPIPSYAR 122

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 123 ITNLANGRMIVVRINDRGPYGTDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAPDGSLS 180

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 181 GPGMACTTVAKQTYALP 197


>gi|261341255|ref|ZP_05969113.1| lipoprotein A [Enterobacter cancerogenus ATCC 35316]
 gi|288316559|gb|EFC55497.1| lipoprotein A [Enterobacter cancerogenus ATCC 35316]
          Length = 379

 Score = 92.4 bits (228), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 71/111 (63%), Gaps = 3/111 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    ITAAHPTLP+PSY R
Sbjct: 62  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGETFDPMQITAAHPTLPIPSYAR 121

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VTN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ +
Sbjct: 122 VTNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPI 170


>gi|313675953|ref|YP_004053949.1| rare lipoprotein a [Marivirga tractuosa DSM 4126]
 gi|312942651|gb|ADR21841.1| rare lipoprotein A [Marivirga tractuosa DSM 4126]
          Length = 226

 Score = 92.4 bits (228), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 64/94 (68%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
           A    G AS+Y   F G+ TA+GE Y  + +TAAH +LP  + V+VTN++N  ++ VR+N
Sbjct: 21  AQVQTGTASYYADKFEGKQTASGEKYKHKKLTAAHKSLPYGTIVKVTNLDNQETVEVRIN 80

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           DRGPY   R+IDLS +AA+ L+   +G++KV +E
Sbjct: 81  DRGPYVDGRVIDLSRSAAEKLKFINQGLAKVRIE 114


>gi|212712938|ref|ZP_03321066.1| hypothetical protein PROVALCAL_04036 [Providencia alcalifaciens DSM
           30120]
 gi|212684416|gb|EEB43944.1| hypothetical protein PROVALCAL_04036 [Providencia alcalifaciens DSM
           30120]
          Length = 329

 Score = 92.4 bits (228), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 70/116 (60%), Gaps = 8/116 (6%)

Query: 68  GKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           GK YQI+      R    Y+ VG AS YG+   G+LTA GE      +TAAHPTLP+PSY
Sbjct: 64  GKQYQIV------RDPAQYSQVGYASIYGQEASGQLTAIGERANPVELTAAHPTLPIPSY 117

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
            R+TNM NG  +VVR+NDRGPY   + I +S A A   R+     +K+ ++ + +A
Sbjct: 118 ARITNMMNGRMMVVRINDRGPYTPGKSIAVSRAVAD--RLNLMTTTKIKIDAIQVA 171


>gi|117622849|ref|YP_851762.1| rare lipoprotein A [Escherichia coli APEC O1]
 gi|115511973|gb|ABJ00048.1| rare lipoprotein A precursor [Escherichia coli APEC O1]
          Length = 445

 Score = 92.4 bits (228), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 144 YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR 203

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 204 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 261

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 262 GPGMACTTVAKQTYALP 278


>gi|329113281|ref|ZP_08242064.1| RlpA-like protein [Acetobacter pomorum DM001]
 gi|326697422|gb|EGE49080.1| RlpA-like protein [Acetobacter pomorum DM001]
          Length = 197

 Score = 92.0 bits (227), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 45/89 (50%), Positives = 60/89 (67%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG  FH R T++GE +    +TAAHPT PL S +RV + + G S+VV +NDRGPY
Sbjct: 69  GVASWYGGRFHNRRTSSGERFDKGSLTAAHPTAPLGSKLRVVSEDTGRSVVVTINDRGPY 128

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVE 178
              R+ID+S AAA  L +   G++ V VE
Sbjct: 129 SRGRIIDVSKAAAAELGMLNSGIAHVRVE 157


>gi|82775902|ref|YP_402249.1| rare lipoprotein A [Shigella dysenteriae Sd197]
 gi|309785936|ref|ZP_07680565.1| rare lipoprotein A [Shigella dysenteriae 1617]
 gi|81240050|gb|ABB60760.1| minor lipoprotein [Shigella dysenteriae Sd197]
 gi|308926047|gb|EFP71525.1| rare lipoprotein A [Shigella dysenteriae 1617]
          Length = 362

 Score = 92.0 bits (227), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFEPTQLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|320175125|gb|EFW50237.1| Rare lipoprotein A precursor [Shigella dysenteriae CDC 74-1112]
          Length = 362

 Score = 92.0 bits (227), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 53/134 (39%), Positives = 76/134 (56%), Gaps = 14/134 (10%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEY---------- 179
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++           
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 180 -LGMALLNGMDQEY 192
            LGMA      Q Y
Sbjct: 179 GLGMACTTVAKQTY 192


>gi|186472492|ref|YP_001859834.1| rare lipoprotein A [Burkholderia phymatum STM815]
 gi|184194824|gb|ACC72788.1| rare lipoprotein A [Burkholderia phymatum STM815]
          Length = 175

 Score = 92.0 bits (227), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 46/77 (59%), Positives = 54/77 (70%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G ASWY + F GR TA+GE Y    +TAAH TLPL SYVRVT++    S+VVRVNDRGP
Sbjct: 69  TGYASWYARKFQGRRTASGERYDNRLLTAAHRTLPLGSYVRVTSLATEKSVVVRVNDRGP 128

Query: 149 YHSNRLIDLSNAAAKIL 165
           +   R+IDLS AAA  L
Sbjct: 129 FIKGRIIDLSLAAASEL 145


>gi|110597249|ref|ZP_01385537.1| rare lipoprotein A [Chlorobium ferrooxidans DSM 13031]
 gi|110341085|gb|EAT59553.1| rare lipoprotein A [Chlorobium ferrooxidans DSM 13031]
          Length = 158

 Score = 92.0 bits (227), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 45/94 (47%), Positives = 63/94 (67%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
           A AA G AS+Y + F GR TA+GE +   + TAAH +LP  + VRV N++NG  +VVR+N
Sbjct: 62  ALAAEGTASYYSRKFQGRKTASGESFNCSHFTAAHRSLPFGTSVRVINLDNGKHVVVRIN 121

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           DRGPY   R+ID+S AAA+ + +   G + V +E
Sbjct: 122 DRGPYLKGRIIDVSPAAAREIGLFGNGTANVRIE 155


>gi|195939372|ref|ZP_03084754.1| rare lipoprotein A [Escherichia coli O157:H7 str. EC4024]
          Length = 245

 Score = 92.0 bits (227), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 78/137 (56%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + +   G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFIQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|298291653|ref|YP_003693592.1| lipoprotein A [Starkeya novella DSM 506]
 gi|296928164|gb|ADH88973.1| rare lipoprotein A [Starkeya novella DSM 506]
          Length = 173

 Score = 92.0 bits (227), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 49/95 (51%), Positives = 65/95 (68%), Gaps = 3/95 (3%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           YA  GMAS+YG  + GR TANGE +  + +TAAH  LP  + VRVTN  NG S+VVR+ND
Sbjct: 81  YATTGMASYYG--YSGR-TANGERHTGQAMTAAHRNLPFNTRVRVTNKANGRSVVVRIND 137

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+   R+ID+S AAA  L   +RGV++V +  +
Sbjct: 138 RGPFIRGRIIDVSTAAADQLGFRKRGVARVEIAVV 172


>gi|331035498|gb|AEC53055.1| RlpA-like lipoprotein precursor [Synechococcus phage S-CRM01]
          Length = 125

 Score = 92.0 bits (227), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 56/83 (67%), Gaps = 1/83 (1%)

Query: 83  YTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVR 142
           +T       ASWYG  FHGR TANGEV+  + +TAAH  LP  + VRVTN  NG S++VR
Sbjct: 28  HTVKEKCSSASWYGPGFHGRRTANGEVFHQDSLTAAHKHLPFGTRVRVTNRHNGKSIIVR 87

Query: 143 VNDRGPYHSNRLIDLS-NAAAKI 164
           +NDRGP+   R +DLS  AAA+I
Sbjct: 88  INDRGPFIGGRALDLSREAAARI 110


>gi|283834061|ref|ZP_06353802.1| lipoprotein A [Citrobacter youngae ATCC 29220]
 gi|291070204|gb|EFE08313.1| lipoprotein A [Citrobacter youngae ATCC 29220]
          Length = 364

 Score = 92.0 bits (227), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPMQLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|33865477|ref|NP_897036.1| RlpA [Synechococcus sp. WH 8102]
 gi|33632646|emb|CAE07458.1| similar to RlpA [Synechococcus sp. WH 8102]
          Length = 154

 Score = 92.0 bits (227), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 47/91 (51%), Positives = 62/91 (68%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  F+GR TA+GE       TAAH TLP  + VRVTN++N  S+VVR+NDRGP+
Sbjct: 63  GAASWYGPGFYGRQTASGERLRKGTFTAAHRTLPFGTRVRVTNLDNNRSVVVRINDRGPF 122

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
             +R+IDL++ AA+ LR+   G   V +E L
Sbjct: 123 RYHRVIDLAHGAARELRMMRAGEIPVRLEIL 153


>gi|283784411|ref|YP_003364276.1| rare lipoprotein A [Citrobacter rodentium ICC168]
 gi|282947865|emb|CBG87426.1| rare lipoprotein A [Citrobacter rodentium ICC168]
          Length = 367

 Score = 92.0 bits (227), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 80/137 (58%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE++    +TAAHPTLP+PSY R
Sbjct: 63  YQRDGKSYRIVQDPSRFSQAGLAAIYDAEPGSNLTASGEMFDPMQLTAAHPTLPIPSYAR 122

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 123 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 180

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 181 GPGMACTTVAKQTYALP 197


>gi|258542237|ref|YP_003187670.1| lipoprotein [Acetobacter pasteurianus IFO 3283-01]
 gi|256633315|dbj|BAH99290.1| lipoprotein [Acetobacter pasteurianus IFO 3283-01]
 gi|256636374|dbj|BAI02343.1| lipoprotein [Acetobacter pasteurianus IFO 3283-03]
 gi|256639427|dbj|BAI05389.1| lipoprotein [Acetobacter pasteurianus IFO 3283-07]
 gi|256642483|dbj|BAI08438.1| lipoprotein [Acetobacter pasteurianus IFO 3283-22]
 gi|256645538|dbj|BAI11486.1| lipoprotein [Acetobacter pasteurianus IFO 3283-26]
 gi|256648591|dbj|BAI14532.1| lipoprotein [Acetobacter pasteurianus IFO 3283-32]
 gi|256651644|dbj|BAI17578.1| lipoprotein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654635|dbj|BAI20562.1| lipoprotein [Acetobacter pasteurianus IFO 3283-12]
          Length = 288

 Score = 92.0 bits (227), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 64/103 (62%)

Query: 65  YFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           Y +G  +Q  G+W+ PR+  A+   G+A        G LTA+GEV+    +T +H TL L
Sbjct: 28  YTVGPAWQAGGKWFYPREDFAWQGTGLAVREPAQAEGHLTADGEVWHAASMTGSHQTLQL 87

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRV 167
           P+ VRVTN++NG  +V+R+NDRGP    R+I L+  AA +L V
Sbjct: 88  PAVVRVTNLDNGRQIVIRLNDRGPNDPGRMIGLTPRAADLLGV 130


>gi|149189950|ref|ZP_01868229.1| rare lipoprotein A [Vibrio shilonii AK1]
 gi|148836265|gb|EDL53223.1| rare lipoprotein A [Vibrio shilonii AK1]
          Length = 150

 Score = 92.0 bits (227), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 62/96 (64%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
           ++  VG ASWYG  +HGR TA+GE Y     TAAH TLP  + VRVTN  NG ++ V++N
Sbjct: 45  SHELVGQASWYGNKYHGRRTASGERYNMRAYTAAHKTLPFGTIVRVTNTANGKTVDVKIN 104

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGP+   R+IDLS  + + +    +G++ V +E +
Sbjct: 105 DRGPFVKGRIIDLSRKSFEQIGDISKGIAPVKIEII 140


>gi|145299193|ref|YP_001142034.1| rare lipoprotein A [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142851965|gb|ABO90286.1| rare lipoprotein A [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 128

 Score = 92.0 bits (227), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 47/98 (47%), Positives = 62/98 (63%)

Query: 83  YTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVR 142
           +  Y   G+AS+Y   +H + TA+GE+Y T   TAAH TLP  S VRVTN+ NG S+VV+
Sbjct: 31  WRGYTETGLASYYADRYHNKKTASGELYRTHLNTAAHMTLPFGSLVRVTNIANGKSVVVK 90

Query: 143 VNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VNDRG +   R+IDLS +A   +     G+ KV VE L
Sbjct: 91  VNDRGAFKRGRIIDLSKSAFSTIGNTRSGLIKVKVEVL 128


>gi|194442270|ref|YP_002039880.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194400933|gb|ACF61155.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
          Length = 377

 Score = 91.7 bits (226), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE++    +TAAHPTLP+PSY R
Sbjct: 63  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEMFDPMQLTAAHPTLPIPSYAR 122

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN  NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 123 ITNQANGRMIVVRINDRGPYGTDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAPDGSLS 180

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 181 GPGMACTTVAKQTYALP 197


>gi|311280462|ref|YP_003942693.1| rare lipoprotein A [Enterobacter cloacae SCF1]
 gi|308749657|gb|ADO49409.1| rare lipoprotein A [Enterobacter cloacae SCF1]
          Length = 386

 Score = 91.7 bits (226), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 77/137 (56%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y   Q  A ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKNYKIVQDPANFSQTGLAAIYDAEPGSNLTASGEAFDPMQLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  LVVR+NDRGPY ++R+I LS AAA  L       +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMLVVRINDRGPYGNDRVISLSRAAADRLNTSNN--TKVRIDPIIVAPDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|307824093|ref|ZP_07654320.1| rare lipoprotein A [Methylobacter tundripaludum SV96]
 gi|307734877|gb|EFO05727.1| rare lipoprotein A [Methylobacter tundripaludum SV96]
          Length = 162

 Score = 91.7 bits (226), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 61/88 (69%), Gaps = 2/88 (2%)

Query: 93  SWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSN 152
           SWYG  FHG+ TA+G+ Y    +TAAH TLPL SY +VTN++N  S+VVR+NDRG +H  
Sbjct: 58  SWYGPEFHGKKTASGQKYDMYALTAAHKTLPLLSYAKVTNLKNHRSVVVRINDRGSFHGK 117

Query: 153 RLIDLSNAAAKILRVEERGVSKVHVEYL 180
           R +DLS AAAK L +  RG+  V +  L
Sbjct: 118 RDMDLSYAAAKELGI--RGLGSVEITPL 143


>gi|258543570|ref|YP_003189003.1| lipoprotein A [Acetobacter pasteurianus IFO 3283-01]
 gi|256634648|dbj|BAI00624.1| rare lipoprotein A [Acetobacter pasteurianus IFO 3283-01]
 gi|256637704|dbj|BAI03673.1| rare lipoprotein A [Acetobacter pasteurianus IFO 3283-03]
 gi|256640758|dbj|BAI06720.1| rare lipoprotein A [Acetobacter pasteurianus IFO 3283-07]
 gi|256643813|dbj|BAI09768.1| rare lipoprotein A [Acetobacter pasteurianus IFO 3283-22]
 gi|256646868|dbj|BAI12816.1| rare lipoprotein A [Acetobacter pasteurianus IFO 3283-26]
 gi|256649921|dbj|BAI15862.1| rare lipoprotein A [Acetobacter pasteurianus IFO 3283-32]
 gi|256652911|dbj|BAI18845.1| rare lipoprotein A [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655965|dbj|BAI21892.1| rare lipoprotein A [Acetobacter pasteurianus IFO 3283-12]
          Length = 238

 Score = 91.7 bits (226), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/89 (50%), Positives = 60/89 (67%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG  FH R T++GE +    +TAAHPT PL S +RV + + G S+VV +NDRGPY
Sbjct: 110 GVASWYGGRFHNRRTSSGERFDKGSLTAAHPTAPLGSKLRVVSEDTGRSVVVTINDRGPY 169

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVE 178
              R+ID+S AAA  L +   G++ V VE
Sbjct: 170 SRGRIIDVSKAAAAELGMLNSGIAHVRVE 198


>gi|15800347|ref|NP_286359.1| rare lipoprotein A [Escherichia coli O157:H7 EDL933]
 gi|15829925|ref|NP_308698.1| rare lipoprotein A [Escherichia coli O157:H7 str. Sakai]
 gi|168752776|ref|ZP_02777798.1| rare lipoprotein A [Escherichia coli O157:H7 str. EC4113]
 gi|168765403|ref|ZP_02790410.1| rare lipoprotein A [Escherichia coli O157:H7 str. EC4501]
 gi|168770238|ref|ZP_02795245.1| rare lipoprotein A [Escherichia coli O157:H7 str. EC4486]
 gi|168786483|ref|ZP_02811490.1| rare lipoprotein A [Escherichia coli O157:H7 str. EC869]
 gi|208815498|ref|ZP_03256677.1| rare lipoprotein A [Escherichia coli O157:H7 str. EC4045]
 gi|208823177|ref|ZP_03263495.1| rare lipoprotein A [Escherichia coli O157:H7 str. EC4042]
 gi|209399263|ref|YP_002269269.1| rare lipoprotein A [Escherichia coli O157:H7 str. EC4115]
 gi|217325232|ref|ZP_03441316.1| rare lipoprotein A [Escherichia coli O157:H7 str. TW14588]
 gi|254791799|ref|YP_003076636.1| rare lipoprotein A [Escherichia coli O157:H7 str. TW14359]
 gi|261224100|ref|ZP_05938381.1| minor lipoprotein [Escherichia coli O157:H7 str. FRIK2000]
 gi|261257794|ref|ZP_05950327.1| minor lipoprotein [Escherichia coli O157:H7 str. FRIK966]
 gi|20139446|sp|Q8XBQ1|RLPA_ECO57 RecName: Full=Rare lipoprotein A; Flags: Precursor
 gi|12513534|gb|AAG54967.1|AE005242_11 a minor lipoprotein [Escherichia coli O157:H7 str. EDL933]
 gi|13360129|dbj|BAB34094.1| a minor lipoprotein [Escherichia coli O157:H7 str. Sakai]
 gi|188013526|gb|EDU51648.1| rare lipoprotein A [Escherichia coli O157:H7 str. EC4113]
 gi|189360876|gb|EDU79295.1| rare lipoprotein A [Escherichia coli O157:H7 str. EC4486]
 gi|189364871|gb|EDU83287.1| rare lipoprotein A [Escherichia coli O157:H7 str. EC4501]
 gi|189373495|gb|EDU91911.1| rare lipoprotein A [Escherichia coli O157:H7 str. EC869]
 gi|208732146|gb|EDZ80834.1| rare lipoprotein A [Escherichia coli O157:H7 str. EC4045]
 gi|208737370|gb|EDZ85054.1| rare lipoprotein A [Escherichia coli O157:H7 str. EC4042]
 gi|209160663|gb|ACI38096.1| rare lipoprotein A [Escherichia coli O157:H7 str. EC4115]
 gi|209777138|gb|ACI86881.1| a minor lipoprotein [Escherichia coli]
 gi|209777140|gb|ACI86882.1| a minor lipoprotein [Escherichia coli]
 gi|209777142|gb|ACI86883.1| a minor lipoprotein [Escherichia coli]
 gi|209777146|gb|ACI86885.1| a minor lipoprotein [Escherichia coli]
 gi|217321453|gb|EEC29877.1| rare lipoprotein A [Escherichia coli O157:H7 str. TW14588]
 gi|254591199|gb|ACT70560.1| minor lipoprotein [Escherichia coli O157:H7 str. TW14359]
 gi|320193040|gb|EFW67680.1| Rare lipoprotein A precursor [Escherichia coli O157:H7 str. EC1212]
 gi|320638082|gb|EFX07846.1| rare lipoprotein A [Escherichia coli O157:H7 str. G5101]
 gi|320643488|gb|EFX12658.1| rare lipoprotein A [Escherichia coli O157:H- str. 493-89]
 gi|320648823|gb|EFX17450.1| rare lipoprotein A [Escherichia coli O157:H- str. H 2687]
 gi|320664887|gb|EFX32022.1| rare lipoprotein A [Escherichia coli O157:H7 str. LSU-61]
 gi|326341384|gb|EGD65176.1| Rare lipoprotein A precursor [Escherichia coli O157:H7 str. 1044]
 gi|326345837|gb|EGD69576.1| Rare lipoprotein A precursor [Escherichia coli O157:H7 str. 1125]
          Length = 362

 Score = 91.7 bits (226), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 78/137 (56%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + +   G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFIQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|322434313|ref|YP_004216525.1| rare lipoprotein A [Acidobacterium sp. MP5ACTX9]
 gi|321162040|gb|ADW67745.1| rare lipoprotein A [Acidobacterium sp. MP5ACTX9]
          Length = 187

 Score = 91.7 bits (226), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 63/95 (66%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
            A  GMASWYG  ++G+ TA+GE +    +TA H TLP  + V+VT +  G S++V++ND
Sbjct: 79  LAGTGMASWYGSMWNGKKTASGETFNETLLTACHRTLPFGTRVKVTAVNTGKSVIVKIND 138

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RG    +R+IDLS+ AAK L +   GV+KV +E L
Sbjct: 139 RGTMTPSRIIDLSSGAAKQLGIINAGVAKVKLEVL 173


>gi|291281584|ref|YP_003498402.1| Rare lipoprotein A precursor [Escherichia coli O55:H7 str. CB9615]
 gi|209777144|gb|ACI86884.1| a minor lipoprotein [Escherichia coli]
 gi|290761457|gb|ADD55418.1| Rare lipoprotein A precursor [Escherichia coli O55:H7 str. CB9615]
 gi|320654409|gb|EFX22456.1| rare lipoprotein A [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320660090|gb|EFX27620.1| rare lipoprotein A [Escherichia coli O55:H7 str. USDA 5905]
          Length = 362

 Score = 91.7 bits (226), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 78/137 (56%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + +   G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFIQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|237730617|ref|ZP_04561098.1| rare lipoprotein A [Citrobacter sp. 30_2]
 gi|226906156|gb|EEH92074.1| rare lipoprotein A [Citrobacter sp. 30_2]
          Length = 371

 Score = 91.7 bits (226), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 78/137 (56%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R
Sbjct: 61  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPMQLTAAHPTLPVPSYAR 120

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA  L       +KV ++ + +A    + 
Sbjct: 121 ITNLANGRMIVVRINDRGPYGNDRVISLSRAAADRLNTSNN--TKVRIDPIIVAQDGSLS 178

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 179 GPGMACTTVAKQTYALP 195


>gi|297566442|ref|YP_003685414.1| rare lipoprotein A [Meiothermus silvanus DSM 9946]
 gi|296850891|gb|ADH63906.1| rare lipoprotein A [Meiothermus silvanus DSM 9946]
          Length = 168

 Score = 91.7 bits (226), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/91 (52%), Positives = 62/91 (68%), Gaps = 2/91 (2%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+A+WYG  FHGR TA+GE Y     TAAH +LP  + VRVTN  +G S+VVR+NDRGP+
Sbjct: 79  GLAAWYGPKFHGRRTASGEPYDMYAFTAAHRSLPFGTRVRVTNPGSGQSVVVRINDRGPF 138

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
               +IDLS AAA+  R+  RG  +V +E L
Sbjct: 139 TPGFIIDLSYAAAQ--RIGLRGSKRVRLEVL 167


>gi|148654068|ref|YP_001281161.1| rare lipoprotein A [Psychrobacter sp. PRwf-1]
 gi|148573152|gb|ABQ95211.1| rare lipoprotein A [Psychrobacter sp. PRwf-1]
          Length = 120

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 63/97 (64%), Gaps = 3/97 (3%)

Query: 84  TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRV 143
           +A A  G+ASWYG  FHG+ TA+G +Y    +TAAH +LP  S V+VTN++N  S+VV++
Sbjct: 17  SAPANAGLASWYGPGFHGKRTASGAIYNMYAMTAAHKSLPFGSKVKVTNLKNNKSVVVKI 76

Query: 144 NDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            DRGP+   R+IDLS  A + L      + KV VE L
Sbjct: 77  TDRGPFAPGRIIDLSKKANQSLNCN---LCKVTVEVL 110


>gi|261416345|ref|YP_003250028.1| rare lipoprotein A [Fibrobacter succinogenes subsp. succinogenes
           S85]
 gi|261372801|gb|ACX75546.1| rare lipoprotein A [Fibrobacter succinogenes subsp. succinogenes
           S85]
 gi|302328104|gb|ADL27305.1| rare lipoprotein A family protein [Fibrobacter succinogenes subsp.
           succinogenes S85]
          Length = 141

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 62/91 (68%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
            Y   G AS+YGK F G+ TA+GE++  +  T AH TLP  + ++VT ++ G S+VVRVN
Sbjct: 45  GYTFTGDASYYGKGFDGKKTASGELFDRDDFTCAHRTLPFGTKLKVTRIKTGASVVVRVN 104

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKV 175
           DRGPY   R++DLS AA K L +++ G ++V
Sbjct: 105 DRGPYAKKRVLDLSEAAGKKLGLDKAGHAQV 135


>gi|241765051|ref|ZP_04763044.1| rare lipoprotein A [Acidovorax delafieldii 2AN]
 gi|241365328|gb|EER60143.1| rare lipoprotein A [Acidovorax delafieldii 2AN]
          Length = 186

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/92 (48%), Positives = 61/92 (66%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
           VG+ASWYG  FH R TA+GE++    +TAAHPTLP  S V V +   G +++VR+NDRGP
Sbjct: 85  VGLASWYGAQFHRRRTASGELFDMRALTAAHPTLPFGSRVCVRSQATGRTVIVRINDRGP 144

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +  NR+IDLS  AA+ L +   G+  V +  L
Sbjct: 145 HAPNRVIDLSRGAAEALGMVGLGLKPVELFAL 176


>gi|330807531|ref|YP_004351993.1| lipoprotein A-like protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375639|gb|AEA66989.1| putative lipoprotein A-like protein [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 125

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 62/96 (64%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
            Y   G+AS+YG   HG+ TA+GE +    +TAAH  LP  + V++TN+ N  S+VVR+N
Sbjct: 28  GYDQTGVASYYGARHHGKRTASGERFDQHSLTAAHRQLPFGTRVKITNLNNNDSVVVRIN 87

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGPY   RLID+S  AA+ L +   G ++V V+ L
Sbjct: 88  DRGPYSRGRLIDVSREAAEQLGMLRSGTARVRVQAL 123


>gi|326799826|ref|YP_004317645.1| lipoprotein A [Sphingobacterium sp. 21]
 gi|326550590|gb|ADZ78975.1| rare lipoprotein A [Sphingobacterium sp. 21]
          Length = 126

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/90 (47%), Positives = 60/90 (66%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+Y   F GR TA+GE +    +TAAH TLP  + V+V N++NG ++ VR+NDRGP+
Sbjct: 32  GGASYYADKFKGRRTASGEKFRQYKLTAAHKTLPFGTKVKVKNLDNGRTVKVRINDRGPF 91

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEY 179
            S R+IDLS  AA+ L + + G  KV + Y
Sbjct: 92  VSGRIIDLSKKAARRLGIIQSGTVKVEISY 121


>gi|156973399|ref|YP_001444306.1| hypothetical protein VIBHAR_01087 [Vibrio harveyi ATCC BAA-1116]
 gi|156524993|gb|ABU70079.1| hypothetical protein VIBHAR_01087 [Vibrio harveyi ATCC BAA-1116]
          Length = 181

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 58/86 (67%), Gaps = 1/86 (1%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
           ++A  G ASWYG  FHG+LTA+GE Y    +TAAH TLP  + VRVTN  N  S+ V++N
Sbjct: 76  SHALNGKASWYGDKFHGKLTASGETYDLNALTAAHKTLPFGTIVRVTNTANNKSVNVKIN 135

Query: 145 DRGPYHSNRLIDLSNAA-AKILRVEE 169
           DRGP+   R+IDLS  A AKI  V +
Sbjct: 136 DRGPFVRGRVIDLSRKAFAKIGNVGQ 161


>gi|124023941|ref|YP_001018248.1| lipoprotein A [Prochlorococcus marinus str. MIT 9303]
 gi|123964227|gb|ABM78983.1| possible rare lipoprotein A [Prochlorococcus marinus str. MIT 9303]
          Length = 221

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 67/111 (60%)

Query: 70  PYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           P   + R   P       + G ASWYG  F G  TA+GEV+    +TAAH +LP  + VR
Sbjct: 110 PVAKLNRPVKPTPTVVQVSTGEASWYGPGFFGNRTASGEVFRPGTMTAAHRSLPFGTKVR 169

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VTN+ N  S VV +NDRGP+ ++R+IDL++ AA  L +   G+++V +E L
Sbjct: 170 VTNLWNDRSAVVTINDRGPFIAHRVIDLAHGAAHELGLISSGIAQVRLEVL 220


>gi|168236630|ref|ZP_02661688.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|194737544|ref|YP_002113756.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|194713046|gb|ACF92267.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197290359|gb|EDY29715.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
          Length = 377

 Score = 91.3 bits (225), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE++    +TAAHPTLP+PSY R
Sbjct: 63  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEMFDPMQLTAAHPTLPIPSYAR 122

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +V R+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 123 ITNLANGRMIVARINDRGPYGTDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAPDGSLS 180

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 181 GPGMACTTVAKQTYALP 197


>gi|260597058|ref|YP_003209629.1| rare lipoprotein A [Cronobacter turicensis z3032]
 gi|260216235|emb|CBA29139.1| Rare lipoprotein A [Cronobacter turicensis z3032]
          Length = 394

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/131 (36%), Positives = 76/131 (58%), Gaps = 2/131 (1%)

Query: 76  RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMEN 135
           R+ + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R+TN+ N
Sbjct: 68  RYSIVQDLSRFSQAGLAAIYDAEPDSNLTASGEPFDPMQLTAAHPTLPVPSYARITNLAN 127

Query: 136 GISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRS 195
           G  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    +    +  
Sbjct: 128 GRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAPDGSLSGPGMAC 185

Query: 196 TVMVNSATVLP 206
           T +      LP
Sbjct: 186 TTVAKQTYALP 196


>gi|255038519|ref|YP_003089140.1| rare lipoprotein A [Dyadobacter fermentans DSM 18053]
 gi|254951275|gb|ACT95975.1| rare lipoprotein A [Dyadobacter fermentans DSM 18053]
          Length = 148

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 63/93 (67%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+Y   FHGR T+ GEV+ +  +  AH + PL + + VTN+EN   ++VRVNDRGP+
Sbjct: 33  GNASYYSARFHGRKTSFGEVHKSSELLCAHRSYPLNTMLEVTNLENDEKVIVRVNDRGPF 92

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
             +R+IDLS  AA++L +  +GV+ V V  +GM
Sbjct: 93  SKHRVIDLSKEAARLLGILAKGVANVSVRVVGM 125


>gi|156934846|ref|YP_001438762.1| rare lipoprotein A [Cronobacter sakazakii ATCC BAA-894]
 gi|156533100|gb|ABU77926.1| hypothetical protein ESA_02694 [Cronobacter sakazakii ATCC BAA-894]
          Length = 393

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/131 (36%), Positives = 76/131 (58%), Gaps = 2/131 (1%)

Query: 76  RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMEN 135
           R+ + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R+TN+ N
Sbjct: 68  RYTIVQDLSRFSQAGLAAIYDAEPDSNLTASGEPFDPMQLTAAHPTLPVPSYARITNLAN 127

Query: 136 GISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRS 195
           G  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    +    +  
Sbjct: 128 GRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAPDGSLSGPGMAC 185

Query: 196 TVMVNSATVLP 206
           T +      LP
Sbjct: 186 TTVAKQTYALP 196


>gi|255020039|ref|ZP_05292112.1| Rare lipoprotein A precursor [Acidithiobacillus caldus ATCC 51756]
 gi|254970568|gb|EET28057.1| Rare lipoprotein A precursor [Acidithiobacillus caldus ATCC 51756]
          Length = 365

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/134 (39%), Positives = 77/134 (57%), Gaps = 5/134 (3%)

Query: 69  KPYQIMGRWYVPRQYT-AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PY+I G WY P      Y   G+ASWY +A    +TA G  +    +TAA   LPLPS 
Sbjct: 68  QPYEINGHWYHPLTTARNYDVRGIASWYDRASSSSVTAMGTAFHQNALTAASRVLPLPSC 127

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL----GMA 183
           VRVTN+ NG S++V V+DRGP+ S R++DLS   A  L +  +G + V ++ +    GM 
Sbjct: 128 VRVTNLVNGRSVLVLVDDRGPFVSGRVMDLSLGTAHALGMVTQGTTPVQIQAVANSPGMP 187

Query: 184 LLNGMDQEYLRSTV 197
            ++      +RST+
Sbjct: 188 AVDSPQLTPVRSTM 201


>gi|74095597|emb|CAJ27363.1| conserved hypothetical protein [Cronobacter sakazakii]
          Length = 393

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/131 (36%), Positives = 76/131 (58%), Gaps = 2/131 (1%)

Query: 76  RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMEN 135
           R+ + +  + ++  G+A+ Y       LTA+GE +    +TAAHPTLP+PSY R+TN+ N
Sbjct: 68  RYTIVQDLSRFSQAGLAAIYDAEPDSNLTASGEPFDPMQLTAAHPTLPVPSYARITNLAN 127

Query: 136 GISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEYLRS 195
           G  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    +    +  
Sbjct: 128 GRMIVVRINDRGPYGNDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAPDGSLSGPGMAC 185

Query: 196 TVMVNSATVLP 206
           T +      LP
Sbjct: 186 TTVAKQTYALP 196


>gi|269120130|ref|YP_003308307.1| lipoprotein A [Sebaldella termitidis ATCC 33386]
 gi|268614008|gb|ACZ08376.1| rare lipoprotein A [Sebaldella termitidis ATCC 33386]
          Length = 127

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 58/91 (63%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  F+G  TA+GE++    +TAAHP+LP  S V VTN+EN   + VR+NDRGP+
Sbjct: 36  GKASWYGDKFNGNSTASGEIFSDRALTAAHPSLPFGSIVEVTNVENNKKIKVRINDRGPF 95

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R+IDLS  A   +    +GV  V ++ +
Sbjct: 96  TKGRIIDLSKEAFSRIADVNKGVIDVSIKVV 126


>gi|325275936|ref|ZP_08141780.1| rare lipoprotein A [Pseudomonas sp. TJI-51]
 gi|324098931|gb|EGB96933.1| rare lipoprotein A [Pseudomonas sp. TJI-51]
          Length = 124

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 61/96 (63%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
            Y   G AS+YG   HG+ TA+GE +     TAAH +LP  S V VTNM N  S+VVR+N
Sbjct: 27  GYDQTGTASYYGSRHHGKRTASGEPFNQHGFTAAHRSLPFGSRVLVTNMANQRSVVVRIN 86

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGP+   RLIDLS AAA+ + +   G ++V V+ L
Sbjct: 87  DRGPHTRGRLIDLSRAAAEKIGMLRSGTARVRVQGL 122


>gi|33863957|ref|NP_895517.1| rare lipoprotein A [Prochlorococcus marinus str. MIT 9313]
 gi|33635541|emb|CAE21865.1| possible rare lipoprotein A [Prochlorococcus marinus str. MIT 9313]
          Length = 199

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 67/111 (60%)

Query: 70  PYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           P   + R   P       + G ASWYG  F G  TA+GEV+    +TAAH +LP  + VR
Sbjct: 88  PVAKLNRPVKPTPTVVQVSTGEASWYGPGFFGNRTASGEVFRPGTMTAAHRSLPFGTKVR 147

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VTN+ N  S VV +NDRGP+ ++R+IDL++ AA  L +   G+++V +E L
Sbjct: 148 VTNLWNDRSAVVTINDRGPFIAHRVIDLAHGAAHELGLISSGIAQVRLEVL 198


>gi|146305887|ref|YP_001186352.1| rare lipoprotein A [Pseudomonas mendocina ymp]
 gi|145574088|gb|ABP83620.1| rare lipoprotein A [Pseudomonas mendocina ymp]
          Length = 140

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/89 (50%), Positives = 61/89 (68%)

Query: 92  ASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHS 151
           AS+YG   HGR TA+GE +  + +TAAH +LP  S V+VTN+ NG ++VVR+NDRGP+  
Sbjct: 51  ASYYGDRHHGRKTASGERFDQQALTAAHRSLPFGSRVKVTNLNNGRTVVVRINDRGPFVR 110

Query: 152 NRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            R+ID+S  AA+ L +   GV  V VE L
Sbjct: 111 GRIIDVSRRAAQQLDMLRSGVVPVRVEAL 139


>gi|56477179|ref|YP_158768.1| putative rare lipoprotein A [Aromatoleum aromaticum EbN1]
 gi|56313222|emb|CAI07867.1| putative rare lipoprotein A [Aromatoleum aromaticum EbN1]
          Length = 151

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 66/96 (68%), Gaps = 4/96 (4%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G+AS+Y ++ HGR TA+GE +    + AAHP+ PL ++VRVTN +NG ++VVR+NDRGP
Sbjct: 48  TGLASYYARSLHGRETASGETFDRTEMVAAHPSYPLGTHVRVTNRKNGRAVVVRINDRGP 107

Query: 149 YHSNR----LIDLSNAAAKILRVEERGVSKVHVEYL 180
              +R    +IDLS AAA  L + + G S+V VE L
Sbjct: 108 TKPSRKEGVIIDLSPAAAARLGMIKDGRSRVKVEVL 143


>gi|15639977|ref|NP_219430.1| rare lipoprotein A, putative [Treponema pallidum subsp. pallidum
           str. Nichols]
 gi|189026216|ref|YP_001933988.1| rare lipoprotein A [Treponema pallidum subsp. pallidum SS14]
 gi|20139376|sp|O83958|RLPA_TREPA RecName: Full=RlpA-like protein; Flags: Precursor
 gi|3323317|gb|AAC65949.1| rare lipoprotein A, putative [Treponema pallidum subsp. pallidum
           str. Nichols]
 gi|189018791|gb|ACD71409.1| possible rare lipoprotein A [Treponema pallidum subsp. pallidum
           SS14]
          Length = 318

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 63/89 (70%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+Y ++F+GR TA+GE++     TAAH TLP  + V +TN++NG  ++VR+NDRGPY
Sbjct: 30  GYASYYAESFNGRPTASGEIFDMNAYTAAHRTLPFGTVVELTNLDNGKKVIVRINDRGPY 89

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVE 178
            +NR ID+S AAA  L +   GV++V + 
Sbjct: 90  AANREIDVSKAAAVALDMLNAGVARVSIH 118


>gi|288817722|ref|YP_003432069.1| rare lipoprotein A [Hydrogenobacter thermophilus TK-6]
 gi|288787121|dbj|BAI68868.1| rare lipoprotein A [Hydrogenobacter thermophilus TK-6]
 gi|308751321|gb|ADO44804.1| rare lipoprotein A [Hydrogenobacter thermophilus TK-6]
          Length = 157

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/86 (48%), Positives = 58/86 (67%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYGK FHGR TA+GE +     TAA    PL +YV V N+EN   ++VR+ DRGP+
Sbjct: 45  GYASWYGKGFHGRRTASGESFDRYKYTAASKVFPLNTYVLVRNLENDQEVIVRITDRGPF 104

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKV 175
              R++DLS A+A+ L + ++G+ KV
Sbjct: 105 VKGRILDLSKASAEKLGILKKGIVKV 130


>gi|299136128|ref|ZP_07029312.1| rare lipoprotein A [Acidobacterium sp. MP5ACTX8]
 gi|298602252|gb|EFI58406.1| rare lipoprotein A [Acidobacterium sp. MP5ACTX8]
          Length = 261

 Score = 90.5 bits (223), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 59/94 (62%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  +H    A+G ++    +TAAH TLP+ S VRVTN+  G  ++VR+ DRGP+
Sbjct: 86  GTASWYGTIYHHHAAADGTIFDQNEMTAAHRTLPMGSTVRVTNLATGQQVLVRITDRGPF 145

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
              R++DLS  AAK + +   GV+KV VE    A
Sbjct: 146 APGRVLDLSMGAAKAVGIYRAGVAKVKVEAFAHA 179


>gi|330823289|ref|YP_004386592.1| rare lipoprotein A [Alicycliphilus denitrificans K601]
 gi|329308661|gb|AEB83076.1| rare lipoprotein A [Alicycliphilus denitrificans K601]
          Length = 250

 Score = 90.5 bits (223), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/94 (48%), Positives = 61/94 (64%)

Query: 88  AVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRG 147
           A G ASWY  + HGR TANGE Y  E  TAAH +LP  + + V ++ NG +++VRVNDRG
Sbjct: 106 ASGQASWYADSLHGRRTANGERYDREEFTAAHRSLPFGARLCVRSLVNGRTVIVRVNDRG 165

Query: 148 PYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           P+   R+IDLS AAA+ L +   G+  V +  LG
Sbjct: 166 PFTPGRIIDLSRAAAEELGMVGLGIKPVELWQLG 199


>gi|299136819|ref|ZP_07030002.1| rare lipoprotein A [Acidobacterium sp. MP5ACTX8]
 gi|298601334|gb|EFI57489.1| rare lipoprotein A [Acidobacterium sp. MP5ACTX8]
          Length = 194

 Score = 90.5 bits (223), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 59/90 (65%), Gaps = 2/90 (2%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
           VG ASWYG  F G  TA GE +    +T AH TLPL S+VRVTN+ N  +  +RVNDRGP
Sbjct: 76  VGKASWYGGRFQGHRTATGERFDMNALTCAHRTLPLGSWVRVTNLHNQKTTFLRVNDRGP 135

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
              N ++DLS AAAK L ++  G+ KV VE
Sbjct: 136 VAGNLIMDLSYAAAKKLGIQ--GLGKVKVE 163


>gi|312958974|ref|ZP_07773493.1| lipoprotein A [Pseudomonas fluorescens WH6]
 gi|311286744|gb|EFQ65306.1| lipoprotein A [Pseudomonas fluorescens WH6]
          Length = 123

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 62/96 (64%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
            Y   G AS+YG   HG+ TA+GE +    +TAAH  LP  + V+VTN++N  S+VVR+N
Sbjct: 26  GYDETGTASYYGARHHGKKTASGEPFNQNSLTAAHRRLPFGTQVKVTNLDNDKSVVVRIN 85

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGP+   RLIDLS  AA+ L +   G ++V V+ +
Sbjct: 86  DRGPHTRGRLIDLSRRAAEQLGMLRSGTARVRVQAM 121


>gi|262041276|ref|ZP_06014487.1| rare lipoprotein A [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|259041392|gb|EEW42452.1| rare lipoprotein A [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
          Length = 365

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 77/139 (55%), Gaps = 8/139 (5%)

Query: 68  GKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           GK Y+I+      +    +   G A+ Y    +  LTA+GE +    +TAAHPTLP+PSY
Sbjct: 65  GKSYKIV------QDPANFTQAGFAAIYDAEPNSNLTASGEAFDPTQLTAAHPTLPIPSY 118

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
            R+TN+ NG  +VVR+NDRGPY ++R+I LS A+A   R+     +KV ++ + +A    
Sbjct: 119 ARITNLANGRMIVVRINDRGPYGNDRVISLSRASAD--RLNTSNNTKVRIDPIIVAPDGS 176

Query: 188 MDQEYLRSTVMVNSATVLP 206
           +    +  T +      LP
Sbjct: 177 LSGPGMACTTVAKQTYALP 195


>gi|167031951|ref|YP_001667182.1| rare lipoprotein A [Pseudomonas putida GB-1]
 gi|166858439|gb|ABY96846.1| rare lipoprotein A [Pseudomonas putida GB-1]
          Length = 124

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 62/96 (64%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
            Y   G AS+YG   HG+ TA+GE +    +TAAH +LP  + V VTNM N  S+VVR+N
Sbjct: 27  GYDQTGTASYYGSRHHGKRTASGEPFNQHGLTAAHRSLPFGTRVLVTNMANQRSVVVRIN 86

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGP+   RLIDLS AAA+ + +   G ++V V+ L
Sbjct: 87  DRGPHTRGRLIDLSRAAAEKIGMLRSGTARVRVQGL 122


>gi|330006023|ref|ZP_08305466.1| putative rare lipoprotein A double-psi beta-barrel protein
           [Klebsiella sp. MS 92-3]
 gi|328536015|gb|EGF62425.1| putative rare lipoprotein A double-psi beta-barrel protein
           [Klebsiella sp. MS 92-3]
          Length = 206

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 78/139 (56%), Gaps = 8/139 (5%)

Query: 68  GKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           GK Y+I+     P  +T     G A+ Y    +  LTA+GE +    +TAAHPTLP+PSY
Sbjct: 65  GKSYKIVQD---PANFTQ---AGFAAIYDAEPNSNLTASGEAFDPTQLTAAHPTLPIPSY 118

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
            R+TN+ NG  +VVR+NDRGPY ++R+I LS A+A   R+     +KV ++ + +A    
Sbjct: 119 ARITNLANGRMIVVRINDRGPYGNDRVISLSRASAD--RLNTSNNTKVRIDPIIVAPDGS 176

Query: 188 MDQEYLRSTVMVNSATVLP 206
           +    +  T +      LP
Sbjct: 177 LSGPGMACTTVAKQTYALP 195


>gi|189347840|ref|YP_001944369.1| rare lipoprotein A [Chlorobium limicola DSM 245]
 gi|189341987|gb|ACD91390.1| rare lipoprotein A [Chlorobium limicola DSM 245]
          Length = 128

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 61/89 (68%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+Y   FHGR TA+GE +     TAAH TLP  + V+VTN++NG  +VVR+NDRGP+
Sbjct: 37  GKASYYANRFHGRKTASGETFRIHDFTAAHRTLPFGTSVKVTNLDNGKEVVVRINDRGPH 96

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVE 178
             +R++D+S AAA IL +  +G   V +E
Sbjct: 97  LKSRVLDVSPAAAHILGLIGKGTVNVRIE 125


>gi|206579479|ref|YP_002239712.1| rare lipoprotein A [Klebsiella pneumoniae 342]
 gi|288936554|ref|YP_003440613.1| lipoprotein A [Klebsiella variicola At-22]
 gi|290510390|ref|ZP_06549760.1| lipoprotein A [Klebsiella sp. 1_1_55]
 gi|206568537|gb|ACI10313.1| rare lipoprotein A [Klebsiella pneumoniae 342]
 gi|288891263|gb|ADC59581.1| rare lipoprotein A [Klebsiella variicola At-22]
 gi|289777106|gb|EFD85104.1| lipoprotein A [Klebsiella sp. 1_1_55]
          Length = 385

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 77/139 (55%), Gaps = 8/139 (5%)

Query: 68  GKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           GK Y+I+      +    +   G A+ Y    +  LTA+GE +    +TAAHPTLP+PSY
Sbjct: 65  GKSYKIV------QDPANFTQAGFAAIYDAEPNSNLTASGETFDPTQLTAAHPTLPIPSY 118

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
            R+TN+ NG  +VVR+NDRGPY ++R+I LS A+A   R+     +KV ++ + +A    
Sbjct: 119 ARITNLANGRMIVVRINDRGPYGNDRVISLSRASAD--RLNTSNNTKVRIDPIIVAPDGS 176

Query: 188 MDQEYLRSTVMVNSATVLP 206
           +    +  T +      LP
Sbjct: 177 LSGPGMACTTVAKQTYALP 195


>gi|295096611|emb|CBK85701.1| rare lipoprotein A [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 368

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 77/137 (56%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G A+ Y       LTA+GE +    ITAAHPTLP+PSY R
Sbjct: 62  YQRDGKSYKIVQDPSRFSQAGYAAIYDAEPGSNLTASGETFDPMQITAAHPTLPVPSYAR 121

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 122 ITNLANGRMIVVRINDRGPYGTDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAQDGSLS 179

Query: 190 QEYLRSTVMVNSATVLP 206
                 T +      LP
Sbjct: 180 GPGTACTTVAKQTYALP 196


>gi|152969236|ref|YP_001334345.1| rare lipoprotein A [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|150954085|gb|ABR76115.1| a minor lipoprotein [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
          Length = 382

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 77/139 (55%), Gaps = 8/139 (5%)

Query: 68  GKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           GK Y+I+      +    +   G A+ Y    +  LTA+GE +    +TAAHPTLP+PSY
Sbjct: 65  GKSYKIV------QDPANFTQAGFAAIYDAEPNSNLTASGEAFDPTQLTAAHPTLPIPSY 118

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
            R+TN+ NG  +VVR+NDRGPY ++R+I LS A+A   R+     +KV ++ + +A    
Sbjct: 119 ARITNLANGRMIVVRINDRGPYGNDRVISLSRASAD--RLNTSNNTKVRIDPIIVAPDGS 176

Query: 188 MDQEYLRSTVMVNSATVLP 206
           +    +  T +      LP
Sbjct: 177 LSGPGMACTTVAKQTYALP 195


>gi|319761424|ref|YP_004125361.1| rare lipoprotein a [Alicycliphilus denitrificans BC]
 gi|317115985|gb|ADU98473.1| rare lipoprotein A [Alicycliphilus denitrificans BC]
          Length = 172

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/94 (48%), Positives = 61/94 (64%)

Query: 88  AVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRG 147
           A G ASWY  + HGR TANGE Y  E  TAAH +LP  + + V ++ NG +++VRVNDRG
Sbjct: 28  ASGQASWYADSLHGRRTANGERYDREEFTAAHRSLPFGARLCVRSLVNGRTVIVRVNDRG 87

Query: 148 PYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           P+   R+IDLS AAA+ L +   G+  V +  LG
Sbjct: 88  PFTPGRIIDLSRAAAEELGMVGLGIKPVELWQLG 121


>gi|238893700|ref|YP_002918434.1| rare lipoprotein A [Klebsiella pneumoniae NTUH-K2044]
 gi|238546016|dbj|BAH62367.1| a minor lipoprotein [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 382

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 77/139 (55%), Gaps = 8/139 (5%)

Query: 68  GKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           GK Y+I+      +    +   G A+ Y    +  LTA+GE +    +TAAHPTLP+PSY
Sbjct: 65  GKSYKIV------QDPANFTQAGFAAIYDAEPNSNLTASGEAFDPTQLTAAHPTLPIPSY 118

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
            R+TN+ NG  +VVR+NDRGPY ++R+I LS A+A   R+     +KV ++ + +A    
Sbjct: 119 ARITNLANGRMIVVRINDRGPYGNDRVISLSRASAD--RLNTSNNTKVRIDPIIVAPDGS 176

Query: 188 MDQEYLRSTVMVNSATVLP 206
           +    +  T +      LP
Sbjct: 177 LSGPGMACTTVAKQTYALP 195


>gi|292491264|ref|YP_003526703.1| lipoprotein A [Nitrosococcus halophilus Nc4]
 gi|291579859|gb|ADE14316.1| rare lipoprotein A [Nitrosococcus halophilus Nc4]
          Length = 148

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 60/93 (64%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           Y   G  SWYG+A HGR TANG+V+    +TAAH +LP  + +RVTN +NG S+V+ VND
Sbjct: 51  YDEEGTTSWYGRAHHGRRTANGQVFDMNGLTAAHRSLPFGTKIRVTNQKNGRSVVLTVND 110

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           RGP+   R +D+S  AA+ L     G+  V V+
Sbjct: 111 RGPFVMGRFLDVSYRAARELGFVREGLVSVRVK 143


>gi|226943389|ref|YP_002798462.1| Rare lipoprotein A, RplA [Azotobacter vinelandii DJ]
 gi|226718316|gb|ACO77487.1| Rare lipoprotein A, RplA [Azotobacter vinelandii DJ]
          Length = 123

 Score = 89.7 bits (221), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/95 (50%), Positives = 63/95 (66%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           Y+A GMAS+Y    HG+ TA+GE      +TAAH TLPL S VRVT++    S+VVR+ND
Sbjct: 27  YSAEGMASYYASHHHGKRTASGEPVDRNTLTAAHRTLPLGSRVRVTSLSTRRSVVVRIND 86

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+   R+IDLS  AA+ L +   GV+ V +E L
Sbjct: 87  RGPHTHGRIIDLSYKAARQLEILHAGVALVRLELL 121


>gi|183598105|ref|ZP_02959598.1| hypothetical protein PROSTU_01469 [Providencia stuartii ATCC 25827]
 gi|188020263|gb|EDU58303.1| hypothetical protein PROSTU_01469 [Providencia stuartii ATCC 25827]
          Length = 325

 Score = 89.7 bits (221), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 57/155 (36%), Positives = 84/155 (54%), Gaps = 12/155 (7%)

Query: 18  VVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGKRV----PRGGGRYFL-GKPYQ 72
           ++LG+++   S    ++ ++  P ++  V A D + +        P     Y   G+ YQ
Sbjct: 6   IMLGITTALLSGCVTEENIKQ-PSNVPAVPAQDVLGAEPHYEPFHPTANSDYQRNGQQYQ 64

Query: 73  IMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTN 132
           I+      R  + ++ VG AS +G    G +TA GE      +TAAHPTLP+PSYVR+TN
Sbjct: 65  IV------RDASQFSQVGYASIFGSESAGNMTAIGERVNPIELTAAHPTLPIPSYVRITN 118

Query: 133 MENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRV 167
           M NG  +VVRVNDRGPY   + I +S A A  L +
Sbjct: 119 MMNGRMMVVRVNDRGPYTQGKSIAVSRAVADRLNL 153


>gi|302037357|ref|YP_003797679.1| putative lipoprotein [Candidatus Nitrospira defluvii]
 gi|300605421|emb|CBK41754.1| putative lipoprotein, RlpA-like [Candidatus Nitrospira defluvii]
          Length = 249

 Score = 89.7 bits (221), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 61/103 (59%)

Query: 78  YVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGI 137
           Y P     +   G ASWYG  FHG  TANGEVY    +TAAH TLPL S   V ++  G 
Sbjct: 52  YSPGYPLGFVERGSASWYGPGFHGNRTANGEVYDMHKLTAAHRTLPLGSVAVVRSLSTGR 111

Query: 138 SLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            ++VR+NDRGP+   R++DLS A A+ + +  RG  ++ +  +
Sbjct: 112 QVIVRINDRGPFARGRILDLSLAGAQAVGMVGRGTDEIELRVI 154


>gi|198283609|ref|YP_002219930.1| rare lipoprotein A [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218667599|ref|YP_002426236.1| rare lipoprotein A, putative [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|198248130|gb|ACH83723.1| rare lipoprotein A [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218519812|gb|ACK80398.1| rare lipoprotein A, putative [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 274

 Score = 89.7 bits (221), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 66/110 (60%), Gaps = 2/110 (1%)

Query: 69  KPYQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           +PYQ+ GR Y P   +A YA  GMASWYG    G  TA G  +     +AA   LPLP+ 
Sbjct: 57  RPYQVHGRIYAPLNSSAGYAVRGMASWYGWE-SGSTTAMGTPFRPRAFSAASRDLPLPTC 115

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
            RVTN+ NG S++V VNDRGP+   R +DLS  AA  L +  +GV+ V +
Sbjct: 116 ARVTNLSNGRSVIVLVNDRGPFVDGRAMDLSYGAANALGMAGQGVAPVEI 165


>gi|229588403|ref|YP_002870522.1| putative lipoprotein A-like protein [Pseudomonas fluorescens SBW25]
 gi|229360269|emb|CAY47126.1| putative lipoprotein A-like protein [Pseudomonas fluorescens SBW25]
          Length = 123

 Score = 89.7 bits (221), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 61/96 (63%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
            Y   G AS+YG   HG  TA+GE +    +TAAH  LP  + V+VTN++N  S+VVR+N
Sbjct: 26  GYDETGTASYYGAKHHGNKTASGEPFNQNALTAAHRRLPFGTQVKVTNLDNDRSVVVRIN 85

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGP+   RLIDLS  AA+ L +   G ++V V+ L
Sbjct: 86  DRGPHTRGRLIDLSRKAAEQLGMISSGTARVRVQAL 121


>gi|328950722|ref|YP_004368057.1| rare lipoprotein A [Marinithermus hydrothermalis DSM 14884]
 gi|328451046|gb|AEB11947.1| rare lipoprotein A [Marinithermus hydrothermalis DSM 14884]
          Length = 178

 Score = 89.7 bits (221), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 47/91 (51%), Positives = 61/91 (67%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+YG  FHGR TA+GEV+     TAAH TLP  + VRVT ++ G S+VVR+NDRGP+
Sbjct: 82  GYASYYGPKFHGRKTASGEVFDMYAYTAAHRTLPFGTRVRVTRLDTGKSVVVRINDRGPW 141

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R+IDLS  AA+ L +   GV  V +E +
Sbjct: 142 KEGRIIDLSYRAAQDLEMIGLGVVWVRLEVI 172


>gi|104780286|ref|YP_606784.1| RlpA family lipoprotein [Pseudomonas entomophila L48]
 gi|95109273|emb|CAK13970.1| putative lipoprotein, RplA family [Pseudomonas entomophila L48]
          Length = 124

 Score = 89.7 bits (221), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 62/96 (64%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
            Y   G AS+YG   HG+ TA+GE +    +TAAH +LP  S V VTN+ N  S+VVR+N
Sbjct: 27  GYNETGTASYYGSRHHGKRTASGEPFNQHGLTAAHRSLPFGSRVLVTNLNNQRSVVVRIN 86

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGP+   RLIDLS AAA+ + +   G ++V V+ L
Sbjct: 87  DRGPHTRGRLIDLSRAAAEKIGMLRSGTARVRVQGL 122


>gi|224550155|gb|ACN54162.1| lipoprotein [Wolbachia endosymbiont of Nasonia longicornis]
 gi|224550157|gb|ACN54163.1| lipoprotein [Wolbachia endosymbiont of Nasonia longicornis]
 gi|224550159|gb|ACN54164.1| lipoprotein [Wolbachia endosymbiont of Nasonia giraulti]
          Length = 68

 Score = 89.7 bits (221), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 53/66 (80%)

Query: 115 ITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSK 174
           I+AAH TLPLP +VRVTN+ENG  LV+RVNDRGP+   R+IDLS  AA++L + + G++K
Sbjct: 1   ISAAHKTLPLPCFVRVTNLENGRKLVIRVNDRGPFVEGRIIDLSEKAAQVLGLHKSGLAK 60

Query: 175 VHVEYL 180
           V VEYL
Sbjct: 61  VKVEYL 66


>gi|150007694|ref|YP_001302437.1| putative lipoprotein [Parabacteroides distasonis ATCC 8503]
 gi|149936118|gb|ABR42815.1| putative lipoprotein [Parabacteroides distasonis ATCC 8503]
          Length = 159

 Score = 89.4 bits (220), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 63/89 (70%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+AS+Y   FHGR +++G V+  E + AAH T P  +++RVTN+EN  S +V V DRGP 
Sbjct: 33  GLASYYHHRFHGRKSSSGRVHDKEELVAAHRTYPFGTFLRVTNLENMKSTIVCVTDRGPR 92

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           +  R+ID+S +AA+IL   ++GV+KV +E
Sbjct: 93  YRKRIIDVSASAAEILDFIDKGVAKVRIE 121


>gi|170723447|ref|YP_001751135.1| rare lipoprotein A [Pseudomonas putida W619]
 gi|169761450|gb|ACA74766.1| rare lipoprotein A [Pseudomonas putida W619]
          Length = 155

 Score = 89.4 bits (220), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 62/96 (64%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
            Y   G AS+YG   HG+ TA+GE +    +TAAH +LP  + V VTN+ N  S+VVR+N
Sbjct: 58  GYNQTGTASYYGARHHGKRTASGEAFNQHGLTAAHRSLPFGTRVLVTNLANQRSVVVRIN 117

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGP+   RLIDLS AAA+ + +   G ++V V+ L
Sbjct: 118 DRGPHTRGRLIDLSRAAAEKIGMIRSGTARVRVQGL 153


>gi|256839955|ref|ZP_05545464.1| conserved hypothetical protein [Parabacteroides sp. D13]
 gi|298375640|ref|ZP_06985597.1| RlpA family protein [Bacteroides sp. 3_1_19]
 gi|301310269|ref|ZP_07216208.1| RlpA family protein [Bacteroides sp. 20_3]
 gi|256738885|gb|EEU52210.1| conserved hypothetical protein [Parabacteroides sp. D13]
 gi|298268140|gb|EFI09796.1| RlpA family protein [Bacteroides sp. 3_1_19]
 gi|300831843|gb|EFK62474.1| RlpA family protein [Bacteroides sp. 20_3]
          Length = 153

 Score = 89.4 bits (220), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 63/89 (70%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+AS+Y   FHGR +++G V+  E + AAH T P  +++RVTN+EN  S +V V DRGP 
Sbjct: 27  GLASYYHHRFHGRKSSSGRVHDKEELVAAHRTYPFGTFLRVTNLENMKSTIVCVTDRGPR 86

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           +  R+ID+S +AA+IL   ++GV+KV +E
Sbjct: 87  YRKRIIDVSASAAEILDFIDKGVAKVRIE 115


>gi|264676674|ref|YP_003276580.1| lipoprotein A [Comamonas testosteroni CNB-2]
 gi|262207186|gb|ACY31284.1| rare lipoprotein A [Comamonas testosteroni CNB-2]
          Length = 247

 Score = 89.0 bits (219), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 45/92 (48%), Positives = 61/92 (66%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G+ASWYG+ FHGR TA+GE + +  +TAAH TLP  + V V +   G S+VVR+NDRGP
Sbjct: 105 AGLASWYGEQFHGRKTASGERFDSMDMTAAHKTLPFGTRVCVRSSVTGKSVVVRINDRGP 164

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +   R+IDLS AAA+ L +   G+  V +  L
Sbjct: 165 FAPGRVIDLSKAAAQELGMLGLGIKPVELWQL 196


>gi|86160388|ref|YP_467173.1| rare lipoprotein A [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85776899|gb|ABC83736.1| rare lipoprotein A [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 145

 Score = 89.0 bits (219), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 45/92 (48%), Positives = 64/92 (69%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
           VG+AS+YGK  HGR TA+G  +    +T AH T P  + ++VT++E+G S+VV+V DRGP
Sbjct: 51  VGLASYYGKRHHGRRTASGSRFDMHAMTCAHRTAPFGTRLKVTSLESGKSVVVKVTDRGP 110

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +   R++DLS AAA+ L + E GV +V VE L
Sbjct: 111 FAGGRVVDLSYAAARKLGMVEDGVVRVRVEPL 142


>gi|221069204|ref|ZP_03545309.1| rare lipoprotein A [Comamonas testosteroni KF-1]
 gi|220714227|gb|EED69595.1| rare lipoprotein A [Comamonas testosteroni KF-1]
          Length = 247

 Score = 89.0 bits (219), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 45/92 (48%), Positives = 61/92 (66%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G+ASWYG+ FHGR TA+GE + +  +TAAH TLP  + V V +   G S+VVR+NDRGP
Sbjct: 105 AGLASWYGEQFHGRKTASGERFDSMDMTAAHKTLPFGTRVCVRSSVTGKSVVVRINDRGP 164

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +   R+IDLS AAA+ L +   G+  V +  L
Sbjct: 165 FAPGRVIDLSKAAAQELGMLGLGIKPVELWQL 196


>gi|256419782|ref|YP_003120435.1| rare lipoprotein A [Chitinophaga pinensis DSM 2588]
 gi|256034690|gb|ACU58234.1| rare lipoprotein A [Chitinophaga pinensis DSM 2588]
          Length = 124

 Score = 89.0 bits (219), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 59/91 (64%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G AS+Y   F GR TA+GEV+    +TAAH TLP  + V V N+ NG S+ VR+NDRGP
Sbjct: 30  TGKASYYADKFEGRKTASGEVFRQGGLTAAHRTLPFGTKVTVINVSNGRSVKVRINDRGP 89

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEY 179
           +   R+IDLS  AAK + +   GV+ V V+Y
Sbjct: 90  FAEGRVIDLSKKAAKRIGMLTTGVAPVEVKY 120


>gi|296103401|ref|YP_003613547.1| rare lipoprotein A [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|295057860|gb|ADF62598.1| rare lipoprotein A [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 370

 Score = 89.0 bits (219), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 46/113 (40%), Positives = 70/113 (61%), Gaps = 8/113 (7%)

Query: 68  GKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           GK Y+I+      +  + ++  G A+ Y       LTA+GE +    +TAAHPTLP+PSY
Sbjct: 66  GKSYKIV------QDPSRFSQAGFAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSY 119

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            R+TN+ NG  +VVR+NDRGPY ++R+I LS A+A   R+     +KV ++ +
Sbjct: 120 ARITNLANGRMIVVRINDRGPYGNDRVISLSRASAD--RLNTSNNTKVRIDPI 170


>gi|294341479|emb|CAZ89896.1| putative rare lipoprotein A [Thiomonas sp. 3As]
          Length = 385

 Score = 89.0 bits (219), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 67/111 (60%), Gaps = 2/111 (1%)

Query: 71  YQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + GR Y P R    Y  VG+ASWYG    G  T+ G  +     +AA   LPLP+ V+
Sbjct: 74  YTVRGRSYSPLRNADGYDEVGIASWYGWE-SGTTTSMGTRFNPRDFSAASRVLPLPTCVQ 132

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VTN++NG+S +V VNDRGP+ S RL+DLS  AA+ L V   G ++V +  L
Sbjct: 133 VTNLDNGLSALVLVNDRGPFVSGRLLDLSMGAAQALGVTRTGTARVRIVAL 183


>gi|255013601|ref|ZP_05285727.1| putative lipoprotein [Bacteroides sp. 2_1_7]
 gi|262381797|ref|ZP_06074935.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
 gi|262296974|gb|EEY84904.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
          Length = 153

 Score = 89.0 bits (219), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 63/89 (70%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+AS+Y   FHGR +++G ++  E + AAH T P  +++RVTN+EN  S +V V DRGP 
Sbjct: 27  GLASYYHHRFHGRKSSSGRIHDKEELVAAHRTYPFGTFLRVTNLENMKSTIVCVTDRGPR 86

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           +  R+ID+S +AA+IL   ++GV+KV +E
Sbjct: 87  YRKRIIDVSASAAEILDFIDKGVAKVRIE 115


>gi|291326468|ref|ZP_06124636.2| lipoprotein A [Providencia rettgeri DSM 1131]
 gi|291314329|gb|EFE54782.1| lipoprotein A [Providencia rettgeri DSM 1131]
          Length = 328

 Score = 89.0 bits (219), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 51/116 (43%), Positives = 70/116 (60%), Gaps = 8/116 (6%)

Query: 68  GKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           G+ YQI+      R  + ++ VG AS YG    G +TA GE      +TAAHPTLP+PSY
Sbjct: 64  GQQYQIV------RDPSQFSQVGYASIYGAESAGNMTAIGERVNPVELTAAHPTLPIPSY 117

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VR+TNM NG  +VVRVNDRGPY   + I +S A A   R+     +K+ ++ + +A
Sbjct: 118 VRITNMMNGRMMVVRVNDRGPYVPGKSIAVSRATAD--RLNLMPTTKIKIDAIQVA 171


>gi|299529490|ref|ZP_07042927.1| rare lipoprotein A [Comamonas testosteroni S44]
 gi|298722353|gb|EFI63273.1| rare lipoprotein A [Comamonas testosteroni S44]
          Length = 225

 Score = 89.0 bits (219), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 85/171 (49%), Gaps = 22/171 (12%)

Query: 11  KGSVVCVVVLGMSSCFFSSTYKDDKLEYFPESMYGVTASDRIVSGK-RVPRGGGRYFLGK 69
           KG+   V    +   +  S Y+D  L        GV A+    + K  +P    +Y L  
Sbjct: 25  KGAQPTVSAPLLPDAYARSNYRDKGL--------GVKANKPADADKADLPEDSNKYELSP 76

Query: 70  PYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           P +                 G+ASWYG+ FHGR TA+GE + +  +TAAH TLP  + V 
Sbjct: 77  PRE-------------SDQAGLASWYGEQFHGRKTASGERFDSMDMTAAHKTLPFGTRVC 123

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           V +   G S+VVR+NDRGP+   R+IDLS AAA+ L +   G+  V +  L
Sbjct: 124 VRSSVTGKSVVVRINDRGPFAPGRVIDLSKAAAQELGMLGLGIKPVELWQL 174


>gi|296137181|ref|YP_003644423.1| rare lipoprotein A [Thiomonas intermedia K12]
 gi|295797303|gb|ADG32093.1| rare lipoprotein A [Thiomonas intermedia K12]
          Length = 385

 Score = 89.0 bits (219), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 67/111 (60%), Gaps = 2/111 (1%)

Query: 71  YQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           Y + GR Y P R    Y  VG+ASWYG    G  T+ G  +     +AA   LPLP+ V+
Sbjct: 74  YTVRGRSYSPLRNADGYDEVGIASWYGWE-SGTTTSMGTRFNPRDFSAASRVLPLPTCVQ 132

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VTN++NG+S +V VNDRGP+ S RL+DLS  AA+ L V   G ++V +  L
Sbjct: 133 VTNLDNGLSALVLVNDRGPFVSGRLLDLSMGAAQALGVTRTGTARVRIVAL 183


>gi|119945475|ref|YP_943155.1| rare lipoprotein A [Psychromonas ingrahamii 37]
 gi|119864079|gb|ABM03556.1| rare lipoprotein A [Psychromonas ingrahamii 37]
          Length = 127

 Score = 89.0 bits (219), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 61/102 (59%)

Query: 79  VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGIS 138
           + R    Y  VG AS+Y   F GRLTA+G V+     TAAH  L   S V+VTN+ NG S
Sbjct: 25  LSRSRDGYKEVGKASFYANKFQGRLTASGAVFDQNAKTAAHKKLSFGSKVKVTNLTNGKS 84

Query: 139 LVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           ++V +NDRGP+   R+IDL  +A  ++   + GV KV +E +
Sbjct: 85  IMVIINDRGPFVKGRIIDLLRSAFSLIGSLDSGVIKVRIEVV 126


>gi|303237829|ref|ZP_07324386.1| lipoprotein A-like protein [Prevotella disiens FB035-09AN]
 gi|302481975|gb|EFL45013.1| lipoprotein A-like protein [Prevotella disiens FB035-09AN]
          Length = 234

 Score = 88.6 bits (218), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 59/91 (64%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+YG + HGR  +NGE Y     T AH TLP  + +RVTN +NG S +VRV DRGP+
Sbjct: 29  GKASYYGNSLHGRKMSNGERYDRNDFTCAHRTLPFGTQLRVTNTKNGNSCIVRVTDRGPF 88

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R++DLS AAA+ L +   GV+ + VE +
Sbjct: 89  IKGRIVDLSYAAARELGMLSAGVAYIKVEVM 119


>gi|289807551|ref|ZP_06538180.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Typhi str. AG3]
          Length = 251

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE++    +TAAHPTLP+PSY R
Sbjct: 63  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEMFDPMQLTAAHPTLPIPSYAR 122

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRG Y ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 123 ITNLANGRMIVVRINDRGLYGTDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAPDGSLS 180

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 181 GPGMACTTVAKQTYALP 197


>gi|220919196|ref|YP_002494500.1| rare lipoprotein A [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219957050|gb|ACL67434.1| rare lipoprotein A [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 144

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/90 (47%), Positives = 63/90 (70%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
           VG+AS+YGK  HGR TA+G  +    +T AH T P  + ++VT++E+G S+VV+V DRGP
Sbjct: 50  VGLASYYGKRHHGRRTASGSRFDMHAMTCAHRTAPFGTRLKVTSLESGKSVVVKVTDRGP 109

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           +   R++DLS AAA+ L + E GV +V +E
Sbjct: 110 FAGGRVVDLSYAAARKLGMVEDGVVRVRIE 139


>gi|213647790|ref|ZP_03377843.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Typhi str. J185]
          Length = 258

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE++    +TAAHPTLP+PSY R
Sbjct: 63  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEMFDPMQLTAAHPTLPIPSYAR 122

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRG Y ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 123 ITNLANGRMIVVRINDRGLYGTDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAPDGSLS 180

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 181 GPGMACTTVAKQTYALP 197


>gi|171910225|ref|ZP_02925695.1| RlpA-like lipoprotein precursor [Verrucomicrobium spinosum DSM
           4136]
          Length = 181

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/173 (34%), Positives = 84/173 (48%), Gaps = 9/173 (5%)

Query: 14  VVCVVVLGMSSCFFSSTYKDDKLEYFPE---SMYGVTASDRIVSGKRVPRGGGRYFLGKP 70
           +   VV+  +S   +   KD+ +E  PE   +   V A   +   +R+         G  
Sbjct: 3   IATTVVMTGASIMLNDYRKDEFVEITPEESGADAAVDAEHDVQDAQRIQAA----VRGLM 58

Query: 71  YQIMGRWYVPRQYTAYAAV--GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV 128
            +        +Q      V  G+AS YG  F+GR TANGE+Y     TAAH  LP  + V
Sbjct: 59  VKAQASLDTRKQLRPAGKVEKGIASSYGNGFNGRKTANGEIYNQNTYTAAHKKLPFGTKV 118

Query: 129 RVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
            V N+ NG  +VVR+N+RGPY   R+ID+S  AAK L + + GV  V V  L 
Sbjct: 119 LVKNLRNGREVVVRINNRGPYVRGRIIDVSLKAAKDLGMLKAGVVPVEVTVLA 171


>gi|124514466|gb|EAY55979.1| Rare lipoprotein A family protein [Leptospirillum rubarum]
          Length = 263

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 64/99 (64%), Gaps = 5/99 (5%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G+ASWYG  F+G+ TA+G ++    +TAAH TLPL + VRV N+ENG S+ V +NDRGP
Sbjct: 84  TGIASWYGPTFYGKRTASGAIFRKNALTAAHRTLPLGTRVRVENLENGRSVDVVINDRGP 143

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
           +   R+IDLS  AA  + +  RG + V      + +LNG
Sbjct: 144 FVRGRVIDLSWKAANAIGMLGRGTAPVR-----LTVLNG 177


>gi|206602641|gb|EDZ39122.1| Rare lipoprotein A family protein [Leptospirillum sp. Group II
           '5-way CG']
          Length = 263

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 64/99 (64%), Gaps = 5/99 (5%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G+ASWYG  F+G+ TA+G ++    +TAAH TLPL + VRV N+ENG S+ V +NDRGP
Sbjct: 84  TGIASWYGPTFYGKRTASGAIFRKNALTAAHRTLPLGTRVRVENLENGRSVDVVINDRGP 143

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNG 187
           +   R+IDLS  AA  + +  RG + V      + +LNG
Sbjct: 144 FVRGRVIDLSWKAANAIGMLGRGTAPVR-----LTVLNG 177


>gi|326576032|gb|EGE25955.1| RplA-like rare lipoprotein A family protein [Moraxella catarrhalis
           CO72]
          Length = 189

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/76 (52%), Positives = 57/76 (75%), Gaps = 2/76 (2%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG+ FHGR TA+GE +    +TAAH +LP+  +VRVTN +NG S+VV++NDR   
Sbjct: 101 GIASWYGRQFHGRKTASGETFDMNALTAAHSSLPMNCHVRVTNRDNGKSVVVKINDR--P 158

Query: 150 HSNRLIDLSNAAAKIL 165
            +NR++DLS  AA+ +
Sbjct: 159 KTNRVLDLSYGAAQAI 174


>gi|296113424|ref|YP_003627362.1| RplA-like rare lipoprotein A family protein [Moraxella catarrhalis
           RH4]
 gi|295921118|gb|ADG61469.1| RplA-like rare lipoprotein A family protein [Moraxella catarrhalis
           RH4]
 gi|326559909|gb|EGE10309.1| RplA-like rare lipoprotein A family protein [Moraxella catarrhalis
           7169]
 gi|326561229|gb|EGE11593.1| RplA-like rare lipoprotein A family protein [Moraxella catarrhalis
           103P14B1]
 gi|326567295|gb|EGE17412.1| RplA-like rare lipoprotein A family protein [Moraxella catarrhalis
           12P80B1]
 gi|326570086|gb|EGE20131.1| RplA-like rare lipoprotein A family protein [Moraxella catarrhalis
           BC8]
 gi|326570826|gb|EGE20850.1| RplA-like rare lipoprotein A family protein [Moraxella catarrhalis
           BC7]
 gi|326573599|gb|EGE23559.1| RplA-like rare lipoprotein A family protein [Moraxella catarrhalis
           101P30B1]
 gi|326576100|gb|EGE26017.1| RplA-like rare lipoprotein A family protein [Moraxella catarrhalis
           O35E]
          Length = 189

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/76 (52%), Positives = 57/76 (75%), Gaps = 2/76 (2%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG+ FHGR TA+GE +    +TAAH +LP+  +VRVTN +NG S+VV++NDR   
Sbjct: 101 GIASWYGRQFHGRKTASGETFDMNALTAAHSSLPMNCHVRVTNRDNGKSVVVKINDR--P 158

Query: 150 HSNRLIDLSNAAAKIL 165
            +NR++DLS  AA+ +
Sbjct: 159 KTNRVLDLSYGAAQAI 174


>gi|16759597|ref|NP_455214.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|29142630|ref|NP_805972.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|213160843|ref|ZP_03346553.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Typhi str. E00-7866]
 gi|213418401|ref|ZP_03351467.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Typhi str. E01-6750]
 gi|213425099|ref|ZP_03357849.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Typhi str. E02-1180]
 gi|213613285|ref|ZP_03371111.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-2068]
 gi|213857664|ref|ZP_03384635.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Typhi str. M223]
 gi|289823663|ref|ZP_06543275.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-3139]
 gi|20139498|sp|Q8Z8I0|RLPA_SALTI RecName: Full=Rare lipoprotein A; Flags: Precursor
 gi|25298599|pir||AI0580 rare lipoprotein A precursor [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16501889|emb|CAD05115.1| rare lipoprotein A precursor [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29138261|gb|AAO69832.1| rare lipoprotein A precursor [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 377

 Score = 87.8 bits (216), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 79/137 (57%), Gaps = 3/137 (2%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y + +  + ++  G+A+ Y       LTA+GE++    +TAAHPTLP+PSY R
Sbjct: 63  YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEMFDPMQLTAAHPTLPIPSYAR 122

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMD 189
           +TN+ NG  +VVR+NDRG Y ++R+I LS AAA   R+     +KV ++ + +A    + 
Sbjct: 123 ITNLANGRMIVVRINDRGLYGTDRVISLSRAAAD--RLNTSNNTKVRIDPIIVAPDGSLS 180

Query: 190 QEYLRSTVMVNSATVLP 206
              +  T +      LP
Sbjct: 181 GPGMACTTVAKQTYALP 197


>gi|218961303|ref|YP_001741078.1| hypothetical protein CLOAM1000 [Candidatus Cloacamonas
           acidaminovorans]
 gi|167729960|emb|CAO80872.1| hypothetical protein CLOAM1000 [Candidatus Cloacamonas
           acidaminovorans]
          Length = 147

 Score = 87.8 bits (216), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/90 (48%), Positives = 60/90 (66%)

Query: 91  MASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYH 150
           +A++Y K F GR TA+GE Y  + +T AH TLP  + +++TN  N  S++VRVNDRGP++
Sbjct: 46  VATYYSKRFQGRKTASGERYNRDALTCAHKTLPFQTLLKITNPRNSKSVIVRVNDRGPFN 105

Query: 151 SNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
             R IDLS AAAK + +   GV  V VE L
Sbjct: 106 RGRDIDLSYAAAKEIGMLSAGVIPVQVEIL 135


>gi|326562635|gb|EGE12939.1| RplA-like rare lipoprotein A family protein [Moraxella catarrhalis
           46P47B1]
 gi|326569607|gb|EGE19659.1| RplA-like rare lipoprotein A family protein [Moraxella catarrhalis
           BC1]
          Length = 189

 Score = 87.8 bits (216), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/76 (52%), Positives = 57/76 (75%), Gaps = 2/76 (2%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG+ FHGR TA+GE +    +TAAH +LP+  +VRVTN +NG S+VV++NDR   
Sbjct: 101 GIASWYGRQFHGRKTASGETFDMNALTAAHSSLPMNCHVRVTNRDNGKSVVVKINDR--P 158

Query: 150 HSNRLIDLSNAAAKIL 165
            +NR++DLS  AA+ +
Sbjct: 159 KTNRVLDLSYGAAQAI 174


>gi|329113406|ref|ZP_08242187.1| RlpA-like lipoprotein [Acetobacter pomorum DM001]
 gi|326697231|gb|EGE48891.1| RlpA-like lipoprotein [Acetobacter pomorum DM001]
          Length = 288

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 62/103 (60%)

Query: 65  YFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPL 124
           Y +G  +Q   +W+ PR+  A+   G+A        G LTA+GEV+    +T +H  L L
Sbjct: 28  YTVGPAWQAGNKWFYPREDFAWQGTGLAVREPPQAEGHLTADGEVWRAASMTGSHQILQL 87

Query: 125 PSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRV 167
           P+ VRVTN++NG  +V+R+NDRGP    R+I LS  AA +L V
Sbjct: 88  PAVVRVTNLDNGRQIVIRLNDRGPNDPGRMIGLSPRAADLLGV 130


>gi|311748453|ref|ZP_07722238.1| rare lipoprotein A [Algoriphagus sp. PR1]
 gi|126576968|gb|EAZ81216.1| rare lipoprotein A [Algoriphagus sp. PR1]
          Length = 190

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/88 (48%), Positives = 62/88 (70%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+AS+YGK FH R T+NGE++  + +TAAH TLP  + ++VT +E   ++ VRVNDR P 
Sbjct: 49  GIASFYGKRFHLRKTSNGEIFHMDSLTAAHKTLPFGTVLKVTRIETRGTVYVRVNDRLPR 108

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHV 177
           +S R+IDLS AAA  L +   G+S+V +
Sbjct: 109 YSRRMIDLSRAAATQLDMIHDGISRVKL 136


>gi|91789968|ref|YP_550920.1| rare lipoprotein A [Polaromonas sp. JS666]
 gi|91699193|gb|ABE46022.1| rare lipoprotein A [Polaromonas sp. JS666]
          Length = 213

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 57/86 (66%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  FHGR TA+GE Y    +TAAH TLP  + VRV ++  G  + VR+NDRGP+
Sbjct: 91  GQASWYGPRFHGRRTASGERYDMHALTAAHKTLPFGTLVRVRSLVTGREVEVRINDRGPF 150

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKV 175
            + R+ID+S AAA+ L +   GV  V
Sbjct: 151 GAGRVIDVSRAAAEALGMMGLGVKDV 176


>gi|152994672|ref|YP_001339507.1| rare lipoprotein A [Marinomonas sp. MWYL1]
 gi|150835596|gb|ABR69572.1| rare lipoprotein A [Marinomonas sp. MWYL1]
          Length = 127

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 61/91 (67%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+Y   + GR TA+GE++  + +TAAH  LP  S V+VTN+ NG S++VRVNDRGP+
Sbjct: 36  GGASYYAMKYQGRKTASGELFDQKAMTAAHKRLPFGSKVKVTNVANGKSVIVRVNDRGPF 95

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R+IDLS +A + +     GV +V +E L
Sbjct: 96  VRGRIIDLSKSAFQRIGNARDGVIEVEIEVL 126


>gi|121603405|ref|YP_980734.1| rare lipoprotein A [Polaromonas naphthalenivorans CJ2]
 gi|120592374|gb|ABM35813.1| rare lipoprotein A [Polaromonas naphthalenivorans CJ2]
          Length = 238

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 59/88 (67%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  FHGR TA+GE Y    +TAAH TLP  + VRV ++  G  + VR+NDRGP+
Sbjct: 120 GHASWYGGQFHGRRTASGENYDKYALTAAHKTLPFGTIVRVRSLALGREVDVRINDRGPF 179

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHV 177
              R+ID+S AAA+ L +   GV++V +
Sbjct: 180 APGRVIDVSQAAAEALGLMGAGVAEVSL 207


>gi|114327735|ref|YP_744892.1| lipoprotein [Granulibacter bethesdensis CGDNIH1]
 gi|114315909|gb|ABI61969.1| lipoprotein [Granulibacter bethesdensis CGDNIH1]
          Length = 315

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 69/112 (61%), Gaps = 3/112 (2%)

Query: 67  LGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS 126
           +G PYQ+   WY P +       G+A+        RLTA+GE Y  + + AAH TL LP+
Sbjct: 45  VGAPYQVGDVWYYPAEQIRLTQTGLAT-VDTDTSSRLTADGERYDPQALAAAHQTLQLPA 103

Query: 127 YVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
            V +TN+ENG SL +RVNDRGP   +RL+ L+  AA++L ++  G +K+ ++
Sbjct: 104 IVWITNLENGRSLRLRVNDRGPASPSRLVSLTPRAAELLGIQ--GATKIRLD 153


>gi|160901347|ref|YP_001566929.1| rare lipoprotein A [Delftia acidovorans SPH-1]
 gi|160366931|gb|ABX38544.1| rare lipoprotein A [Delftia acidovorans SPH-1]
          Length = 303

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 73/143 (51%), Gaps = 7/143 (4%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG   HGRLTA+GE +  E +TAAH +    S V V +   G ++VVR+NDRGP+
Sbjct: 117 GLASWYGPGLHGRLTASGERFDKEELTAAHRSFAFGSRVCVRSAATGRTVVVRINDRGPF 176

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHV-------EYLGMALLNGMDQEYLRSTVMVNSA 202
              R+IDLS AAA+ L +   G+  V +       E     L+     E L+ T      
Sbjct: 177 APGRVIDLSQAAAQELGMVGLGIKPVELWQLDEGEEECPETLVTARKAESLKKTQQAKGQ 236

Query: 203 TVLPLGCQYREEIVVIPYLLTRS 225
           T      Q + +  V P +  ++
Sbjct: 237 TQTQARTQVQAKAPVRPRVQAKA 259


>gi|330501854|ref|YP_004378723.1| rare lipoprotein A [Pseudomonas mendocina NK-01]
 gi|328916140|gb|AEB56971.1| rare lipoprotein A [Pseudomonas mendocina NK-01]
          Length = 140

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 60/92 (65%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G AS+YG   HG+ TA+GE +    +TAAH TLP  + VRVTN+ N  S+V+R+NDRGP
Sbjct: 48  TGKASYYGDRHHGQRTASGERFDQNALTAAHRTLPFGTRVRVTNLNNERSVVLRINDRGP 107

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +   R+ID+S AAA  L +   GV  V VE L
Sbjct: 108 FVRGRVIDVSRAAAVRLDMLRAGVVPVRVEAL 139


>gi|296282648|ref|ZP_06860646.1| hypothetical protein CbatJ_03450 [Citromicrobium bathyomarinum
           JL354]
          Length = 194

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/91 (50%), Positives = 60/91 (65%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+AS+YG  F+GR TA+GE +    +TAAH TLP  + VRVTN   G S+VVR+NDRGPY
Sbjct: 103 GVASYYGARFNGRPTASGERFDMNALTAAHKTLPFGTRVRVTNPRTGKSVVVRINDRGPY 162

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R ID+S AAA  L + +RG   V +  +
Sbjct: 163 AHGREIDVSRAAAVELGLIQRGHGTVELALI 193


>gi|146310826|ref|YP_001175900.1| rare lipoprotein A [Enterobacter sp. 638]
 gi|145317702|gb|ABP59849.1| rare lipoprotein A [Enterobacter sp. 638]
          Length = 365

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 68/108 (62%), Gaps = 2/108 (1%)

Query: 76  RWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMEN 135
           R+ + +  + ++  G A+ Y        TA+GE +    ITAAH TLP+PSYVRVTN+ N
Sbjct: 68  RYKIVQDPSRFSQAGFAAIYDAEPGSNQTASGEAFDPMQITAAHATLPIPSYVRVTNLAN 127

Query: 136 GISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           G  +VVR+NDRGPY ++R+I LS AAA   R+     +KV ++ + +A
Sbjct: 128 GRMIVVRINDRGPYGTDRVISLSRAAAD--RLNTSNNTKVRIDPIIVA 173


>gi|315127151|ref|YP_004069154.1| rlpA-like lipoprotein precursor [Pseudoalteromonas sp. SM9913]
 gi|315015665|gb|ADT69003.1| rlpA-like lipoprotein precursor [Pseudoalteromonas sp. SM9913]
          Length = 135

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 64/111 (57%), Gaps = 6/111 (5%)

Query: 70  PYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           P QI+       Q +  +  G AS+Y   +HGR TANGE +  +  TAAH  LP  + V+
Sbjct: 23  PRQIIN------QQSDMSERGKASFYADKYHGRTTANGERFSQQAATAAHLRLPFGTKVK 76

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VTN+ N  S+VVR+NDRGPY   R+IDLS A  K +   + GV  V V  +
Sbjct: 77  VTNIANNKSVVVRINDRGPYIRGRIIDLSKAMFKKIADPKVGVIDVTVTVI 127


>gi|330829540|ref|YP_004392492.1| Rare lipoprotein A [Aeromonas veronii B565]
 gi|328804676|gb|AEB49875.1| Rare lipoprotein A [Aeromonas veronii B565]
          Length = 128

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 61/98 (62%)

Query: 83  YTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVR 142
           +  Y+  G AS+Y   +HG+ TA+GE+Y     +AAH  LP  + VRVTN+ NG S+VV+
Sbjct: 31  WRGYSETGYASYYADRYHGKKTASGEIYRNNLNSAAHMELPFGAMVRVTNLANGKSVVVK 90

Query: 143 VNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VNDRG +   R+IDLS +A   +     G+ KV +E L
Sbjct: 91  VNDRGAFKKGRIIDLSKSAFSTIGNIRDGIIKVKIEVL 128


>gi|188584687|ref|YP_001916232.1| rare lipoprotein A [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179349374|gb|ACB83644.1| rare lipoprotein A [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 283

 Score = 87.0 bits (214), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/94 (46%), Positives = 58/94 (61%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
              G ASWYG  FHG  T +GE+Y    +TAAHP+LP+ S V V     G S++VR+NDR
Sbjct: 186 TETGEASWYGARFHGNRTFSGEIYDMYDLTAAHPSLPMNSLVHVEFPVTGESVIVRINDR 245

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           GP+   R+IDLS  AA+ + +   GV  V V+ L
Sbjct: 246 GPHVGGRIIDLSKQAAEKIGLAPHGVGDVKVKVL 279


>gi|37520717|ref|NP_924094.1| hypothetical protein glr1148 [Gloeobacter violaceus PCC 7421]
 gi|35211712|dbj|BAC89089.1| glr1148 [Gloeobacter violaceus PCC 7421]
          Length = 351

 Score = 87.0 bits (214), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 60/91 (65%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG  F  R T++G V   + + AAHP LP  + +RVTN+ NG  + V+V DRGP+
Sbjct: 260 GVASWYGHTFLNRRTSSGTVLREDSLIAAHPALPFGTQLRVTNLGNGRQVTVKVQDRGPF 319

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R+IDLS  AA++L +   G+++V VE +
Sbjct: 320 IRGRVIDLSPRAAQLLGMVSSGLARVKVEVI 350


>gi|220921469|ref|YP_002496770.1| rare lipoprotein A [Methylobacterium nodulans ORS 2060]
 gi|219946075|gb|ACL56467.1| rare lipoprotein A [Methylobacterium nodulans ORS 2060]
          Length = 124

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 63/97 (64%), Gaps = 5/97 (5%)

Query: 84  TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRV 143
           TA A  G ASWY     G+ TANGE +    +TAAH +LP  S VRVTN  NG S+VVR+
Sbjct: 32  TAAAQTGGASWYAS---GQRTANGERFNPNDLTAAHRSLPFGSRVRVTNTANGRSVVVRI 88

Query: 144 NDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           NDRGP+   R+IDLS A+A+ + +   GV+ V +E +
Sbjct: 89  NDRGPFARGRIIDLSRASARAIGMG--GVTHVALERI 123


>gi|254470575|ref|ZP_05083979.1| rare lipoprotein A [Pseudovibrio sp. JE062]
 gi|211960886|gb|EEA96082.1| rare lipoprotein A [Pseudovibrio sp. JE062]
          Length = 163

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 66/112 (58%), Gaps = 11/112 (9%)

Query: 66  FLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLP 125
           F+ +P+Q+        +    +  G ASWY        TA+GE+     +TAAH TLP+ 
Sbjct: 32  FILRPHQV--------EIKTSSQCGEASWYALTSQ---TASGEMMDPSKLTAAHLTLPMG 80

Query: 126 SYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           + V VTN+ NG SL VR+NDRGPY  NRLIDLS AAA  L   + GV++V +
Sbjct: 81  TRVLVTNLTNGKSLTVRINDRGPYAQNRLIDLSKAAAAELGFIKSGVTQVKI 132


>gi|300023899|ref|YP_003756510.1| lipoprotein A [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525720|gb|ADJ24189.1| rare lipoprotein A [Hyphomicrobium denitrificans ATCC 51888]
          Length = 195

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 65/95 (68%), Gaps = 3/95 (3%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
           A+ GMAS+Y   + G++TA+G  +    +TAAH +LP  + VRVTN  NG S+VV +NDR
Sbjct: 102 ASSGMASYY---WQGQMTASGVRFNPSALTAAHRSLPFGTRVRVTNRSNGRSVVVTINDR 158

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           GP+   R+IDLS AAA+ + +  +GV+ V +E LG
Sbjct: 159 GPFIGGRIIDLSRAAAQAISMTGQGVAAVSLEVLG 193


>gi|332186111|ref|ZP_08387857.1| rare lipoA family protein [Sphingomonas sp. S17]
 gi|332013926|gb|EGI55985.1| rare lipoA family protein [Sphingomonas sp. S17]
          Length = 227

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 61/99 (61%)

Query: 82  QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVV 141
           +Y +Y A G ASWYG    GR TA G+ +  + +  AH TLPL S V VT+++ G ++V 
Sbjct: 33  RYGSYQATGRASWYGHELAGRRTATGKRFNPDDVMIAHRTLPLESMVEVTDVDTGRTIVA 92

Query: 142 RVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RV DRGP  ++R+ DLS  AA++L    R V+ + +  L
Sbjct: 93  RVGDRGPGRADRVADLSLGAARLLGTNRRAVANIRLRAL 131


>gi|296391195|ref|ZP_06880670.1| rare lipoprotein A [Pseudomonas aeruginosa PAb1]
          Length = 127

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 62/97 (63%)

Query: 84  TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRV 143
           +  A  G AS+YG    G  TA+GE Y    +TAAH TLP  + VRVTN++N  S+VVR+
Sbjct: 30  SGSADTGEASYYGSRHAGLRTASGERYNPNAMTAAHRTLPFGTRVRVTNLDNRRSVVVRI 89

Query: 144 NDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           NDRGP+   R+ID+S  AA+ L +   GV+ V +E L
Sbjct: 90  NDRGPFRRGRIIDVSRKAAEGLGMIRSGVAPVRIESL 126


>gi|124009402|ref|ZP_01694079.1| rAre lipoprotein a rlpa [Microscilla marina ATCC 23134]
 gi|123984950|gb|EAY24908.1| rAre lipoprotein a rlpa [Microscilla marina ATCC 23134]
          Length = 248

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 61/92 (66%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+AS+Y   F GR TA+GE++    +  +H  LP  + V+VTN+ N  S+VVR+NDRGPY
Sbjct: 20  GIASYYTDRFDGRKTASGEIFDNRELVGSHKKLPFNTMVKVTNLANKRSVVVRINDRGPY 79

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
              R+ID+S +AA ++ +   G +KV ++ +G
Sbjct: 80  AHGRIIDVSKSAANLIGLYATGTAKVLIQAVG 111


>gi|218893577|ref|YP_002442446.1| putative rplA family protein [Pseudomonas aeruginosa LESB58]
 gi|218773805|emb|CAW29619.1| putative rplA family protein [Pseudomonas aeruginosa LESB58]
          Length = 125

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 62/97 (63%)

Query: 84  TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRV 143
           +  A  G AS+YG    G  TA+GE Y    +TAAH TLP  + VRVTN++N  S+VVR+
Sbjct: 28  SGSADTGEASYYGSRHAGLRTASGERYNPNAMTAAHRTLPFGTRVRVTNLDNRRSVVVRI 87

Query: 144 NDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           NDRGP+   R+ID+S  AA+ L +   GV+ V +E L
Sbjct: 88  NDRGPFRRGRIIDVSRKAAEGLGMIRSGVAPVRIESL 124


>gi|15599681|ref|NP_253175.1| hypothetical protein PA4485 [Pseudomonas aeruginosa PAO1]
 gi|254238854|ref|ZP_04932177.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|9950723|gb|AAG07873.1|AE004862_7 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|126170785|gb|EAZ56296.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
          Length = 125

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 62/97 (63%)

Query: 84  TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRV 143
           +  A  G AS+YG    G  TA+GE Y    +TAAH TLP  + VRVTN++N  S+VVR+
Sbjct: 28  SGSADTGEASYYGSRHAGLRTASGERYNPNAMTAAHRTLPFGARVRVTNLDNRRSVVVRI 87

Query: 144 NDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           NDRGP+   R+ID+S  AA+ L +   GV+ V +E L
Sbjct: 88  NDRGPFRRGRIIDVSRKAAEGLGMIRSGVAPVRIESL 124


>gi|330950291|gb|EGH50551.1| rplA family protein [Pseudomonas syringae Cit 7]
          Length = 122

 Score = 86.7 bits (213), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 61/96 (63%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
            Y   G A++YG+  HG  TA+GE +    +TAAH  LP  + V+VTN++N  S+VVRVN
Sbjct: 26  GYDETGTAAYYGRRHHGNRTASGEPFNQNALTAAHRQLPFGTRVKVTNLDNDRSVVVRVN 85

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGP+   RLID+S  AA+ L +   G + V V+ L
Sbjct: 86  DRGPHTRGRLIDVSREAAEQLGMLRSGTAPVRVQAL 121


>gi|260891315|ref|ZP_05902578.1| o protein A family protein [Leptotrichia hofstadii F0254]
 gi|260858991|gb|EEX73491.1| o protein A family protein [Leptotrichia hofstadii F0254]
          Length = 118

 Score = 86.7 bits (213), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 64/103 (62%)

Query: 78  YVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGI 137
           Y  ++  +    G+AS+YGK  HG  TA+GE +    + AAH +LP  + V+VTN+ NG 
Sbjct: 12  YASKKTGSKLQSGIASYYGKGLHGSRTASGERHNRHEMVAAHRSLPFGTKVKVTNLSNGK 71

Query: 138 SLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            ++V++NDRGP+   R+IDLS  A   +    +G++KV +E L
Sbjct: 72  EVIVKINDRGPFTRGRVIDLSYGAFSKIENPGKGLTKVKLEVL 114


>gi|107099930|ref|ZP_01363848.1| hypothetical protein PaerPA_01000951 [Pseudomonas aeruginosa PACS2]
 gi|116052517|ref|YP_792830.1| hypothetical protein PA14_58210 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|313107072|ref|ZP_07793273.1| putative rplA family protein [Pseudomonas aeruginosa 39016]
 gi|115587738|gb|ABJ13753.1| putative rplA family protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|310879775|gb|EFQ38369.1| putative rplA family protein [Pseudomonas aeruginosa 39016]
          Length = 125

 Score = 86.7 bits (213), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 62/97 (63%)

Query: 84  TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRV 143
           +  A  G AS+YG    G  TA+GE Y    +TAAH TLP  + VRVTN++N  S+VVR+
Sbjct: 28  SGSADTGEASYYGSRHAGLRTASGERYNPNAMTAAHRTLPFGTRVRVTNLDNRRSVVVRI 87

Query: 144 NDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           NDRGP+   R+ID+S  AA+ L +   GV+ V +E L
Sbjct: 88  NDRGPFRRGRIIDVSRKAAEGLGMIRSGVAPVRIESL 124


>gi|103488450|ref|YP_618011.1| rare lipoprotein A [Sphingopyxis alaskensis RB2256]
 gi|98978527|gb|ABF54678.1| rare lipoprotein A [Sphingopyxis alaskensis RB2256]
          Length = 134

 Score = 86.7 bits (213), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 61/91 (67%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+AS+YG    G  TA+GE +    +TAAH TLP  S VRVTN+  G S+VVR+NDRGP+
Sbjct: 41  GVASYYGNELAGNRTASGERFDPGQLTAAHRTLPFGSMVRVTNVATGDSVVVRINDRGPF 100

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R+ID+S+AAA+ + +   G ++V +  L
Sbjct: 101 AHGRVIDVSHAAAREIGLHRSGTARVKLALL 131


>gi|49077972|gb|AAT49737.1| PA4485 [synthetic construct]
          Length = 126

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 62/97 (63%)

Query: 84  TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRV 143
           +  A  G AS+YG    G  TA+GE Y    +TAAH TLP  + VRVTN++N  S+VVR+
Sbjct: 28  SGSADTGEASYYGSRHAGLRTASGERYDPNAMTAAHRTLPFGARVRVTNLDNRRSVVVRI 87

Query: 144 NDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           NDRGP+   R+ID+S  AA+ L +   GV+ V +E L
Sbjct: 88  NDRGPFRRGRIIDVSRKAAEGLGMIRSGVAPVRIESL 124


>gi|325972147|ref|YP_004248338.1| lipoprotein A [Spirochaeta sp. Buddy]
 gi|324027385|gb|ADY14144.1| rare lipoprotein A [Spirochaeta sp. Buddy]
          Length = 220

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 42/88 (47%), Positives = 58/88 (65%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWY       LTANGE++    ++AAH +L   + VRVTN+ NG S+ VR+NDRGPY
Sbjct: 34  GIASWYTTDKSESLTANGEIFDPNVLSAAHKSLKFGTIVRVTNLANGKSVDVRINDRGPY 93

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHV 177
              R+IDL+ AAAK + +   G+S V +
Sbjct: 94  VDGRIIDLTPAAAKQIDMLNSGISSVDL 121


>gi|297561135|ref|YP_003680109.1| lipoprotein A [Nocardiopsis dassonvillei subsp. dassonvillei DSM
           43111]
 gi|296845583|gb|ADH67603.1| rare lipoprotein A [Nocardiopsis dassonvillei subsp. dassonvillei
           DSM 43111]
          Length = 239

 Score = 86.3 bits (212), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 58/100 (58%)

Query: 82  QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVV 141
           + T       AS+YG  F GR TANGE +    +TAAH TLP  + V+VTN  +G S+ V
Sbjct: 140 ESTGQGGTCQASYYGADFAGRTTANGETFDPNAMTAAHKTLPFGTQVQVTNPSSGASVTV 199

Query: 142 RVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           R+NDRGPY   R +DLS AA   +     GV +V  + +G
Sbjct: 200 RINDRGPYVDGRCLDLSTAAFDQIIGTGAGVGQVDWQVVG 239


>gi|152986821|ref|YP_001350435.1| hypothetical protein PSPA7_5099 [Pseudomonas aeruginosa PA7]
 gi|150961979|gb|ABR84004.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 125

 Score = 85.9 bits (211), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 46/94 (48%), Positives = 61/94 (64%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
           A  G AS+YG    G  TA+GE Y    +TAAH TLP  + VRVTN++N  S+VVR+NDR
Sbjct: 31  ADTGEASYYGSRHAGLRTASGERYNPNAMTAAHRTLPFGTRVRVTNLDNRRSVVVRINDR 90

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           GP+   R+ID+S  AA+ L +   GV+ V +E L
Sbjct: 91  GPFRRGRIIDVSRKAAEGLGMIRSGVAPVRIESL 124


>gi|284039132|ref|YP_003389062.1| lipoprotein A [Spirosoma linguale DSM 74]
 gi|283818425|gb|ADB40263.1| rare lipoprotein A [Spirosoma linguale DSM 74]
          Length = 144

 Score = 85.9 bits (211), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 42/92 (45%), Positives = 60/92 (65%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+Y K F+GR TA GE    E +  AH  LPL + V VTN++N  S++VR+NDRGP+
Sbjct: 27  GKASFYSKKFNGRKTAYGERVSAEALEGAHRNLPLNTLVEVTNLDNQRSVIVRINDRGPF 86

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
              R+IDL+ AAA  L +  +G++ V +  +G
Sbjct: 87  AKGRVIDLTVAAAHALGMVSKGIANVSLRVVG 118


>gi|91217693|ref|ZP_01254650.1| hypothetical protein P700755_19357 [Psychroflexus torquis ATCC
           700755]
 gi|91184197|gb|EAS70583.1| hypothetical protein P700755_19357 [Psychroflexus torquis ATCC
           700755]
          Length = 242

 Score = 85.9 bits (211), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 60/96 (62%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
           A    G AS+Y   F G+ TA+GE+Y     TAAH  L   S V+VTN++N  + +V +N
Sbjct: 7   AQTQTGKASFYADKFEGKQTASGEIYKHNLPTAAHRKLAFGSKVKVTNLQNYKTAMVTIN 66

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGP+   R+IDLS + A+ L + + GV++V +E L
Sbjct: 67  DRGPFIRGRIIDLSRSVAQTLDILDNGVTEVKIEVL 102


>gi|284009240|emb|CBA76341.1| rare lipoprotein A precursor [Arsenophonus nasoniae]
          Length = 329

 Score = 85.5 bits (210), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 61/98 (62%), Gaps = 1/98 (1%)

Query: 71  YQIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ+ G+ Y + +    ++  G AS +G    G++TA GE       TA+HPTLP+PSY R
Sbjct: 54  YQLNGQTYQIVKDPAHFSETGFASIFGSEVIGKITATGEKASPYAFTASHPTLPIPSYAR 113

Query: 130 VTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRV 167
           +TN+ NG  ++VR+NDRGPY S + I LS AA   L +
Sbjct: 114 ITNLINGRMIIVRINDRGPYISGKNIALSQAAGDRLNL 151


>gi|330902836|gb|EGH33838.1| rplA family protein [Pseudomonas syringae pv. japonica str.
           M301072PT]
          Length = 122

 Score = 85.5 bits (210), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 60/95 (63%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           Y   G A++YG   HG  TA+GE +    +TAAH  LP  + V+VTN++N  S+VVRVND
Sbjct: 27  YDETGTAAYYGARHHGNRTASGEPFNQNALTAAHRQLPFGTRVKVTNLDNDRSVVVRVND 86

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+   RLID+S  AA+ L +   G + V V+ L
Sbjct: 87  RGPHTRGRLIDVSREAAEQLGMLRSGTAPVRVQAL 121


>gi|255530601|ref|YP_003090973.1| rare lipoprotein A [Pedobacter heparinus DSM 2366]
 gi|255343585|gb|ACU02911.1| rare lipoprotein A [Pedobacter heparinus DSM 2366]
          Length = 135

 Score = 85.5 bits (210), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 45/89 (50%), Positives = 57/89 (64%)

Query: 92  ASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHS 151
           A++Y + F GR T +G  Y    +TAAH TLP  + V VTN ENG S+ V VNDRGP+  
Sbjct: 43  ATYYARKFEGRKTTSGARYRRSKMTAAHMTLPFGTIVTVTNPENGESVDVEVNDRGPHSR 102

Query: 152 NRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              IDLS AAAK L +  +GV+KV + YL
Sbjct: 103 KFKIDLSEAAAKELGIYGKGVAKVEISYL 131


>gi|330969665|gb|EGH69731.1| rare lipoprotein A [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 122

 Score = 85.1 bits (209), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 60/96 (62%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
            Y   G A++YG   HG  TA+GE +    +TAAH  LP  + V+VTN++N  S+VVRVN
Sbjct: 26  GYDETGTAAYYGARHHGNRTASGEPFNQNALTAAHRQLPFGTRVKVTNLDNDRSVVVRVN 85

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGP+   RLID+S  AA+ L +   G + V V+ L
Sbjct: 86  DRGPHTRGRLIDVSREAAEQLGMLRSGTAPVRVQAL 121


>gi|288957466|ref|YP_003447807.1| rare lipoprotein A [Azospirillum sp. B510]
 gi|288909774|dbj|BAI71263.1| rare lipoprotein A [Azospirillum sp. B510]
          Length = 197

 Score = 85.1 bits (209), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 46/89 (51%), Positives = 57/89 (64%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+Y + FHGR TA+GE       TAA  TLPL +   VTN +NG S+ V VNDRGPY
Sbjct: 49  GEASFYSQKFHGRTTASGEPMNQNKPTAASRTLPLGAKATVTNQDNGKSVDVIVNDRGPY 108

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVE 178
              R+IDLS +AA+ L + E G + V VE
Sbjct: 109 VDGRVIDLSRSAARKLDMIEDGTAPVKVE 137


>gi|66047394|ref|YP_237235.1| rare lipoprotein A [Pseudomonas syringae pv. syringae B728a]
 gi|63258101|gb|AAY39197.1| Rare lipoprotein A [Pseudomonas syringae pv. syringae B728a]
          Length = 145

 Score = 85.1 bits (209), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 60/96 (62%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
            Y   G A++YG   HG  TA+GE +    +TAAH  LP  + V+VTN++N  S+VVRVN
Sbjct: 49  GYDETGTAAYYGARHHGNRTASGEPFNQNALTAAHRQLPFGTRVKVTNLDNDRSVVVRVN 108

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGP+   RLID+S  AA+ L +   G + V V+ L
Sbjct: 109 DRGPHTRGRLIDVSREAAEQLGMLRSGTAPVRVQAL 144


>gi|162147580|ref|YP_001602041.1| rare lipoprotein A [Gluconacetobacter diazotrophicus PAl 5]
 gi|209542213|ref|YP_002274442.1| Rare lipoprotein A [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786157|emb|CAP55739.1| putative rare lipoprotein A precursor [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209529890|gb|ACI49827.1| Rare lipoprotein A [Gluconacetobacter diazotrophicus PAl 5]
          Length = 279

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/160 (38%), Positives = 82/160 (51%), Gaps = 12/160 (7%)

Query: 58  VPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGR---LTANGEVYGTEY 114
           +P     Y +G PYQ+ G WY P +  +Y A G+A     A   R   +TA+GE Y  + 
Sbjct: 16  LPPAAPHYVVGAPYQMDGVWYYPHEDFSYQATGLA----VADPDRTPYVTADGEHYSPDA 71

Query: 115 ITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSK 174
           +T  H TL LP+ V V N+ENG  + +RVNDRGP    RLI LS  AA +L +   G + 
Sbjct: 72  LTGRHATLQLPAIVTVRNLENGREITIRVNDRGPDSPGRLIGLSPRAAALLGI---GSNP 128

Query: 175 VHVEYLGMALLNGMDQEYLRSTVMVNSATVLPLGCQYREE 214
           V V   G+   N    E L  T  ++ A   P G Q R E
Sbjct: 129 VRVAVTGLEAQNEQLAEGLPGTQHLDIAAA-PAG-QVRAE 166


>gi|330448070|ref|ZP_08311718.1| rare lipoA family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328492261|dbj|GAA06215.1| rare lipoA family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 143

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/92 (46%), Positives = 57/92 (61%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
           +G AS+Y   + GR TA+G+ Y     TAAH TLP  + V+VTN+ N  S+VV +NDRGP
Sbjct: 51  IGKASYYADKYQGRKTASGQRYDKNKRTAAHRTLPFGTRVKVTNLANNKSVVVTINDRGP 110

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           Y   R+IDLS +A   +     G+ KV VE L
Sbjct: 111 YSKGRIIDLSRSAFSAIGNTSSGILKVKVETL 142


>gi|23013988|ref|ZP_00053831.1| COG0797: Lipoproteins [Magnetospirillum magnetotacticum MS-1]
          Length = 131

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 58/93 (62%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG  F G  TA+GE +  + +TAAHPTLP  + V V+  +   S++V V DRGPY
Sbjct: 37  GVASWYGTGFKGSRTASGEKFDPKALTAAHPTLPFGTLVEVSRRDKKKSVIVVVTDRGPY 96

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
              R IDLS AAA+ L +   G   V ++ +GM
Sbjct: 97  VQGRSIDLSRAAARRLSMSYLGAVPVRMQVVGM 129


>gi|319795936|ref|YP_004157576.1| rare lipoprotein a [Variovorax paradoxus EPS]
 gi|315598399|gb|ADU39465.1| rare lipoprotein A [Variovorax paradoxus EPS]
          Length = 208

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 65/104 (62%), Gaps = 2/104 (1%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  FH R TA+GE +    +TAAH TLP  + V V ++ NG  ++VR+ DRGPY
Sbjct: 72  GGASWYGIQFHQRKTASGERFDMTALTAAHKTLPFGTRVCVRSLVNGSEVLVRITDRGPY 131

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALL--NGMDQE 191
              R+IDLS AAA+ + +   G+ +V +  +G A +   G+D E
Sbjct: 132 AQGRVIDLSRAAAERIGLIGLGIKQVALSVVGSAGMRCGGVDVE 175


>gi|257482247|ref|ZP_05636288.1| rplA family protein [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|289676047|ref|ZP_06496937.1| rplA family protein [Pseudomonas syringae pv. syringae FF5]
 gi|298488469|ref|ZP_07006500.1| Rare lipoprotein A [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|302185445|ref|ZP_07262118.1| rplA family protein [Pseudomonas syringae pv. syringae 642]
 gi|298157094|gb|EFH98183.1| Rare lipoprotein A [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|320322515|gb|EFW78608.1| rplA family protein [Pseudomonas syringae pv. glycinea str. B076]
 gi|320330016|gb|EFW86003.1| rplA family protein [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330875182|gb|EGH09331.1| rplA family protein [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330937960|gb|EGH41747.1| rplA family protein [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330981105|gb|EGH79208.1| rplA family protein [Pseudomonas syringae pv. aptata str. DSM
           50252]
 gi|330987068|gb|EGH85171.1| rplA family protein [Pseudomonas syringae pv. lachrymans str.
           M301315]
 gi|331011512|gb|EGH91568.1| rplA family protein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 122

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 60/95 (63%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           Y   G A++YG   HG  TA+GE +    +TAAH  LP  + V+VTN++N  S+VVR+ND
Sbjct: 27  YDETGTAAYYGARHHGNRTASGEPFNQNALTAAHRQLPFGTRVKVTNLDNDRSVVVRIND 86

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+   RLID+S  AA+ L +   G + V V+ L
Sbjct: 87  RGPHTRGRLIDVSREAAEQLGMLRSGTAPVRVQAL 121


>gi|300776435|ref|ZP_07086293.1| RlpA family lipoprotein [Chryseobacterium gleum ATCC 35910]
 gi|300501945|gb|EFK33085.1| RlpA family lipoprotein [Chryseobacterium gleum ATCC 35910]
          Length = 123

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 57/87 (65%)

Query: 92  ASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHS 151
           AS+Y   F+GR TA+GE++     TAA+ TLP  + V+VTN+ NG  ++VR+NDRGPYHS
Sbjct: 34  ASYYHDKFNGRKTASGEIFDNSKFTAANRTLPFGTNVKVTNLRNGKEVIVRINDRGPYHS 93

Query: 152 NRLIDLSNAAAKILRVEERGVSKVHVE 178
           +R +D+S AA   +    RG   V  E
Sbjct: 94  SRSLDMSKAAFDEIGDINRGTIPVEYE 120


>gi|304393048|ref|ZP_07374977.1| rare lipoprotein A [Ahrensia sp. R2A130]
 gi|303294813|gb|EFL89184.1| rare lipoprotein A [Ahrensia sp. R2A130]
          Length = 155

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 65/108 (60%), Gaps = 2/108 (1%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
           A A  G ASWY  A  G +TA+GE   +  +TAAH  LP  + ++VTN+ N  S++VRVN
Sbjct: 17  AAAQTGSASWY--ALDGNMTASGERMNSSRMTAAHRKLPFGTKIKVTNLHNNRSVIVRVN 74

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMALLNGMDQEY 192
           DRGP+   R++D+S  AA+ L    RG +KV ++ +      G+  ++
Sbjct: 75  DRGPFAKGRILDVSKGAARKLGFIGRGHAKVRIQRVSRNTAVGVQPQW 122


>gi|325270761|ref|ZP_08137352.1| rare lipoprotein A [Prevotella multiformis DSM 16608]
 gi|324986877|gb|EGC18869.1| rare lipoprotein A [Prevotella multiformis DSM 16608]
          Length = 267

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 57/91 (62%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+YG   HGR  +NGE Y     T AH TLP  + +RVTN  NG S++VRV DRGP+
Sbjct: 30  GKASYYGSGLHGRRMSNGERYDRNGFTCAHRTLPFGTRLRVTNPRNGRSVIVRVTDRGPF 89

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R++DLS AAA+ L     GV+ V VE +
Sbjct: 90  VRGRVVDLSYAAARELGTLSCGVAYVKVEVV 120


>gi|262195701|ref|YP_003266910.1| lipoprotein A [Haliangium ochraceum DSM 14365]
 gi|262079048|gb|ACY15017.1| rare lipoprotein A [Haliangium ochraceum DSM 14365]
          Length = 162

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/92 (47%), Positives = 60/92 (65%), Gaps = 1/92 (1%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+YG+ +HGR TA+GE +    +TAAH TLP  + V V N++NG  + VR+NDRGP+
Sbjct: 66  GRASYYGERYHGRKTASGERFDMNAMTAAHRTLPFGTVVEVINLDNGRRVEVRINDRGPF 125

Query: 150 -HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
               R+ID+S AAA+ L +   GV  V V  L
Sbjct: 126 GRRRRIIDVSRAAARALEMLRAGVVPVEVRVL 157


>gi|120599874|ref|YP_964448.1| rare lipoprotein A [Shewanella sp. W3-18-1]
 gi|120559967|gb|ABM25894.1| rare lipoprotein A [Shewanella sp. W3-18-1]
          Length = 137

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 60/98 (61%)

Query: 83  YTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVR 142
           +  +   G AS+YG     + TA+GE+Y  +  TAAH  LP  S V+VTN++NG S++V+
Sbjct: 39  WVGFTETGQASFYGDKHQNKQTASGEIYKHKLKTAAHKKLPFGSSVKVTNVKNGKSVIVK 98

Query: 143 VNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +NDRGP+   R+IDLS +A   +     G+  V +E +
Sbjct: 99  INDRGPFVRGRIIDLSKSAFSSIGNTSSGLIDVKIEVI 136


>gi|255536059|ref|YP_003096430.1| Rare lipoprotein A [Flavobacteriaceae bacterium 3519-10]
 gi|255342255|gb|ACU08368.1| Rare lipoprotein A [Flavobacteriaceae bacterium 3519-10]
          Length = 123

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/90 (45%), Positives = 60/90 (66%)

Query: 91  MASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYH 150
           MAS+Y   F+GR TA+GE++    +TAA+ TLP  + ++VTN+  G S++V+VNDRGP+H
Sbjct: 33  MASYYHDKFNGRKTASGEIFHNTKLTAANRTLPFGTKLKVTNLRTGKSVIVKVNDRGPFH 92

Query: 151 SNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           S+R +DLS AA   +    RG   V  E +
Sbjct: 93  SSRALDLSKAAFDEIGNVARGTMPVEYEII 122


>gi|290476199|ref|YP_003469099.1| lipoprotein [Xenorhabdus bovienii SS-2004]
 gi|289175532|emb|CBJ82335.1| a minor lipoprotein [Xenorhabdus bovienii SS-2004]
          Length = 347

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 65/99 (65%), Gaps = 2/99 (2%)

Query: 71  YQIMGRWYVPRQYTA-YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVR 129
           YQ  G+ Y   Q +A +   G AS +G+  +G+LTA GE      + AAHPTLP+PSYVR
Sbjct: 56  YQRDGQTYRIVQDSANFTQTGYASGFGEEANGKLTAIGERASPYALAAAHPTLPIPSYVR 115

Query: 130 VTNMENGISLVVRVNDRGPYHS-NRLIDLSNAAAKILRV 167
           VTN+ NG  ++VR+NDRGPY+   ++I+LS A  + L +
Sbjct: 116 VTNLSNGRMIIVRINDRGPYNKPGKIIELSRATTERLNL 154


>gi|207110842|ref|ZP_03245004.1| rare lipoprotein A (rlpA) [Helicobacter pylori HPKX_438_CA4C1]
          Length = 81

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 38/78 (48%), Positives = 58/78 (74%)

Query: 104 TANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAK 163
           T+NGE+Y     TAAH TLP+ + V+V N++N +S +VR+NDRGP+ S+R+IDLSNAAA+
Sbjct: 4   TSNGEIYNMYAHTAAHKTLPMNTVVKVINVDNNLSTIVRINDRGPFVSDRIIDLSNAAAR 63

Query: 164 ILRVEERGVSKVHVEYLG 181
            + + ++G + V +  LG
Sbjct: 64  DIDMVQKGTASVRLIVLG 81


>gi|71734583|ref|YP_276298.1| rplA family protein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|71555136|gb|AAZ34347.1| rplA family protein [Pseudomonas syringae pv. phaseolicola 1448A]
          Length = 207

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 60/95 (63%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           Y   G A++YG   HG  TA+GE +    +TAAH  LP  + V+VTN++N  S+VVR+ND
Sbjct: 112 YDETGTAAYYGARHHGNRTASGEPFNQNALTAAHRQLPFGTRVKVTNLDNDRSVVVRIND 171

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+   RLID+S  AA+ L +   G + V V+ L
Sbjct: 172 RGPHTRGRLIDVSREAAEQLGMLRSGTAPVRVQAL 206


>gi|251772234|gb|EES52804.1| rare lipoprotein A [Leptospirillum ferrodiazotrophum]
          Length = 237

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/92 (48%), Positives = 59/92 (64%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
           VG ASWYG  F+G+ TA+G ++    +TAAH TLPL + VRVTN+ N  S+ V VNDRGP
Sbjct: 59  VGRASWYGPTFYGKKTASGAIFHKHDLTAAHRTLPLGTEVRVTNLANERSVDVLVNDRGP 118

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           + S R+IDLS  AA  + +   G   V +  L
Sbjct: 119 FVSGRIIDLSWEAANRIGIIGPGTGLVKITVL 150


>gi|117619427|ref|YP_856899.1| RplA family protein [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|117560834|gb|ABK37782.1| RplA family protein [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
          Length = 125

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 60/99 (60%)

Query: 82  QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVV 141
            +  Y+  G+AS+Y   +H + TA+GE Y     TAAH  LP  + VRVTN+ NG S+VV
Sbjct: 27  SWRGYSETGLASYYADRYHNKRTASGEPYQRHANTAAHMELPFGAMVRVTNLANGKSVVV 86

Query: 142 RVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RVNDRG +   R+IDLS AA   +     G+ KV +E L
Sbjct: 87  RVNDRGNFPRGRIIDLSKAAFSTIGNPRAGLIKVKIEAL 125


>gi|28871611|ref|NP_794230.1| rplA family protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|28854863|gb|AAO57925.1| rplA family protein [Pseudomonas syringae pv. tomato str. DC3000]
          Length = 122

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 59/96 (61%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
            Y   G A++YG   HG  TA+GE +    +TAAH  LP  + V+VTN+ N  S++VRVN
Sbjct: 26  GYDETGTAAYYGTRHHGNRTASGEPFNQNALTAAHRQLPFGTRVKVTNLNNDKSVIVRVN 85

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGP+   RLID+S  AA+ L +   G + V V+ L
Sbjct: 86  DRGPHTRGRLIDVSREAAEQLGMLRSGTAPVRVQAL 121


>gi|312131717|ref|YP_003999057.1| rare lipoprotein a [Leadbetterella byssophila DSM 17132]
 gi|311908263|gb|ADQ18704.1| rare lipoprotein A [Leadbetterella byssophila DSM 17132]
          Length = 179

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 63/105 (60%)

Query: 78  YVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGI 137
           Y  +    ++  G+AS+Y   F GR TA+GE++     T AH +LP  + + V N + G 
Sbjct: 32  YAQKVDIGHSFKGLASYYHSKFLGRKTASGEIFSRGMYTCAHRSLPFGTLIEVENTKTGR 91

Query: 138 SLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGM 182
            ++VRVNDRGPY  NR+IDLS  AAK L   E+GV+ +  + +G 
Sbjct: 92  WVIVRVNDRGPYSKNRVIDLSIDAAKHLGFLEKGVAHITAKVVGF 136


>gi|332667875|ref|YP_004450663.1| rare lipoprotein A [Haliscomenobacter hydrossis DSM 1100]
 gi|332336689|gb|AEE53790.1| rare lipoprotein A [Haliscomenobacter hydrossis DSM 1100]
          Length = 295

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/92 (44%), Positives = 62/92 (67%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+Y   ++G  TA GE+Y    +TAAH   P+ + +RVT ++N  S++VRVNDRGPY
Sbjct: 28  GYASYYSDDYNGSETAYGEIYDRNKLTAAHKMHPMGTRLRVTRLDNKKSVIVRVNDRGPY 87

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
              R+++LS+AAA+ L++   G  +V VE +G
Sbjct: 88  LKGRIVELSHAAARQLKMLNEGQVEVKVEVIG 119


>gi|330958036|gb|EGH58296.1| rplA family protein [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 122

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 60/96 (62%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
            Y   G A++YG   HG  TA+GE +    +TAAH  LP  + V+VTN++N  ++VVR+N
Sbjct: 26  GYDETGTAAYYGARHHGNRTASGESFNQNALTAAHRQLPFGTRVKVTNLDNQRTVVVRIN 85

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGP+   RLID+S  AA+ L +   G + V V+ L
Sbjct: 86  DRGPHTRGRLIDVSREAAEQLGMLRSGTAPVRVQAL 121


>gi|237798577|ref|ZP_04587038.1| rplA family protein [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331021430|gb|EGI01487.1| rplA family protein [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 122

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 59/96 (61%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
            Y   G A++YG   HG  TA+GE +    +TAAH  LP  + V+VTN+ N  S++VRVN
Sbjct: 26  GYDETGTAAYYGARHHGNRTASGEPFNQNALTAAHRQLPFGTRVKVTNLNNDKSVIVRVN 85

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGP+   RLID+S  AA+ L +   G + V V+ L
Sbjct: 86  DRGPHTRGRLIDVSREAAEQLGMLRSGTAPVRVQAL 121


>gi|282858345|ref|ZP_06267525.1| lipoprotein A-like protein [Prevotella bivia JCVIHMP010]
 gi|282588793|gb|EFB93918.1| lipoprotein A-like protein [Prevotella bivia JCVIHMP010]
          Length = 227

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 59/99 (59%), Gaps = 1/99 (1%)

Query: 83  YTAYAAV-GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVV 141
           +  YA   G AS+Y  A HGR  +NG+ Y     T AH TLP  + ++VTN  NG +++V
Sbjct: 21  FECYAQTSGKASYYSNALHGRRMSNGQPYNKNDFTCAHRTLPFGTQLKVTNTRNGNTVIV 80

Query: 142 RVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RV DRGP+   R+IDLS AAA+ L     G+  V +E +
Sbjct: 81  RVTDRGPFVRGRIIDLSYAAARALGTISSGIGYVRIEVM 119


>gi|213966634|ref|ZP_03394785.1| rplA family protein [Pseudomonas syringae pv. tomato T1]
 gi|301383144|ref|ZP_07231562.1| rplA family protein [Pseudomonas syringae pv. tomato Max13]
 gi|302063732|ref|ZP_07255273.1| rplA family protein [Pseudomonas syringae pv. tomato K40]
 gi|302133794|ref|ZP_07259784.1| rplA family protein [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|213928484|gb|EEB62028.1| rplA family protein [Pseudomonas syringae pv. tomato T1]
 gi|331016663|gb|EGH96719.1| rplA family protein [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 122

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 59/96 (61%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
            Y   G A++YG   HG  TA+GE +    +TAAH  LP  + V+VTN+ N  S++VRVN
Sbjct: 26  GYDETGTAAYYGARHHGNRTASGEPFNQNALTAAHRQLPFGTRVKVTNLNNDKSVIVRVN 85

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGP+   RLID+S  AA+ L +   G + V V+ L
Sbjct: 86  DRGPHTRGRLIDVSREAAEQLGMLRSGTAPVRVQAL 121


>gi|213859601|ref|ZP_03385305.1| rare lipoprotein A [Salmonella enterica subsp. enterica serovar
           Typhi str. M223]
          Length = 84

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 41/75 (54%), Positives = 53/75 (70%)

Query: 91  MASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYH 150
           MA+ Y       LTA+GE +    +TAAHPTLP+PSY R+TN+ NG  +VVR+NDRGPY 
Sbjct: 1   MAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYARITNLANGRMIVVRINDRGPYG 60

Query: 151 SNRLIDLSNAAAKIL 165
           ++R+I LS AAA  L
Sbjct: 61  NDRVISLSRAAADRL 75


>gi|154492300|ref|ZP_02031926.1| hypothetical protein PARMER_01934 [Parabacteroides merdae ATCC
           43184]
 gi|154087525|gb|EDN86570.1| hypothetical protein PARMER_01934 [Parabacteroides merdae ATCC
           43184]
          Length = 153

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/89 (41%), Positives = 61/89 (68%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+AS+Y   FHGR  A+G V+  + + AAH T P  +++RVTN+ N   ++V V DRGP+
Sbjct: 27  GLASYYHNRFHGRKAASGRVHDADELVAAHRTYPFGTFLRVTNLSNMKRVIVCVTDRGPF 86

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVE 178
              R+ID+S  AA++L  +++G+++V +E
Sbjct: 87  RKGRIIDVSAGAAELLDFKKKGLARVRIE 115


>gi|312880096|ref|ZP_07739896.1| rare lipoprotein A [Aminomonas paucivorans DSM 12260]
 gi|310783387|gb|EFQ23785.1| rare lipoprotein A [Aminomonas paucivorans DSM 12260]
          Length = 251

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 77/124 (62%), Gaps = 7/124 (5%)

Query: 65  YFLGKPYQIMGRWY---VPRQYT---AYAAVGMASWYG-KAFHGRLTANGEVYGTEYITA 117
           ++L + Y+ +G+ +   +  ++T   A+ A G  SWYG  +F GR  ANGE Y    + A
Sbjct: 120 FWLSRLYEALGKEHADPLTAKHTLRGAHVARGTVSWYGGDSFVGRRFANGERYQGSELVA 179

Query: 118 AHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           A  +LP  + VR+ N+E+G ++VVR+ DR   H  R++D+S  AA++L  + RGV++V V
Sbjct: 180 AAKSLPFGTLVRIRNLESGRTVVVRIVDRFMEHRGRILDVSKTAAEVLGFKNRGVAQVAV 239

Query: 178 EYLG 181
           E +G
Sbjct: 240 EVIG 243


>gi|217974356|ref|YP_002359107.1| rare lipoprotein A [Shewanella baltica OS223]
 gi|217499491|gb|ACK47684.1| rare lipoprotein A [Shewanella baltica OS223]
          Length = 137

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (60%)

Query: 82  QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVV 141
            +  +   G AS+YG     + TA+GE+Y  +  TAAH  LP  S V+VTN++NG S++V
Sbjct: 38  NWVGFTEAGQASFYGDKHQNKQTASGELYKHKLKTAAHKKLPFGSSVKVTNVDNGKSVIV 97

Query: 142 RVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           ++NDRGP+   R+IDLS +A   +     G+  V +E +
Sbjct: 98  KINDRGPFVRGRIIDLSKSAFSSIGNTSSGLIDVKIEVI 136


>gi|330888644|gb|EGH21305.1| rplA family protein [Pseudomonas syringae pv. mori str. 301020]
          Length = 122

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 59/95 (62%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           Y   G A++YG   HG  TA+GE +    +TAAH  LP  + V+VTN++N  S+VVR+ND
Sbjct: 27  YDETGTAAYYGARHHGNRTASGEPFNQNALTAAHRQLPFGTRVKVTNLDNDRSVVVRIND 86

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+   RLID+S  AA+ L +   G + V V  L
Sbjct: 87  RGPHTRGRLIDVSREAAEQLGMLRSGTAPVRVRAL 121


>gi|319425489|gb|ADV53563.1| rare lipoprotein A [Shewanella putrefaciens 200]
          Length = 137

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 60/98 (61%)

Query: 83  YTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVR 142
           +  +   G AS+YG     + TA+GE+Y  +  TAAH  LP  S V+VTN++NG S++V+
Sbjct: 39  WVGFTETGQASFYGDKHQNKQTASGELYKHKLKTAAHKKLPFGSSVKVTNVKNGKSVIVK 98

Query: 143 VNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +NDRGP+   R+IDLS +A   +     G+  V +E +
Sbjct: 99  INDRGPFVRGRIIDLSKSAFSSIGNTSSGLIDVKIEVI 136


>gi|146292190|ref|YP_001182614.1| rare lipoprotein A [Shewanella putrefaciens CN-32]
 gi|145563880|gb|ABP74815.1| rare lipoprotein A [Shewanella putrefaciens CN-32]
          Length = 137

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 60/98 (61%)

Query: 83  YTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVR 142
           +  +   G AS+YG     + TA+GE+Y  +  TAAH  LP  S V+VTN++NG S++V+
Sbjct: 39  WVGFTETGQASFYGDKHQNKQTASGELYKHKLKTAAHKKLPFGSSVKVTNVKNGKSVIVK 98

Query: 143 VNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +NDRGP+   R+IDLS +A   +     G+  V +E +
Sbjct: 99  INDRGPFVRGRIIDLSKSAFSSIGNTSSGLIDVKIEVI 136


>gi|152999693|ref|YP_001365374.1| rare lipoprotein A [Shewanella baltica OS185]
 gi|151364311|gb|ABS07311.1| rare lipoprotein A [Shewanella baltica OS185]
          Length = 137

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 60/98 (61%)

Query: 83  YTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVR 142
           +  +   G AS+YG     + TA+GE+Y  +  TAAH  LP  S V+VTN++NG S++V+
Sbjct: 39  WVGFTEAGQASFYGDKHQNKQTASGELYKHKLKTAAHKKLPFGSSVKVTNVDNGKSVIVK 98

Query: 143 VNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +NDRGP+   R+IDLS +A   +     G+  V +E +
Sbjct: 99  INDRGPFVRGRIIDLSKSAFSSIGNTSSGLIDVKIEVI 136


>gi|187734790|ref|YP_001876902.1| Rare lipoprotein A [Akkermansia muciniphila ATCC BAA-835]
 gi|187424842|gb|ACD04121.1| Rare lipoprotein A [Akkermansia muciniphila ATCC BAA-835]
          Length = 172

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/125 (41%), Positives = 72/125 (57%), Gaps = 7/125 (5%)

Query: 66  FLGKPYQIMGRWYVP---RQYTAYAAVGMASWYGK-AFHGRL---TANGEVYGTEYITAA 118
           ++ +PY I G  Y P    Q  AY   G+AS Y + A  G +   TA GE     ++ AA
Sbjct: 33  YMTRPYTIRGHRYHPMNVEQALAYEQTGIASHYNECALWGLVSGKTAIGENVRPWHLHAA 92

Query: 119 HPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
           HPTLPLP  V V ++  G ++ VRVNDRGP+  NR+IDLS  AA+ L ++  G+ KV + 
Sbjct: 93  HPTLPLPCEVLVQSLRTGKTVKVRVNDRGPFIKNRIIDLSEEAAERLDMKHHGLDKVRIT 152

Query: 179 YLGMA 183
            L + 
Sbjct: 153 VLSVG 157


>gi|304409276|ref|ZP_07390896.1| rare lipoprotein A [Shewanella baltica OS183]
 gi|307303634|ref|ZP_07583387.1| rare lipoprotein A [Shewanella baltica BA175]
 gi|304351794|gb|EFM16192.1| rare lipoprotein A [Shewanella baltica OS183]
 gi|306912532|gb|EFN42955.1| rare lipoprotein A [Shewanella baltica BA175]
          Length = 137

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (60%)

Query: 82  QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVV 141
            +  +   G AS+YG     + TA+GE+Y  +  TAAH  LP  S V+VTN++NG S++V
Sbjct: 38  NWVGFTESGQASFYGDKHQNKQTASGELYKHKLKTAAHKKLPFGSSVKVTNVDNGKSVIV 97

Query: 142 RVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           ++NDRGP+   R+IDLS +A   +     G+  V +E +
Sbjct: 98  KINDRGPFVRGRIIDLSKSAFSSIGKTSSGLIDVKIEVI 136


>gi|257126713|ref|YP_003164827.1| lipoprotein A [Leptotrichia buccalis C-1013-b]
 gi|257050652|gb|ACV39836.1| rare lipoprotein A [Leptotrichia buccalis C-1013-b]
          Length = 170

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 64/100 (64%), Gaps = 1/100 (1%)

Query: 81  RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLV 140
           +++T Y + G+AS+Y K   G  TA+GE +    + AAH TLP  + V+VTN+ NG  ++
Sbjct: 68  QKFTHYQS-GIASYYSKGLDGSKTASGERHHMTEMVAAHKTLPFGTRVKVTNLSNGKEVI 126

Query: 141 VRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           V++NDRGP+   R+IDLS  A   +    +G++KV +E L
Sbjct: 127 VKINDRGPFVKGRVIDLSYGAFSQIESPGKGITKVKLEIL 166


>gi|92113633|ref|YP_573561.1| rare lipoprotein A [Chromohalobacter salexigens DSM 3043]
 gi|91796723|gb|ABE58862.1| rare lipoprotein A [Chromohalobacter salexigens DSM 3043]
          Length = 114

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 59/91 (64%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+Y   + G+ TA+GE Y  + +TAAH  LP  + VRVTN++NG  + VR+NDRGP+
Sbjct: 23  GQASYYHDRYQGQRTASGEPYDAQALTAAHRRLPFDTRVRVTNLDNGRQVTVRINDRGPF 82

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R+IDLS  AA+ L + + G + V V  L
Sbjct: 83  TEGRVIDLSRRAAERLGMIKAGTAPVRVTPL 113


>gi|228472932|ref|ZP_04057689.1| rare lipoprotein A [Capnocytophaga gingivalis ATCC 33624]
 gi|228275514|gb|EEK14291.1| rare lipoprotein A [Capnocytophaga gingivalis ATCC 33624]
          Length = 158

 Score = 83.6 bits (205), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 62/95 (65%), Gaps = 1/95 (1%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
           A  G+AS+Y   F+GR TA+GEV+    +TAAH T P  +Y++VTN+ NG S+VV+VNDR
Sbjct: 62  ATTGVASYYHNKFNGRKTASGEVFSNNKLTAAHRTYPFGTYLKVTNVVNGKSVVVKVNDR 121

Query: 147 GPYHSNRLIDLSNAA-AKILRVEERGVSKVHVEYL 180
           GP+   + +DLS  A   I     +G  +V++E +
Sbjct: 122 GPFTKGKELDLSRKAFMDITDNPNKGNLQVNIEVV 156


>gi|83816576|ref|YP_446246.1| rare lipoprotein A [Salinibacter ruber DSM 13855]
 gi|83757970|gb|ABC46083.1| rare lipoprotein A [Salinibacter ruber DSM 13855]
          Length = 207

 Score = 83.6 bits (205), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 63/95 (66%), Gaps = 2/95 (2%)

Query: 88  AVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGI--SLVVRVND 145
           A G+AS+Y   F GR TANGE+Y  + +TAAH +LP  + VR T ++     S+VVR+ND
Sbjct: 85  AQGIASYYADKFVGRTTANGEIYDHQGLTAAHRSLPFGTRVRTTRIDAPAQPSVVVRIND 144

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+   R+IDLS AAA  L +   G+++V +E +
Sbjct: 145 RGPFKDGRIIDLSKAAAGRLNMLRDGLAEVRLEIV 179


>gi|294508178|ref|YP_003572236.1| Rare lipoprotein A [Salinibacter ruber M8]
 gi|294344506|emb|CBH25284.1| Rare lipoprotein A [Salinibacter ruber M8]
          Length = 166

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 63/95 (66%), Gaps = 2/95 (2%)

Query: 88  AVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGI--SLVVRVND 145
           A G+AS+Y   F GR TANGE+Y  + +TAAH +LP  + VR T ++     S+VVR+ND
Sbjct: 44  AQGIASYYADKFVGRTTANGEIYDHQGLTAAHRSLPFGTRVRTTRIDAPAQPSVVVRIND 103

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+   R+IDLS AAA  L +   G+++V +E +
Sbjct: 104 RGPFKDGRIIDLSKAAAGRLNMLRDGLAEVRLEIV 138


>gi|126173340|ref|YP_001049489.1| rare lipoprotein A [Shewanella baltica OS155]
 gi|125996545|gb|ABN60620.1| rare lipoprotein A [Shewanella baltica OS155]
          Length = 137

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (60%)

Query: 82  QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVV 141
            +  +   G AS+YG     + TA+GE+Y  +  TAAH  LP  S V+VTN++NG S++V
Sbjct: 38  NWVGFTESGQASFYGDKHQNKQTASGELYKHKLKTAAHKKLPFGSSVKVTNVDNGKSVIV 97

Query: 142 RVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           ++NDRGP+   R+IDLS +A   +     G+  V +E +
Sbjct: 98  KINDRGPFVRGRIIDLSKSAFSSIGNTSSGLIDVKIEVI 136


>gi|313902848|ref|ZP_07836245.1| rare lipoprotein A [Thermaerobacter subterraneus DSM 13965]
 gi|313466968|gb|EFR62485.1| rare lipoprotein A [Thermaerobacter subterraneus DSM 13965]
          Length = 403

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 58/85 (68%)

Query: 91  MASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYH 150
           +ASWYG  F+GR TA+GE++    +TAAH T+P  + + VT  E G S+ VR+NDRGPY 
Sbjct: 310 VASWYGPGFYGRPTASGEIFTGREMTAAHRTMPFGTVLLVTYPETGRSVRVRINDRGPYV 369

Query: 151 SNRLIDLSNAAAKILRVEERGVSKV 175
             R +DLS AAA+ L +   GV++V
Sbjct: 370 EGRDLDLSEAAAEALGMISAGVARV 394


>gi|218260717|ref|ZP_03475883.1| hypothetical protein PRABACTJOHN_01547 [Parabacteroides johnsonii
           DSM 18315]
 gi|218224396|gb|EEC97046.1| hypothetical protein PRABACTJOHN_01547 [Parabacteroides johnsonii
           DSM 18315]
          Length = 153

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/89 (41%), Positives = 61/89 (68%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+AS+Y   FHGR  A+G V+  + + AAH T P  +++RVTN+ N   ++V V DRGP+
Sbjct: 27  GLASYYHNRFHGRKAASGRVHDADELVAAHRTYPFGTFLRVTNLANMKRVIVCVTDRGPF 86

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVE 178
              R+ID+S  AA++L  +++G+++V +E
Sbjct: 87  RKGRIIDVSVGAAELLGFKKKGLARVRIE 115


>gi|330877215|gb|EGH11364.1| rplA family protein [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
 gi|330963987|gb|EGH64247.1| rplA family protein [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 122

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 59/96 (61%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
            Y   G A++YG   HG  TA+GE +    +TAAH  LP  + V+VTN+ N  +++VRVN
Sbjct: 26  GYDETGTAAYYGARHHGNRTASGEPFNQNALTAAHRQLPFGTRVKVTNLNNDKAVIVRVN 85

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGP+   RLID+S  AA+ L +   G + V V+ L
Sbjct: 86  DRGPHTRGRLIDVSREAAEQLGMLRSGTAPVRVQAL 121


>gi|108803592|ref|YP_643529.1| rare lipoprotein A [Rubrobacter xylanophilus DSM 9941]
 gi|108764835|gb|ABG03717.1| rare lipoprotein A [Rubrobacter xylanophilus DSM 9941]
          Length = 330

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 57/89 (64%), Gaps = 2/89 (2%)

Query: 91  MASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYH 150
           MA+WYG  F G  TA+GE +  +  TAAH TLP  + + VT   NG S+VVRVNDRGPY 
Sbjct: 39  MATWYGPGFEGSTTASGEPFNPDDYTAAHKTLPFGTKLIVTY--NGRSVVVRVNDRGPYS 96

Query: 151 SNRLIDLSNAAAKILRVEERGVSKVHVEY 179
               +DLS AAA+ L +   G + V+VE+
Sbjct: 97  GGYDLDLSQAAAEYLGLTAAGAAPVNVEF 125


>gi|170739048|ref|YP_001767703.1| rare lipoprotein A [Methylobacterium sp. 4-46]
 gi|168193322|gb|ACA15269.1| rare lipoprotein A [Methylobacterium sp. 4-46]
          Length = 124

 Score = 83.2 bits (204), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 62/96 (64%), Gaps = 5/96 (5%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
           A A  G ASWYG    G+ TA+GE +    +TAAH +LP  + VRVTN  NG S+VVR+N
Sbjct: 33  AAAQSGRASWYGS---GQRTASGERFNPNGLTAAHRSLPFGTRVRVTNTANGRSVVVRIN 89

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGP+   R+IDLS  +A+ + +   GV+ V ++ L
Sbjct: 90  DRGPFAGGRIIDLSRGSARAIGMG--GVTHVALQRL 123


>gi|300023900|ref|YP_003756511.1| lipoprotein A [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525721|gb|ADJ24190.1| rare lipoprotein A [Hyphomicrobium denitrificans ATCC 51888]
          Length = 201

 Score = 83.2 bits (204), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 64/95 (67%), Gaps = 1/95 (1%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           +A  G+AS+YG +  G  TA GE +    +TAAH TLP  + V+VT ++ G S+VVR+ND
Sbjct: 107 HATTGLASFYGIS-AGVKTATGERFDPSGMTAAHRTLPFGTRVKVTRVDTGESVVVRIND 165

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+   R+IDLS  AAK L++ + G++ V +E +
Sbjct: 166 RGPFKPGRVIDLSEGAAKTLKMTDIGLTNVRLEVM 200


>gi|326335859|ref|ZP_08202038.1| rare lipoprotein A [Capnocytophaga sp. oral taxon 338 str. F0234]
 gi|325692003|gb|EGD33963.1| rare lipoprotein A [Capnocytophaga sp. oral taxon 338 str. F0234]
          Length = 160

 Score = 83.2 bits (204), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 62/94 (65%), Gaps = 1/94 (1%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+AS+Y   F+GR TA+GEV+    +TAAH T P  + ++VTN++NG S++V+VNDRGP+
Sbjct: 67  GIASYYHNKFNGRKTASGEVFNNNKLTAAHRTYPFGTLLKVTNIDNGKSVIVKVNDRGPF 126

Query: 150 HSNRLIDLSNAA-AKILRVEERGVSKVHVEYLGM 182
              +++DLS  A   I     +G  +V++E +  
Sbjct: 127 TKEKVLDLSRKAFMTITDNPNKGNLQVNIEVISQ 160


>gi|260592735|ref|ZP_05858193.1| rare lipoprotein A [Prevotella veroralis F0319]
 gi|260535266|gb|EEX17883.1| rare lipoprotein A [Prevotella veroralis F0319]
          Length = 273

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 56/91 (61%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+Y    HGR  +NGE Y     T AH TLP  + ++VTN  NG S++VRV DRGP+
Sbjct: 29  GKASYYSNGLHGRRMSNGERYDKNAFTCAHRTLPFGTRLKVTNPRNGRSVIVRVTDRGPF 88

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R++DLS AAA+ L     GV+ V VE +
Sbjct: 89  VRGRIVDLSYAAARELGTLAMGVAYVKVEVV 119


>gi|197124466|ref|YP_002136417.1| lipoprotein A [Anaeromyxobacter sp. K]
 gi|196174315|gb|ACG75288.1| rare lipoprotein A [Anaeromyxobacter sp. K]
          Length = 144

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 58/83 (69%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
           VG+AS+YGK  HGR TA+G  +    +T AH T P  + ++VT++E+G S+VV+V DRGP
Sbjct: 50  VGLASYYGKRHHGRRTASGSRFDMHAMTCAHRTAPFGTRLKVTSLESGKSVVVKVTDRGP 109

Query: 149 YHSNRLIDLSNAAAKILRVEERG 171
           +   R++DLS AAA+ L + E G
Sbjct: 110 FAGGRVVDLSYAAARKLGMVEDG 132


>gi|288803913|ref|ZP_06409337.1| rare lipoprotein A [Prevotella melaninogenica D18]
 gi|288333617|gb|EFC72068.1| rare lipoprotein A [Prevotella melaninogenica D18]
          Length = 264

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 56/91 (61%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+Y    HGR  +NGE Y     T AH TLP  + +++TN  NG S++VRV DRGP+
Sbjct: 28  GKASYYSNGLHGRRMSNGERYDRNAFTCAHRTLPFGTRLKITNPRNGKSVIVRVTDRGPF 87

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R++DLS AAA+ L     GV+ V VE +
Sbjct: 88  VRGRVVDLSYAAARELGTLASGVAYVKVELV 118


>gi|254502838|ref|ZP_05114989.1| putative rare lipoprotein A double-psi beta-barrel [Labrenzia
           alexandrii DFL-11]
 gi|222438909|gb|EEE45588.1| putative rare lipoprotein A double-psi beta-barrel [Labrenzia
           alexandrii DFL-11]
          Length = 143

 Score = 82.8 bits (203), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 62/102 (60%), Gaps = 4/102 (3%)

Query: 77  WYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMEN 135
           W  P +   ++   G ASWY     G  TA+GE      + AAHP+LP  +   VTN+ N
Sbjct: 29  WAAPAKAEESFVQCGKASWYN--LRG-TTASGEQADPNKLAAAHPSLPFGTLATVTNLRN 85

Query: 136 GISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           G S+VVR+NDRGP+   R+ID++ AAA+ L   ++G++KV V
Sbjct: 86  GKSVVVRINDRGPFVKRRIIDVTQAAAQKLGFVQQGIAKVKV 127


>gi|88808735|ref|ZP_01124245.1| hypothetical protein WH7805_03557 [Synechococcus sp. WH 7805]
 gi|88787723|gb|EAR18880.1| hypothetical protein WH7805_03557 [Synechococcus sp. WH 7805]
          Length = 154

 Score = 82.8 bits (203), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 63/103 (61%)

Query: 78  YVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGI 137
           ++  + T     G A+WYG  ++GR TA+G+V     +TAAH +LPL + V+VT ++   
Sbjct: 51  HLASEDTVKTMKGRATWYGPGYYGRKTASGDVLKKGTMTAAHSSLPLGTEVKVTRVDTNE 110

Query: 138 SLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           S+ V +NDR PY    +IDL++ AA  L ++E G + V VE +
Sbjct: 111 SVTVVINDRKPYKKGTVIDLAHGAADALDIDEDGTASVIVEVI 153


>gi|325859617|ref|ZP_08172750.1| rare lipoprotein A double-psi beta-barrel protein [Prevotella
           denticola CRIS 18C-A]
 gi|327314416|ref|YP_004329853.1| rare lipoprotein A double-psi beta-barrel protein [Prevotella
           denticola F0289]
 gi|325482897|gb|EGC85897.1| rare lipoprotein A double-psi beta-barrel protein [Prevotella
           denticola CRIS 18C-A]
 gi|326945897|gb|AEA21782.1| rare lipoprotein A double-psi beta-barrel protein [Prevotella
           denticola F0289]
          Length = 256

 Score = 82.8 bits (203), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 56/91 (61%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+Y    HGR  +NGE Y     T AH TLP  + +RVTN  NG S++VRV DRGP+
Sbjct: 28  GKASYYSNGLHGRRMSNGERYDRNGFTCAHRTLPFGTRLRVTNPRNGRSVIVRVTDRGPF 87

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R++DLS AAA+ L     GV+ V VE +
Sbjct: 88  VRGRVVDLSYAAARELGTLSCGVAYVKVEVV 118


>gi|302345111|ref|YP_003813464.1| lipoprotein A-like protein [Prevotella melaninogenica ATCC 25845]
 gi|302149540|gb|ADK95802.1| lipoprotein A-like protein [Prevotella melaninogenica ATCC 25845]
          Length = 264

 Score = 82.8 bits (203), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 56/91 (61%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+Y    HGR  +NGE Y     T AH TLP  + +++TN  NG S++VRV DRGP+
Sbjct: 28  GKASYYSNGLHGRRMSNGERYDRNAFTCAHRTLPFGTRLKITNPRNGKSVIVRVTDRGPF 87

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R++DLS AAA+ L     GV+ V VE +
Sbjct: 88  VRGRVVDLSYAAARELGTLASGVAYVKVELV 118


>gi|154248308|ref|YP_001419266.1| rare lipoprotein A [Xanthobacter autotrophicus Py2]
 gi|154162393|gb|ABS69609.1| rare lipoprotein A [Xanthobacter autotrophicus Py2]
          Length = 119

 Score = 82.4 bits (202), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 64/102 (62%), Gaps = 3/102 (2%)

Query: 79  VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGIS 138
           V     A  + G+AS+Y   + GR TA+GE +    +TAAH +LP  + VRVTN+ NG +
Sbjct: 20  VSNTAKADTSTGVASYY---WQGRSTASGERFNPSAMTAAHRSLPFGTKVRVTNLRNGRT 76

Query: 139 LVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +VVR+NDRGP+   R+ID+S AAA  L     G+++V +  +
Sbjct: 77  VVVRINDRGPFVRGRVIDVSRAAASELGFTNSGITRVALAVM 118


>gi|289646974|ref|ZP_06478317.1| rplA family protein [Pseudomonas syringae pv. aesculi str. 2250]
          Length = 122

 Score = 82.4 bits (202), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 59/95 (62%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           Y   G A++YG   HG  TA+GE +    +TAAH  LP  + V+V N++N  S+VVR+ND
Sbjct: 27  YDETGTAAYYGARHHGNRTASGEPFNQNALTAAHRQLPFGTRVKVINLDNDRSVVVRIND 86

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+   RLID+S  AA+ L +   G + V V+ L
Sbjct: 87  RGPHTRGRLIDVSREAAEQLGMLRSGTAPVRVQAL 121


>gi|160874311|ref|YP_001553627.1| rare lipoprotein A [Shewanella baltica OS195]
 gi|160859833|gb|ABX48367.1| rare lipoprotein A [Shewanella baltica OS195]
 gi|315266546|gb|ADT93399.1| rare lipoprotein A [Shewanella baltica OS678]
          Length = 137

 Score = 82.4 bits (202), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (60%)

Query: 82  QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVV 141
            +  +   G AS+YG     + TA+GE+Y  +  TAAH  LP  S V+VTN++NG S++V
Sbjct: 38  NWVGFTESGQASFYGDKHQNKQTASGELYKHKLKTAAHKKLPFGSSVKVTNVDNGKSVIV 97

Query: 142 RVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           ++NDRGP+   R+IDLS +A   +     G+  V +E +
Sbjct: 98  KINDRGPFVRGRIIDLSKSAFSSIGNISSGLIDVKIEVI 136


>gi|332885254|gb|EGK05505.1| hypothetical protein HMPREF9456_02706 [Dysgonomonas mossii DSM
           22836]
          Length = 136

 Score = 82.4 bits (202), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 62/93 (66%), Gaps = 1/93 (1%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
           VG+A++YGK F+ R TA+GE+Y  + +  AH T P  S ++V +++N   ++V+V DRGP
Sbjct: 23  VGLATYYGKKFNNRKTASGEIYKKDSMVCAHRTYPFGSLLKVKSLKNDKEIIVKVIDRGP 82

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHV-EYL 180
           +    +IDLS AAAK L +   G+ KV V EY+
Sbjct: 83  FRKKCIIDLSYAAAKELDMVHHGLMKVEVSEYI 115


>gi|206890530|ref|YP_002249199.1| lipoprotein, RlpA family [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206742468|gb|ACI21525.1| lipoprotein, RlpA family [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 214

 Score = 82.4 bits (202), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 61/95 (64%)

Query: 87  AAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDR 146
           A  G+ASWYG  FHGR TA+GE+Y     T AH   P  + ++V N++NG ++   VNDR
Sbjct: 23  ARKGVASWYGPDFHGRPTASGEIYNMYDYTCAHREYPFGTKLKVVNLQNGKNVTCTVNDR 82

Query: 147 GPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           GP+ S R +DLS A+AK + +   G ++V +E +G
Sbjct: 83  GPFVSGRDLDLSYASAKKIDLIGPGTAEVLMEPVG 117


>gi|289627546|ref|ZP_06460500.1| rplA family protein [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|330868259|gb|EGH02968.1| rplA family protein [Pseudomonas syringae pv. aesculi str. 0893_23]
          Length = 122

 Score = 82.4 bits (202), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 59/95 (62%)

Query: 86  YAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVND 145
           Y   G A++YG   HG  TA+GE +    +TAAH  LP  + V+V N++N  S+VVR+ND
Sbjct: 27  YDETGTAAYYGARHHGNRTASGEPFNQNALTAAHRQLPFGTRVKVINLDNDRSVVVRIND 86

Query: 146 RGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           RGP+   RLID+S  AA+ L +   G + V V+ L
Sbjct: 87  RGPHTRGRLIDVSREAAEQLGMLRSGTAPVRVQAL 121


>gi|77360947|ref|YP_340522.1| rlpA-like lipoprotein precursor [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76875858|emb|CAI87079.1| conserved protein of unknown function ; putative rlpA-like
           lipoprotein precursor [Pseudoalteromonas haloplanktis
           TAC125]
          Length = 129

 Score = 82.4 bits (202), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 58/95 (61%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
           +G AS+Y   + GR TANGE +  +  TAAH  L   + V+VTN+ N  S++VRVNDRGP
Sbjct: 34  LGKASFYADKYQGRTTANGERFDQQAATAAHLKLAFGTKVKVTNLANNKSVIVRVNDRGP 93

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           Y   R+IDLS++  K +   + GV  V V  +  A
Sbjct: 94  YIRGRIIDLSSSMFKKIADPKVGVIDVQVTVIDKA 128


>gi|108803813|ref|YP_643750.1| rare lipoprotein A [Rubrobacter xylanophilus DSM 9941]
 gi|108765056|gb|ABG03938.1| rare lipoprotein A [Rubrobacter xylanophilus DSM 9941]
          Length = 204

 Score = 82.4 bits (202), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 59/97 (60%), Gaps = 2/97 (2%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
           A A   +ASWYG  F G  TA+GE Y     TAAH TLPL + ++V+   NG S++V VN
Sbjct: 25  AEAETALASWYGPGFAGNPTASGEPYDPSAFTAAHKTLPLGTQLQVS--YNGRSVLVTVN 82

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           DRGPY   R +DLS AAA+ L + + GV  V   Y G
Sbjct: 83  DRGPYVPGRELDLSQAAAEYLGLTQAGVDYVTYNYAG 119


>gi|158423915|ref|YP_001525207.1| rare lipoprotein A [Azorhizobium caulinodans ORS 571]
 gi|158330804|dbj|BAF88289.1| rare lipoprotein A [Azorhizobium caulinodans ORS 571]
          Length = 141

 Score = 82.4 bits (202), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 42/92 (45%), Positives = 62/92 (67%), Gaps = 3/92 (3%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
            G+AS+Y   + GR TA+GE +    +TAAH +LP  + VRVTN++NG ++VVR+NDRGP
Sbjct: 43  TGVASYY---WQGRGTASGERFNPNALTAAHRSLPFGTKVRVTNLKNGRTVVVRINDRGP 99

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           +   R+ID+S AAA  L  +  G +KV +  +
Sbjct: 100 FVRGRIIDVSKAAAGELGFKGSGTTKVALSVV 131


>gi|255021222|ref|ZP_05293272.1| Rare lipoprotein A precursor [Acidithiobacillus caldus ATCC 51756]
 gi|254969337|gb|EET26849.1| Rare lipoprotein A precursor [Acidithiobacillus caldus ATCC 51756]
          Length = 261

 Score = 82.0 bits (201), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 65/113 (57%), Gaps = 2/113 (1%)

Query: 69  KPYQIMGRWYVP-RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSY 127
           + Y + GR Y P      Y   G ASWYG    G +T+ G  +  +  +AA   LPLP+ 
Sbjct: 54  RSYVVNGRRYQPLTTADGYDRSGTASWYGWE-SGSVTSMGTPFVPQAFSAASRELPLPTC 112

Query: 128 VRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VRVTN+ NG S+ V VNDRGP+   RL+DLS  AAK+L +   G + V VE L
Sbjct: 113 VRVTNLANGRSVEVLVNDRGPFVDGRLLDLSYGAAKVLDMIHSGTAVVRVEAL 165


>gi|260907050|ref|ZP_05915372.1| rare lipoprotein A [Brevibacterium linens BL2]
          Length = 271

 Score = 82.0 bits (201), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%)

Query: 102 RLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAA 161
           R TANGE++ T  +TAAH TLP  S V++TN  NG S+ VR+NDRGP+H +R IDLS AA
Sbjct: 193 RPTANGEIFDTNKLTAAHKTLPFGSQVKITNTANGKSVTVRINDRGPHHGSRCIDLSKAA 252


>gi|53804947|ref|YP_113250.1| rare lipoprotein A [Methylococcus capsulatus str. Bath]
 gi|53758708|gb|AAU92999.1| putative rare lipoprotein A [Methylococcus capsulatus str. Bath]
          Length = 135

 Score = 81.6 bits (200), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 58/91 (63%)

Query: 88  AVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRG 147
           +VGMAS+Y   FHGR TA+GE Y  + +TA H + P  + +RVTN+ N  S++VRVNDR 
Sbjct: 38  SVGMASYYSDRFHGRRTASGERYNRDALTAVHNSFPFGTLLRVTNLRNHRSVLVRVNDRS 97

Query: 148 PYHSNRLIDLSNAAAKILRVEERGVSKVHVE 178
                RL+DLS  AA+ L     G++ V +E
Sbjct: 98  SRRHGRLLDLSKRAARELGFLGAGLALVKLE 128


>gi|307564526|ref|ZP_07627067.1| lipoprotein A-like protein [Prevotella amnii CRIS 21A-A]
 gi|307346886|gb|EFN92182.1| lipoprotein A-like protein [Prevotella amnii CRIS 21A-A]
          Length = 227

 Score = 81.6 bits (200), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 56/91 (61%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+Y    HGR  +NG+VY     T AH TLP  + ++VTN  +G ++ VRV DRGP+
Sbjct: 29  GKASYYSNNLHGRRMSNGQVYNKNDFTCAHRTLPFGTRLKVTNPRSGKTITVRVADRGPF 88

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R+IDLS AAA+ L +   GV  V +E +
Sbjct: 89  VRGRIIDLSYAAARALGIISSGVGYVRIEVM 119


>gi|315500933|ref|YP_004079820.1| rare lipoprotein a [Micromonospora sp. L5]
 gi|315407552|gb|ADU05669.1| rare lipoprotein A [Micromonospora sp. L5]
          Length = 210

 Score = 81.6 bits (200), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/90 (47%), Positives = 56/90 (62%), Gaps = 3/90 (3%)

Query: 92  ASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHS 151
           AS+Y +   G++TANGE +  + +TAAH TLP  + VRVTN  NG S+VVR+NDRGP+  
Sbjct: 124 ASFYAE---GQMTANGETFNPDALTAAHKTLPFNTKVRVTNPANGKSVVVRINDRGPFID 180

Query: 152 NRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
            R +DLS AA   +     G   V  E LG
Sbjct: 181 GRCLDLSRAAFATIAATSLGHVNVRYEVLG 210


>gi|302864640|ref|YP_003833277.1| rare lipoprotein A [Micromonospora aurantiaca ATCC 27029]
 gi|302567499|gb|ADL43701.1| rare lipoprotein A [Micromonospora aurantiaca ATCC 27029]
          Length = 215

 Score = 81.6 bits (200), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/90 (47%), Positives = 56/90 (62%), Gaps = 3/90 (3%)

Query: 92  ASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHS 151
           AS+Y +   G++TANGE +  + +TAAH TLP  + VRVTN  NG S+VVR+NDRGP+  
Sbjct: 129 ASFYAE---GQMTANGETFNPDALTAAHKTLPFNTKVRVTNPANGKSVVVRINDRGPFID 185

Query: 152 NRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
            R +DLS AA   +     G   V  E LG
Sbjct: 186 GRCLDLSRAAFATIAATSLGHVNVRYEVLG 215


>gi|222147271|ref|YP_002548228.1| rare lipoprotein A [Agrobacterium vitis S4]
 gi|221734261|gb|ACM35224.1| rare lipoprotein A [Agrobacterium vitis S4]
          Length = 144

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 62/104 (59%), Gaps = 3/104 (2%)

Query: 78  YVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGI 137
           + P Q  A    G ASWY  A + R TA+GE       TAAH +LP  S V+VTN  NG 
Sbjct: 44  FSPLQAFAANGCGGASWY--ALYSR-TASGERMNPTTFTAAHKSLPFGSKVKVTNRNNGK 100

Query: 138 SLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
           ++VVR+NDRGP+   R++DLS AAA  + +   G +KV  E +G
Sbjct: 101 TVVVRINDRGPFIKGRVLDLSKAAAADIGMVGSGTAKVCYELIG 144


>gi|329850688|ref|ZP_08265533.1| rare lipoprotein A [Asticcacaulis biprosthecum C19]
 gi|328841003|gb|EGF90574.1| rare lipoprotein A [Asticcacaulis biprosthecum C19]
          Length = 158

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/69 (56%), Positives = 50/69 (72%)

Query: 115 ITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSK 174
           I+AAH T PLPS   VTN++NG ++ VRVNDRGP+ + R+IDLS  AAK L V   G +K
Sbjct: 5   ISAAHKTFPLPSIAEVTNLDNGKTIRVRVNDRGPFSNGRIIDLSRGAAKALGVYTTGTAK 64

Query: 175 VHVEYLGMA 183
           V V++LG A
Sbjct: 65  VRVKFLGPA 73


>gi|222109817|ref|YP_002552081.1| rare lipoprotein a [Acidovorax ebreus TPSY]
 gi|221729261|gb|ACM32081.1| rare lipoprotein A [Acidovorax ebreus TPSY]
          Length = 238

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/92 (48%), Positives = 62/92 (67%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG + HGR TA+GE +    +TAAH TLP  + V V ++ NG  +VVRVNDRGP+
Sbjct: 95  GLASWYGGSLHGRRTASGERFDRGELTAAHRTLPFGARVCVRSLVNGKVVVVRVNDRGPF 154

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
              R+IDLS AAA+ L +   G+  V + ++G
Sbjct: 155 APGRVIDLSQAAAQELGMVGLGIKPVEIWHMG 186


>gi|325105148|ref|YP_004274802.1| rare lipoprotein A [Pedobacter saltans DSM 12145]
 gi|324973996|gb|ADY52980.1| rare lipoprotein A [Pedobacter saltans DSM 12145]
          Length = 142

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/90 (45%), Positives = 60/90 (66%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G A++Y   F GR T +G+VY  E +TAAH TLP  + V VTN +NG S+ V +NDRGP+
Sbjct: 32  GKATYYHSKFVGRKTTSGQVYRHEKLTAAHRTLPFGTEVTVTNPKNGKSVTVVINDRGPF 91

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEY 179
           + + +IDLS +AAK + +   G++ V + Y
Sbjct: 92  NRHLMIDLSQSAAKEIGIFGAGIAPVEMSY 121


>gi|317123117|ref|YP_004103120.1| lipoprotein A [Thermaerobacter marianensis DSM 12885]
 gi|315593097|gb|ADU52393.1| rare lipoprotein A [Thermaerobacter marianensis DSM 12885]
          Length = 417

 Score = 81.3 bits (199), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 57/85 (67%)

Query: 91  MASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYH 150
           +ASWYG  F+GR TA+GE++    +TAAH T+P  + + VT  E G S+ VR+NDRGP+ 
Sbjct: 324 VASWYGPGFYGRPTASGEIFTGREMTAAHRTMPFGTVLLVTYPETGRSVQVRINDRGPFV 383

Query: 151 SNRLIDLSNAAAKILRVEERGVSKV 175
             R +DLS AAA+ L +   GV +V
Sbjct: 384 EGRDLDLSEAAAEALGMVSAGVVRV 408


>gi|121593049|ref|YP_984945.1| rare lipoprotein A [Acidovorax sp. JS42]
 gi|120605129|gb|ABM40869.1| rare lipoprotein A [Acidovorax sp. JS42]
          Length = 175

 Score = 81.3 bits (199), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/92 (48%), Positives = 62/92 (67%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+ASWYG + HGR TA+GE +    +TAAH TLP  + V V ++ NG  +VVRVNDRGP+
Sbjct: 32  GLASWYGGSLHGRRTASGERFDRGELTAAHRTLPFGARVCVRSLVNGKVVVVRVNDRGPF 91

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
              R+IDLS AAA+ L +   G+  V + ++G
Sbjct: 92  APGRVIDLSQAAAQELGMVGLGIKPVEIWHMG 123


>gi|90577445|ref|ZP_01233256.1| Lipoprotein A family protein [Vibrio angustum S14]
 gi|90440531|gb|EAS65711.1| Lipoprotein A family protein [Vibrio angustum S14]
          Length = 138

 Score = 81.3 bits (199), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 56/91 (61%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+Y   + GR TA+G+ +     TAAH TLP  + V+VTN+ N  S+VV VNDRGP+
Sbjct: 47  GKASYYANKYQGRKTASGQRFDQNKPTAAHRTLPFGTKVKVTNLANSKSVVVTVNDRGPF 106

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R+IDLS +A   +     GV KV VE L
Sbjct: 107 TKGRVIDLSRSAFSAIGNTASGVLKVKVETL 137


>gi|288801369|ref|ZP_06406823.1| RplA family protein [Prevotella sp. oral taxon 299 str. F0039]
 gi|288331752|gb|EFC70236.1| RplA family protein [Prevotella sp. oral taxon 299 str. F0039]
          Length = 203

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 61/94 (64%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G A++Y K   G  TA+GE+   + +T AH T P  S +RVTN ENG  ++VRV DRGP+
Sbjct: 14  GKATFYSKRATGARTASGELLHHDSLTCAHRTYPFGSKLRVTNPENGKDVIVRVTDRGPF 73

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
              R+IDLS +AA IL +  +GV+ V VE + ++
Sbjct: 74  ARGRIIDLSWSAANILGILSKGVASVIVEPIEIS 107


>gi|94496387|ref|ZP_01302964.1| Sporulation related protein [Sphingomonas sp. SKA58]
 gi|94424133|gb|EAT09157.1| Sporulation related protein [Sphingomonas sp. SKA58]
          Length = 308

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 70/124 (56%), Gaps = 12/124 (9%)

Query: 66  FLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLP 125
            LG+ Y + G  Y P    AY  VG A+   +   G  TANGE +  + ITAAH TLPLP
Sbjct: 37  LLGEAYNVAGVLYRPADPAAYDEVGYAAAMAEGSQGAKTANGEAFAADAITAAHKTLPLP 96

Query: 126 SYVRVTNMENGISLVVRVNDRGPYHSNRLIDLS------------NAAAKILRVEERGVS 173
           SYV VT +++G +++ RVNDRGP  ++RLI LS            +AA ++ RV   G  
Sbjct: 97  SYVEVTALDSGRTILARVNDRGPMRNDRLIGLSLGAMAQLGLAGPSAAVRVRRVNPPGQD 156

Query: 174 KVHV 177
           +V +
Sbjct: 157 QVAL 160


>gi|110638617|ref|YP_678826.1| rare lipoprotein A-like protein [Cytophaga hutchinsonii ATCC 33406]
 gi|110281298|gb|ABG59484.1| rare lipoprotein A-like protein [Cytophaga hutchinsonii ATCC 33406]
          Length = 249

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 57/93 (61%)

Query: 88  AVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRG 147
             G AS+Y   F G+ TA+GE Y     TAAH T    + ++VTN++ GI + V VNDRG
Sbjct: 44  TTGSASYYANKFQGKRTASGETYDKNKFTAAHRTYAFGTKLKVTNIKTGIWIQVYVNDRG 103

Query: 148 PYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           PY  +R+ID+S AAA  L + + G  +V +E L
Sbjct: 104 PYAKDRIIDVSYAAATALGMIQPGTIQVKLEIL 136


>gi|330721406|gb|EGG99469.1| Rare lipoprotein A precursor [gamma proteobacterium IMCC2047]
          Length = 216

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 51/66 (77%)

Query: 115 ITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSK 174
           +TAAH +LP+P+YV+VTN+ NG  ++VRVNDRGP+H +R+IDLS AAA  L    +G ++
Sbjct: 4   MTAAHKSLPIPTYVKVTNLSNGRHVIVRVNDRGPFHEDRIIDLSYAAATKLGYANKGTAQ 63

Query: 175 VHVEYL 180
           V VE +
Sbjct: 64  VRVEAI 69


>gi|222054002|ref|YP_002536364.1| rare lipoprotein A [Geobacter sp. FRC-32]
 gi|221563291|gb|ACM19263.1| rare lipoprotein A [Geobacter sp. FRC-32]
          Length = 157

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 58/99 (58%)

Query: 79  VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGIS 138
            P++     AVG+AS+Y K + GR T +G  Y  E +TAAH  LP  + V+VTN+ NG  
Sbjct: 49  TPKEAKDAEAVGIASYYAKRYDGRKTTSGARYNPEKMTAAHQALPFGTKVKVTNLSNGKE 108

Query: 139 LVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           +VV VNDR        IDLS AAA+ L     G++KV +
Sbjct: 109 VVVTVNDRCRKRKKPFIDLSRAAARELGFLGNGIAKVKI 147


>gi|149279602|ref|ZP_01885731.1| Rare lipoprotein A [Pedobacter sp. BAL39]
 gi|149229638|gb|EDM35028.1| Rare lipoprotein A [Pedobacter sp. BAL39]
          Length = 128

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 57/96 (59%)

Query: 84  TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRV 143
           T +   G A++Y K F G  T++G  Y    +TAAH +LP  + V VTN+ NG S+ V V
Sbjct: 28  TNFRKTGYATYYAKRFEGHRTSSGVRYRASKMTAAHLSLPFGTIVTVTNLSNGKSIDVEV 87

Query: 144 NDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEY 179
           NDRGP+    +IDLS  AAK L    +G SKV + Y
Sbjct: 88  NDRGPHSKKYMIDLSAGAAKELGFYRQGHSKVEISY 123


>gi|307544854|ref|YP_003897333.1| lipoprotein A [Halomonas elongata DSM 2581]
 gi|307216878|emb|CBV42148.1| K03642 rare lipoprotein A [Halomonas elongata DSM 2581]
          Length = 139

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 59/91 (64%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+AS+Y   F GR TA+G  +  + +TAAH +LP  + V VT  +NG  + V +NDRGPY
Sbjct: 48  GVASYYSDRFQGRTTASGVPFDQKALTAAHKSLPFGTKVLVTRRDNGRQVEVMINDRGPY 107

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R+IDLS +AA+ L +  RGV+ V + Y+
Sbjct: 108 VDGRVIDLSKSAARELGMLGRGVAPVELSYV 138


>gi|330464975|ref|YP_004402718.1| rare lipoprotein a [Verrucosispora maris AB-18-032]
 gi|328807946|gb|AEB42118.1| rare lipoprotein a [Verrucosispora maris AB-18-032]
          Length = 211

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/90 (48%), Positives = 58/90 (64%), Gaps = 3/90 (3%)

Query: 92  ASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHS 151
           AS+Y   + G++TANGE +  E +TAAH TLP  S VRVTN  NG S+ VR+NDRGP+ +
Sbjct: 125 ASFY---WQGQMTANGETFNPEDMTAAHKTLPFNSKVRVTNPANGKSITVRINDRGPFIA 181

Query: 152 NRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
            R +DLS AA   +   + G  +V  E LG
Sbjct: 182 GRCLDLSRAAFAEIASLDLGHIEVRYEVLG 211


>gi|328541630|ref|YP_004301739.1| Rare lipoprotein A-like double-psi beta-barrel [polymorphum gilvum
           SL003B-26A1]
 gi|326411382|gb|ADZ68445.1| Rare lipoprotein A-like double-psi beta-barrel [Polymorphum gilvum
           SL003B-26A1]
          Length = 141

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/103 (44%), Positives = 61/103 (59%), Gaps = 3/103 (2%)

Query: 81  RQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLV 140
           R   A    G+ASWY        TA+GE    E +TAAH +LP  S V V N +NG S+ 
Sbjct: 32  RTEAAPVQCGLASWYQLTSR---TASGERADPETLTAAHRSLPFGSLVTVVNRDNGRSVT 88

Query: 141 VRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           +RVNDRGP+  NR+ID+S  AA+ L   ++GV++V V   G A
Sbjct: 89  LRVNDRGPFVKNRIIDVSRRAARELGFVDKGVTRVQVVAAGNA 131


>gi|117921542|ref|YP_870734.1| rare lipoprotein A [Shewanella sp. ANA-3]
 gi|117613874|gb|ABK49328.1| rare lipoprotein A [Shewanella sp. ANA-3]
          Length = 131

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 60/101 (59%)

Query: 83  YTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVR 142
           +  +   G AS+YG     + TA+GE Y  +  TAAH  +P  S V+VTN++NG ++VV+
Sbjct: 29  WQGFTESGQASFYGDKHQNKKTASGERYNHKLKTAAHKEIPFGSVVKVTNLKNGKTVVVK 88

Query: 143 VNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VNDRGP+   R+IDLS +A   +     G+  V +E +  A
Sbjct: 89  VNDRGPFVRGRIIDLSKSAFSSIGNTSAGLLDVKIEVIQAA 129


>gi|113971260|ref|YP_735053.1| rare lipoprotein A [Shewanella sp. MR-4]
 gi|113885944|gb|ABI39996.1| rare lipoprotein A [Shewanella sp. MR-4]
          Length = 131

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 60/101 (59%)

Query: 83  YTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVR 142
           +  +   G AS+YG     + TA+GE Y  +  TAAH  +P  S V+VTN++NG ++VV+
Sbjct: 29  WQGFTESGQASFYGDKHQNKKTASGERYNHKLKTAAHKEIPFGSVVKVTNLKNGKTVVVK 88

Query: 143 VNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VNDRGP+   R+IDLS +A   +     G+  V +E +  A
Sbjct: 89  VNDRGPFVRGRIIDLSKSAFSSIGNTSAGLLDVKIEVIQAA 129


>gi|326318757|ref|YP_004236429.1| rare lipoprotein A [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323375593|gb|ADX47862.1| rare lipoprotein A [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 108

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/88 (46%), Positives = 55/88 (62%)

Query: 91  MASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYH 150
           MASWYG  FH R TA+GE +     TAAH TLP  + V V ++  G S+ VR+NDRGP+ 
Sbjct: 1   MASWYGARFHSRRTASGERFDMNDFTAAHRTLPFGTRVCVRSLVTGRSVQVRINDRGPHS 60

Query: 151 SNRLIDLSNAAAKILRVEERGVSKVHVE 178
             R++DLS AAA+ L +   G+  V + 
Sbjct: 61  PGRIVDLSRAAAQSLGLLGLGIKPVAIS 88


>gi|93004877|ref|YP_579314.1| rare lipoprotein A [Psychrobacter cryohalolentis K5]
 gi|92392555|gb|ABE73830.1| rare lipoprotein A [Psychrobacter cryohalolentis K5]
          Length = 120

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 53/79 (67%)

Query: 84  TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRV 143
           +A A  G  S+YG  FHG+ TA+G ++    +TAAH TLP  + V+VTN +   S++V++
Sbjct: 17  SATAFAGNTSYYGSKFHGKRTASGSIFNMNSLTAAHRTLPFGTKVQVTNKKTKQSVIVKI 76

Query: 144 NDRGPYHSNRLIDLSNAAA 162
            DRGP+   R++DLS AAA
Sbjct: 77  TDRGPFIRGRILDLSKAAA 95


>gi|149912302|ref|ZP_01900871.1| putative rare lipoprotein A [Moritella sp. PE36]
 gi|149804624|gb|EDM64686.1| putative rare lipoprotein A [Moritella sp. PE36]
          Length = 133

 Score = 80.5 bits (197), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 74/134 (55%), Gaps = 10/134 (7%)

Query: 13  SVVCVVVLGMSSCFFSS-TYKDDKLEYFPESMYGVTASDRIVSGKRVPRGGGRYFLGKPY 71
           +++C+  L +++C  S   Y DD   + PE+   +   D I      P+   RY   + Y
Sbjct: 8   TLLCICGL-LAACSSSRYQYSDD---HAPEN---IPQLDDIADAVPTPQTYSRY-ANRDY 59

Query: 72  QIMGRWY-VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRV 130
           Q+ G  Y V R        G ASWYG  FHG  T+NGE+Y    ++AAH  LPLPS+V+V
Sbjct: 60  QVRGINYEVWRDIKILTQEGKASWYGNKFHGHKTSNGEIYDMFSMSAAHKNLPLPSFVKV 119

Query: 131 TNMENGISLVVRVN 144
           TN+ N  +++VRVN
Sbjct: 120 TNLGNDKTVIVRVN 133


>gi|120612693|ref|YP_972371.1| rare lipoprotein A [Acidovorax citrulli AAC00-1]
 gi|120591157|gb|ABM34597.1| rare lipoprotein A [Acidovorax citrulli AAC00-1]
          Length = 108

 Score = 80.1 bits (196), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 55/88 (62%)

Query: 91  MASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYH 150
           MASWYG  FH R TA+GE +     TAAH TLP  + + V ++  G S+ VR+NDRGP+ 
Sbjct: 1   MASWYGARFHSRRTASGERFDMNDFTAAHRTLPFGTRICVRSLVTGRSVQVRINDRGPHS 60

Query: 151 SNRLIDLSNAAAKILRVEERGVSKVHVE 178
             R++DLS AAA+ L +   G+  V + 
Sbjct: 61  PGRIVDLSRAAAQSLGLLGLGIKPVAIS 88


>gi|163852597|ref|YP_001640640.1| rare lipoprotein A [Methylobacterium extorquens PA1]
 gi|218531438|ref|YP_002422254.1| lipoprotein A [Methylobacterium chloromethanicum CM4]
 gi|240139931|ref|YP_002964408.1| putative rare lipoprotein A precursor [Methylobacterium extorquens
           AM1]
 gi|163664202|gb|ABY31569.1| rare lipoprotein A [Methylobacterium extorquens PA1]
 gi|218523741|gb|ACK84326.1| rare lipoprotein A [Methylobacterium chloromethanicum CM4]
 gi|240009905|gb|ACS41131.1| putative rare lipoprotein A precursor [Methylobacterium extorquens
           AM1]
          Length = 115

 Score = 80.1 bits (196), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 60/96 (62%), Gaps = 5/96 (5%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
           A A  G ASWYG    G+ TANGE +     TAAH +LP  + VRVTN  NG S+VVR+N
Sbjct: 24  AQAQGGRASWYGS---GKKTANGERFNPNGYTAAHRSLPFGTRVRVTNQSNGRSVVVRIN 80

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGP+   R+IDL+  +A+ + +   GVS V +  +
Sbjct: 81  DRGPFIGGRVIDLARGSARAIGMS--GVSYVSLNVV 114


>gi|332830662|gb|EGK03268.1| hypothetical protein HMPREF9455_00656 [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 133

 Score = 79.7 bits (195), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 56/88 (63%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G A++YG  F+ R TA+GE+Y  + +  AH T P  + ++V N+ N   +VVRV DRGP+
Sbjct: 23  GKATFYGTKFNNRKTASGEIYRKDSMVCAHKTYPFGTLLKVKNLHNDKEVVVRVIDRGPF 82

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHV 177
               +IDLS AAAK + +  RGV+ V V
Sbjct: 83  RKKFIIDLSYAAAKKIDMLSRGVADVMV 110


>gi|188582618|ref|YP_001926063.1| rare lipoprotein A [Methylobacterium populi BJ001]
 gi|179346116|gb|ACB81528.1| rare lipoprotein A [Methylobacterium populi BJ001]
          Length = 115

 Score = 79.7 bits (195), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 41/81 (50%), Positives = 53/81 (65%), Gaps = 3/81 (3%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
           A A  G ASWYG    G+ TANGE +     TAAH +LP  + VRVTN  NG S+VVR+N
Sbjct: 24  AQAQGGQASWYGS---GKKTANGERFNPNGYTAAHRSLPFGTRVRVTNRANGRSVVVRIN 80

Query: 145 DRGPYHSNRLIDLSNAAAKIL 165
           DRGP+   R+IDL+  +A+ +
Sbjct: 81  DRGPFVGGRVIDLARGSARAI 101


>gi|254562355|ref|YP_003069450.1| rare lipoprotein A [Methylobacterium extorquens DM4]
 gi|254269633|emb|CAX25604.1| putative rare lipoprotein A precursor [Methylobacterium extorquens
           DM4]
          Length = 115

 Score = 79.7 bits (195), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 60/96 (62%), Gaps = 5/96 (5%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
           A A  G ASWYG    G+ TANGE +     TAAH +LP  + VRVTN  NG S+VVR+N
Sbjct: 24  AQAQGGRASWYGS---GKKTANGERFNPNGYTAAHRSLPFGTRVRVTNQSNGRSVVVRIN 80

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGP+   R+IDL+  +A+ + +   GVS V +  +
Sbjct: 81  DRGPFIGGRVIDLARGSARAIGMS--GVSYVSLNVV 114


>gi|71064619|ref|YP_263346.1| putative lipoprotein A [Psychrobacter arcticus 273-4]
 gi|71037604|gb|AAZ17912.1| putative lipoprotein A [Psychrobacter arcticus 273-4]
          Length = 122

 Score = 79.7 bits (195), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 53/79 (67%)

Query: 84  TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRV 143
           TA+A     S+YG  FHG+ TA+G ++    +TAAH TLP  + V+VTN +   S++V++
Sbjct: 19  TAFAHNTNTSYYGSKFHGKRTASGSIFNMNSLTAAHRTLPFGTKVQVTNKKTKQSVIVKI 78

Query: 144 NDRGPYHSNRLIDLSNAAA 162
            DRGP+   R++DLS AAA
Sbjct: 79  TDRGPFIRGRILDLSKAAA 97


>gi|114048498|ref|YP_739048.1| rare lipoprotein A [Shewanella sp. MR-7]
 gi|113889940|gb|ABI43991.1| rare lipoprotein A [Shewanella sp. MR-7]
          Length = 147

 Score = 79.3 bits (194), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 59/101 (58%)

Query: 83  YTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVR 142
           +  +   G AS+YG     + TA+GE Y  +  TAAH  +P  S V+VTN+ NG ++VV+
Sbjct: 45  WQGFTESGQASFYGDKHQNKKTASGERYSHKLKTAAHKEIPFGSVVKVTNLMNGKTVVVK 104

Query: 143 VNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
           VNDRGP+   R+IDLS +A   +     G+  V +E +  A
Sbjct: 105 VNDRGPFVRGRIIDLSKSAFSSIGNTSAGLLDVKIEVIQAA 145


>gi|119471154|ref|ZP_01613686.1| hypothetical protein ATW7_09261 [Alteromonadales bacterium TW-7]
 gi|119445810|gb|EAW27092.1| hypothetical protein ATW7_09261 [Alteromonadales bacterium TW-7]
          Length = 130

 Score = 79.3 bits (194), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 54/92 (58%)

Query: 89  VGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGP 148
           +G AS+Y   +HGR TANGE +     TAAH      + V+VTN+ N  S++VR+NDRGP
Sbjct: 35  LGKASYYANKYHGRTTANGETFNQNAATAAHLEFDFGTKVKVTNLANNKSVIVRINDRGP 94

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           Y   R+IDLS    K +   + GV  V +  L
Sbjct: 95  YVRGRVIDLSLGMFKKIADPKVGVIDVSISVL 126


>gi|313206095|ref|YP_004045272.1| rare lipoprotein a [Riemerella anatipestifer DSM 15868]
 gi|312445411|gb|ADQ81766.1| rare lipoprotein A [Riemerella anatipestifer DSM 15868]
          Length = 126

 Score = 79.3 bits (194), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 38/80 (47%), Positives = 51/80 (63%)

Query: 92  ASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHS 151
           AS+Y   F+G+ TA+GE++    +TAAH  LP  + V +TN+  G S+VVRVNDRGPY  
Sbjct: 33  ASYYHDKFNGKKTASGEIFNNNELTAAHKRLPFGTLVEITNLRTGKSVVVRVNDRGPYVK 92

Query: 152 NRLIDLSNAAAKILRVEERG 171
            R  DLS AA   +   +RG
Sbjct: 93  GRSFDLSKAAYNAIGDHKRG 112


>gi|239817641|ref|YP_002946551.1| lipoprotein A [Variovorax paradoxus S110]
 gi|239804218|gb|ACS21285.1| rare lipoprotein A [Variovorax paradoxus S110]
          Length = 199

 Score = 79.0 bits (193), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 40/91 (43%), Positives = 57/91 (62%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  FH R TA+GE +    +TAAH TLP  + V V ++ NG  ++VR+ DRGPY
Sbjct: 68  GGASWYGIQFHQRKTASGERFDMMAMTAAHKTLPFNTRVCVRSLVNGSEVLVRITDRGPY 127

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              R+IDLS  AA+ + +   G+ +V +  +
Sbjct: 128 AQGRIIDLSRGAAERIGLIGLGIKQVALTII 158


>gi|319780593|ref|YP_004140069.1| lipoprotein A [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317166481|gb|ADV10019.1| rare lipoprotein A [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 119

 Score = 79.0 bits (193), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 44/82 (53%), Positives = 53/82 (64%), Gaps = 3/82 (3%)

Query: 84  TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRV 143
           TA A  G ASWY  A H R TA+GE      +TAAH TLP  + +RVTN  NG S+VVR+
Sbjct: 26  TAAAQCGRASWY--ALHSR-TASGERMNPSAMTAAHRTLPFGTKLRVTNKNNGRSVVVRI 82

Query: 144 NDRGPYHSNRLIDLSNAAAKIL 165
           NDRGP+   R++DLS  AA  L
Sbjct: 83  NDRGPFIKGRVLDLSKGAAGQL 104


>gi|261324074|ref|ZP_05963271.1| rare lipoprotein A [Brucella neotomae 5K33]
 gi|261300054|gb|EEY03551.1| rare lipoprotein A [Brucella neotomae 5K33]
          Length = 109

 Score = 79.0 bits (193), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 48/101 (47%), Positives = 60/101 (59%), Gaps = 3/101 (2%)

Query: 80  PRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISL 139
           P+     +  G ASWY  A   R TA+GE      +TAAH TLPL S V+VTN +NG SL
Sbjct: 12  PQSRLQQSKCGGASWY--ALTSR-TASGERMNPAGLTAAHRTLPLGSKVKVTNQKNGKSL 68

Query: 140 VVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VVR+NDRGP+   R++DLS  AA  L     G +KV  + L
Sbjct: 69  VVRINDRGPFIKGRVLDLSKGAASRLGFIGAGHTKVCFKPL 109


>gi|320353413|ref|YP_004194752.1| rare lipoprotein A [Desulfobulbus propionicus DSM 2032]
 gi|320121915|gb|ADW17461.1| rare lipoprotein A [Desulfobulbus propionicus DSM 2032]
          Length = 158

 Score = 79.0 bits (193), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 61/94 (64%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G+A+ Y   F GR TA+G+ +    +TAAH  LPL + VRVTN+ N  ++ VR+NDRGP+
Sbjct: 62  GVATVYADKFIGRKTASGQRFRQSELTAAHRLLPLGTKVRVTNLRNQKTVEVRINDRGPW 121

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMA 183
              R+IDLS AAA  + + +RG + V +E +  A
Sbjct: 122 AKGRIIDLSAAAAAKVGMAKRGTALVKLEVVSSA 155


>gi|114561248|ref|YP_748761.1| rare lipoprotein A [Shewanella frigidimarina NCIMB 400]
 gi|114332541|gb|ABI69923.1| rare lipoprotein A [Shewanella frigidimarina NCIMB 400]
          Length = 129

 Score = 78.6 bits (192), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 56/96 (58%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
            +   G AS+Y        TA+G++Y     TAAH TLP  S V+VTN  NG S++V++N
Sbjct: 33  GFTESGQASYYSDRHQNNKTASGDIYQHNQKTAAHKTLPFGSNVKVTNTNNGKSVIVKIN 92

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           DRGP+   R+IDLS +A   +     GV  V++E +
Sbjct: 93  DRGPFVKGRIIDLSKSAFSSIGNISTGVINVNIEVV 128


>gi|85711150|ref|ZP_01042210.1| Lipoprotein A family protein [Idiomarina baltica OS145]
 gi|85695063|gb|EAQ33001.1| Lipoprotein A family protein [Idiomarina baltica OS145]
          Length = 126

 Score = 78.6 bits (192), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 58/101 (57%)

Query: 80  PRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISL 139
           P         G AS+Y   +  R TA+GE Y     TAAH TLP  + VRVTN+ NG S+
Sbjct: 24  PAHLVGQVETGKASYYAMKYQFRTTASGERYSHFDDTAAHKTLPFGTLVRVTNLANGESV 83

Query: 140 VVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VV++NDRGP+   R+IDLS +A   +   + G+  V ++ +
Sbjct: 84  VVKINDRGPFIKGRIIDLSRSAFSEIADLDVGIIDVKMQVI 124


>gi|296532603|ref|ZP_06895308.1| RplA family protein [Roseomonas cervicalis ATCC 49957]
 gi|296267094|gb|EFH13014.1| RplA family protein [Roseomonas cervicalis ATCC 49957]
          Length = 112

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 56/99 (56%)

Query: 79  VPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGIS 138
            PR        G AS+Y   FHGR  ANG  +     TAA  TLPL S  RV N+ENG S
Sbjct: 6   APRAGQRRVIRGRASYYANRFHGRRMANGRRFDRHAHTAASRTLPLGSRARVRNLENGRS 65

Query: 139 LVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
             V + DRGP+  +R+IDLS A A  L +  +G+++V V
Sbjct: 66  ATVTITDRGPHLRSRVIDLSPATAAQLGMLRQGLARVEV 104


>gi|225181537|ref|ZP_03734979.1| rare lipoprotein A [Dethiobacter alkaliphilus AHT 1]
 gi|225167785|gb|EEG76594.1| rare lipoprotein A [Dethiobacter alkaliphilus AHT 1]
          Length = 343

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/92 (47%), Positives = 58/92 (63%), Gaps = 2/92 (2%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPS-YVRVTNMENGISLVVRVNDRGP 148
           G A+WYG  FHG  TANGE++    +TAA P+  +    +RVTN  NG S+VVRVND GP
Sbjct: 252 GEATWYGPGFHGNRTANGEIFDQNALTAAFPSHSMMGRNLRVTNTRNGRSVVVRVNDFGP 311

Query: 149 YHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
             +  +IDLS AAA+ + +   G + V VE L
Sbjct: 312 -STGAIIDLSKAAAEAIGMVSAGRANVKVEVL 342


>gi|237738433|ref|ZP_04568914.1| conserved hypothetical protein [Fusobacterium mortiferum ATCC 9817]
 gi|229420313|gb|EEO35360.1| conserved hypothetical protein [Fusobacterium mortiferum ATCC 9817]
          Length = 138

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 56/96 (58%), Gaps = 1/96 (1%)

Query: 84  TAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRV 143
           TA  + G ASWYGK F G+LTA+G VY +  +T A    P  + ++VTN ENG S++V V
Sbjct: 14  TACTSTGTASWYGKGFEGKLTASGYVYDSNQLTCASNDYPFGTVLKVTNKENGKSVLVVV 73

Query: 144 NDRGPYHS-NRLIDLSNAAAKILRVEERGVSKVHVE 178
            DRG +    R IDLS AA   +     G+  V VE
Sbjct: 74  TDRGGFEKYGRKIDLSRAAFNKIASTGHGLIDVKVE 109


>gi|209967323|ref|YP_002300238.1| rare lipoprotein A, putative [Rhodospirillum centenum SW]
 gi|209960789|gb|ACJ01426.1| rare lipoprotein A, putative [Rhodospirillum centenum SW]
          Length = 187

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/110 (42%), Positives = 63/110 (57%), Gaps = 5/110 (4%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+YG  F GR TA+GE +     TAA   LPL +   VT++E G S+ V VNDRGPY
Sbjct: 62  GEASFYGDGFQGRRTASGERFDQAKPTAASKDLPLGTRAEVTHLETGRSVEVTVNDRGPY 121

Query: 150 HSNRLIDLSNAAAKILRV-EERGVSKVHVEYLGMALLNGMDQEYLRSTVM 198
              R+IDLS  AAK + + ++ G + V V    +A  +    E LR  V+
Sbjct: 122 VEGRIIDLSKQAAKAVGLTKQEGTAPVEV----VARPSDQPTEELRRKVL 167


>gi|56460865|ref|YP_156146.1| lipoprotein A family protein [Idiomarina loihiensis L2TR]
 gi|56179875|gb|AAV82597.1| Lipoprotein A family protein [Idiomarina loihiensis L2TR]
          Length = 135

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 58/101 (57%)

Query: 80  PRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISL 139
           P+        G AS+Y   +  R TA+GE Y     TAAH TLP  + VRVTN+ N  S+
Sbjct: 34  PQNVVGTRESGKASYYAMKYQFRTTASGETYNHFSSTAAHRTLPFGTKVRVTNIANNKSV 93

Query: 140 VVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
           VV++NDRGP+   R+IDLS +A   +   + GV +V  E +
Sbjct: 94  VVKINDRGPFIDGRVIDLSRSAFDKIADLDSGVIEVATEVV 134


>gi|238062003|ref|ZP_04606712.1| rare lipoprotein A [Micromonospora sp. ATCC 39149]
 gi|237883814|gb|EEP72642.1| rare lipoprotein A [Micromonospora sp. ATCC 39149]
          Length = 209

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/90 (47%), Positives = 55/90 (61%), Gaps = 3/90 (3%)

Query: 92  ASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHS 151
           AS+Y +   G+LTANGE +    +TAAH TLP  + VRVTN  NG S+ VR+NDRGP+  
Sbjct: 123 ASFYDE---GQLTANGENFDPSALTAAHKTLPFDTKVRVTNPANGKSVTVRINDRGPFVD 179

Query: 152 NRLIDLSNAAAKILRVEERGVSKVHVEYLG 181
            R +DLS AA   +   + G   V  E LG
Sbjct: 180 GRCLDLSRAAFAAIASVDVGALTVKYEVLG 209


>gi|162147145|ref|YP_001601606.1| RlpA-like protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|161785722|emb|CAP55293.1| putative RlpA-like protein [Gluconacetobacter diazotrophicus PAl 5]
          Length = 231

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 61/98 (62%)

Query: 78  YVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGI 137
           +V R   +++  G+ASWYG     R T++G  +    +TAAHPTLP+ + V V + + G 
Sbjct: 94  HVGRSALSWSEQGVASWYGHLRRVRPTSSGRAFDPRALTAAHPTLPMGTRVLVRSEDTGR 153

Query: 138 SLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKV 175
           S+VV VNDRGP+  +R+IDLS AAA  L +   G + V
Sbjct: 154 SVVVTVNDRGPFLGSRIIDLSPAAAARLGMLNAGTAHV 191


>gi|170747154|ref|YP_001753414.1| rare lipoprotein A [Methylobacterium radiotolerans JCM 2831]
 gi|170653676|gb|ACB22731.1| rare lipoprotein A [Methylobacterium radiotolerans JCM 2831]
          Length = 116

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/81 (50%), Positives = 51/81 (62%), Gaps = 3/81 (3%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
           A A  G ASWYG    G  TANGE +    +TAAH +LP  + VRV N   G S+VVR+N
Sbjct: 25  AAAQSGAASWYGS---GHRTANGERFNPNGLTAAHRSLPFGTRVRVENKRTGRSVVVRIN 81

Query: 145 DRGPYHSNRLIDLSNAAAKIL 165
           DRGP+   R+IDLS  +A+ L
Sbjct: 82  DRGPFVRGRIIDLSRGSARAL 102


>gi|163782621|ref|ZP_02177618.1| reverse gyrase [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882194|gb|EDP75701.1| reverse gyrase [Hydrogenivirga sp. 128-5-R1-1]
          Length = 219

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 53/83 (63%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWYG  FHGR TA+G  +      AAH TLPL + + V N++NG ++ V+V DRGPY
Sbjct: 125 GYASWYGPKFHGRRTASGTRFNMHDYVAAHRTLPLGTVLLVKNLKNGKTVKVKVLDRGPY 184

Query: 150 HSNRLIDLSNAAAKILRVEERGV 172
              R +DLS AAA+ L +   GV
Sbjct: 185 VRGRHLDLSRAAAERLGMFSDGV 207


>gi|317503949|ref|ZP_07961957.1| rare lipoprotein A [Prevotella salivae DSM 15606]
 gi|315664975|gb|EFV04634.1| rare lipoprotein A [Prevotella salivae DSM 15606]
          Length = 223

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 58/95 (61%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+Y K   G  TA+GE    + +T AH T P  + ++VTN  NG S+VV+V DRGP+
Sbjct: 36  GKASYYSKRATGARTASGERLHHDSLTCAHRTYPFGTLLKVTNPNNGNSVVVKVTDRGPF 95

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYLGMAL 184
              R+IDLS  AAK L +   GV+ V +E +G  +
Sbjct: 96  GHGRIIDLSYGAAKQLGILSNGVATVMIEKIGKGV 130


>gi|118590455|ref|ZP_01547857.1| rare lipoprotein A [Stappia aggregata IAM 12614]
 gi|118436918|gb|EAV43557.1| rare lipoprotein A [Stappia aggregata IAM 12614]
          Length = 138

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 57/96 (59%), Gaps = 3/96 (3%)

Query: 82  QYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVV 141
           Q   Y   G ASWY     G  TA+GE      +TAAH  LP  + V VTN+ NG ++ V
Sbjct: 30  QAGVYQQCGKASWYK---LGGTTASGERANPNQLTAAHRNLPFGTLVDVTNLANGKTVTV 86

Query: 142 RVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           R+NDRGP+   R+ID++ AAAK L    +G+++V +
Sbjct: 87  RINDRGPFAKGRVIDVTWAAAKELGFVRKGITRVQL 122


>gi|15606419|ref|NP_213799.1| rare lipoprotein A [Aquifex aeolicus VF5]
 gi|20139373|sp|O67235|RLPA_AQUAE RecName: Full=RlpA-like lipoprotein; Flags: Precursor
 gi|2983624|gb|AAC07192.1| rare lipoprotein A [Aquifex aeolicus VF5]
          Length = 226

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/117 (41%), Positives = 66/117 (56%), Gaps = 1/117 (0%)

Query: 56  KRVPRGGGRYFLGKPYQIMGRWYVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYI 115
           KR+ +  G+ FLGK Y +       ++   Y   G ASWYG  FHGR TA+G  +     
Sbjct: 99  KRLKKYLGKPFLGKVYLLRCGENGVKKCPKYIR-GYASWYGGKFHGRKTASGIRFNQHEY 157

Query: 116 TAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGV 172
            AAH  LP  + + V N++NG  ++V+V DRGPY   R +DLS AAAK L +   GV
Sbjct: 158 YAAHRYLPFGTLLEVKNLKNGRKVIVKVVDRGPYVRGRHLDLSYAAAKKLGMIRDGV 214


>gi|209544201|ref|YP_002276430.1| rare lipoprotein A [Gluconacetobacter diazotrophicus PAl 5]
 gi|209531878|gb|ACI51815.1| rare lipoprotein A [Gluconacetobacter diazotrophicus PAl 5]
          Length = 201

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 61/98 (62%)

Query: 78  YVPRQYTAYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGI 137
           +V R   +++  G+ASWYG     R T++G  +    +TAAHPTLP+ + V V + + G 
Sbjct: 64  HVGRSALSWSEQGVASWYGHLRRVRPTSSGRAFDPRALTAAHPTLPMGTRVLVRSEDTGR 123

Query: 138 SLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKV 175
           S+VV VNDRGP+  +R+IDLS AAA  L +   G + V
Sbjct: 124 SVVVTVNDRGPFLGSRIIDLSPAAAARLGMLNAGTAHV 161


>gi|23502983|ref|NP_699110.1| rare lipoprotein A family protein [Brucella suis 1330]
 gi|62290974|ref|YP_222767.1| rare lipoprotein A family protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82700884|ref|YP_415458.1| rare lipoprotein A [Brucella melitensis biovar Abortus 2308]
 gi|148559953|ref|YP_001259933.1| rare lipoprotein A family protein [Brucella ovis ATCC 25840]
 gi|161620045|ref|YP_001593932.1| rare lipoprotein A [Brucella canis ATCC 23365]
 gi|189025188|ref|YP_001935956.1| Rare lipoprotein A [Brucella abortus S19]
 gi|225626505|ref|ZP_03784544.1| rare lipoprotein A [Brucella ceti str. Cudo]
 gi|237816478|ref|ZP_04595471.1| rare lipoprotein A [Brucella abortus str. 2308 A]
 gi|254690270|ref|ZP_05153524.1| Rare lipoprotein A [Brucella abortus bv. 6 str. 870]
 gi|254694757|ref|ZP_05156585.1| Rare lipoprotein A [Brucella abortus bv. 3 str. Tulya]
 gi|254696385|ref|ZP_05158213.1| Rare lipoprotein A [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700767|ref|ZP_05162595.1| Rare lipoprotein A [Brucella suis bv. 5 str. 513]
 gi|254705137|ref|ZP_05166965.1| Rare lipoprotein A [Brucella suis bv. 3 str. 686]
 gi|254707346|ref|ZP_05169174.1| Rare lipoprotein A [Brucella pinnipedialis M163/99/10]
 gi|254709112|ref|ZP_05170923.1| Rare lipoprotein A [Brucella pinnipedialis B2/94]
 gi|254716182|ref|ZP_05177993.1| Rare lipoprotein A [Brucella ceti M13/05/1]
 gi|254731299|ref|ZP_05189877.1| Rare lipoprotein A [Brucella abortus bv. 4 str. 292]
 gi|256158640|ref|ZP_05456523.1| Rare lipoprotein A [Brucella ceti M490/95/1]
 gi|256258523|ref|ZP_05464059.1| Rare lipoprotein A [Brucella abortus bv. 9 str. C68]
 gi|256370531|ref|YP_003108042.1| rare lipoprotein A family protein [Brucella microti CCM 4915]
 gi|260169542|ref|ZP_05756353.1| rare lipoprotein A family protein [Brucella sp. F5/99]
 gi|260546239|ref|ZP_05821979.1| rare lipoprotein A [Brucella abortus NCTC 8038]
 gi|260567394|ref|ZP_05837864.1| rare lipoprotein A [Brucella suis bv. 4 str. 40]
 gi|260755808|ref|ZP_05868156.1| rare lipoprotein A [Brucella abortus bv. 6 str. 870]
 gi|260759031|ref|ZP_05871379.1| rare lipoprotein A [Brucella abortus bv. 4 str. 292]
 gi|260760756|ref|ZP_05873099.1| rare lipoprotein A [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884833|ref|ZP_05896447.1| rare lipoprotein A [Brucella abortus bv. 9 str. C68]
 gi|261215083|ref|ZP_05929364.1| rare lipoprotein A [Brucella abortus bv. 3 str. Tulya]
 gi|261217954|ref|ZP_05932235.1| rare lipoprotein A [Brucella ceti M13/05/1]
 gi|261221183|ref|ZP_05935464.1| rare lipoprotein A [Brucella ceti B1/94]
 gi|261314830|ref|ZP_05954027.1| rare lipoprotein A [Brucella pinnipedialis M163/99/10]
 gi|261316611|ref|ZP_05955808.1| rare lipoprotein A [Brucella pinnipedialis B2/94]
 gi|261321196|ref|ZP_05960393.1| rare lipoprotein A [Brucella ceti M644/93/1]
 gi|261751275|ref|ZP_05994984.1| rare lipoprotein A [Brucella suis bv. 5 str. 513]
 gi|261755840|ref|ZP_05999549.1| rare lipoprotein A [Brucella suis bv. 3 str. 686]
 gi|261759068|ref|ZP_06002777.1| rare lipoprotein A [Brucella sp. F5/99]
 gi|265987683|ref|ZP_06100240.1| rare lipoprotein A [Brucella pinnipedialis M292/94/1]
 gi|265997144|ref|ZP_06109701.1| rare lipoprotein A [Brucella ceti M490/95/1]
 gi|294851364|ref|ZP_06792037.1| lipoprotein A [Brucella sp. NVSL 07-0026]
 gi|297247361|ref|ZP_06931079.1| lipoprotein A [Brucella abortus bv. 5 str. B3196]
 gi|306843554|ref|ZP_07476155.1| rare lipoprotein A [Brucella sp. BO1]
 gi|23349021|gb|AAN31025.1| rare lipoprotein A family protein [Brucella suis 1330]
 gi|62197106|gb|AAX75406.1| rare lipoprotein A family protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82616985|emb|CAJ12094.1| Rare lipoprotein A [Brucella melitensis biovar Abortus 2308]
 gi|148371210|gb|ABQ61189.1| rare lipoprotein A family protein [Brucella ovis ATCC 25840]
 gi|161336856|gb|ABX63161.1| rare lipoprotein A [Brucella canis ATCC 23365]
 gi|189020760|gb|ACD73482.1| Rare lipoprotein A [Brucella abortus S19]
 gi|225618162|gb|EEH15205.1| rare lipoprotein A [Brucella ceti str. Cudo]
 gi|237788545|gb|EEP62760.1| rare lipoprotein A [Brucella abortus str. 2308 A]
 gi|256000694|gb|ACU49093.1| rare lipoprotein A family protein [Brucella microti CCM 4915]
 gi|260096346|gb|EEW80222.1| rare lipoprotein A [Brucella abortus NCTC 8038]
 gi|260156912|gb|EEW91992.1| rare lipoprotein A [Brucella suis bv. 4 str. 40]
 gi|260669349|gb|EEX56289.1| rare lipoprotein A [Brucella abortus bv. 4 str. 292]
 gi|260671188|gb|EEX58009.1| rare lipoprotein A [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675916|gb|EEX62737.1| rare lipoprotein A [Brucella abortus bv. 6 str. 870]
 gi|260874361|gb|EEX81430.1| rare lipoprotein A [Brucella abortus bv. 9 str. C68]
 gi|260916690|gb|EEX83551.1| rare lipoprotein A [Brucella abortus bv. 3 str. Tulya]
 gi|260919767|gb|EEX86420.1| rare lipoprotein A [Brucella ceti B1/94]
 gi|260923043|gb|EEX89611.1| rare lipoprotein A [Brucella ceti M13/05/1]
 gi|261293886|gb|EEX97382.1| rare lipoprotein A [Brucella ceti M644/93/1]
 gi|261295834|gb|EEX99330.1| rare lipoprotein A [Brucella pinnipedialis B2/94]
 gi|261303856|gb|EEY07353.1| rare lipoprotein A [Brucella pinnipedialis M163/99/10]
 gi|261739052|gb|EEY27048.1| rare lipoprotein A [Brucella sp. F5/99]
 gi|261741028|gb|EEY28954.1| rare lipoprotein A [Brucella suis bv. 5 str. 513]
 gi|261745593|gb|EEY33519.1| rare lipoprotein A [Brucella suis bv. 3 str. 686]
 gi|262551612|gb|EEZ07602.1| rare lipoprotein A [Brucella ceti M490/95/1]
 gi|264659880|gb|EEZ30141.1| rare lipoprotein A [Brucella pinnipedialis M292/94/1]
 gi|294819953|gb|EFG36952.1| lipoprotein A [Brucella sp. NVSL 07-0026]
 gi|297174530|gb|EFH33877.1| lipoprotein A [Brucella abortus bv. 5 str. B3196]
 gi|306276245|gb|EFM57945.1| rare lipoprotein A [Brucella sp. BO1]
          Length = 118

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 55/86 (63%), Gaps = 3/86 (3%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWY  A   R TA+GE      +TAAH TLPL S V+VTN +NG SLVVR+NDRGP+
Sbjct: 31  GGASWY--ALTSR-TASGERMNPAGLTAAHRTLPLGSKVKVTNQKNGKSLVVRINDRGPF 87

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKV 175
              R++DLS  AA  L     G +KV
Sbjct: 88  IKGRVLDLSKGAASRLGFIGAGHTKV 113


>gi|254713462|ref|ZP_05175273.1| Rare lipoprotein A [Brucella ceti M644/93/1]
 gi|256030638|ref|ZP_05444252.1| Rare lipoprotein A [Brucella pinnipedialis M292/94/1]
 gi|256254044|ref|ZP_05459580.1| Rare lipoprotein A [Brucella ceti B1/94]
          Length = 112

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 55/86 (63%), Gaps = 3/86 (3%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWY  A   R TA+GE      +TAAH TLPL S V+VTN +NG SLVVR+NDRGP+
Sbjct: 25  GGASWY--ALTSR-TASGERMNPAGLTAAHRTLPLGSKVKVTNQKNGKSLVVRINDRGPF 81

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKV 175
              R++DLS  AA  L     G +KV
Sbjct: 82  IKGRVLDLSKGAASRLGFIGAGHTKV 107


>gi|124005552|ref|ZP_01690392.1| RlpA protein [Microscilla marina ATCC 23134]
 gi|123988986|gb|EAY28579.1| RlpA protein [Microscilla marina ATCC 23134]
          Length = 165

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/91 (43%), Positives = 57/91 (62%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G AS+Y   FHGR TA+G+ Y    +TAAH TLP  + + V N++N   ++V +NDR P 
Sbjct: 73  GKASYYHDKFHGRRTASGQTYNKYALTAAHKTLPFNTKIEVRNLKNNRKVLVVINDRLPR 132

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
            S R IDLS AAA+ + +   GV +V ++ L
Sbjct: 133 TSTRSIDLSRAAAERIGMVRDGVVRVEMKVL 163


>gi|330837434|ref|YP_004412075.1| rare lipoprotein A [Spirochaeta coccoides DSM 17374]
 gi|329749337|gb|AEC02693.1| rare lipoprotein A [Spirochaeta coccoides DSM 17374]
          Length = 258

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/93 (40%), Positives = 54/93 (58%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVN 144
           +Y   G+ASWY       LTANGE++    + AAH  L   + V + NM+NG    VR+N
Sbjct: 67  SYEMKGIASWYTSDRTDSLTANGEIFDPTKMAAAHKELTFGTLVEIHNMDNGKRATVRIN 126

Query: 145 DRGPYHSNRLIDLSNAAAKILRVEERGVSKVHV 177
           DRGPY   R+IDL+  AA+   + E G++ V +
Sbjct: 127 DRGPYVDGRIIDLTPEAARATGMYESGIAPVEL 159


>gi|306842753|ref|ZP_07475395.1| rare lipoprotein A [Brucella sp. BO2]
 gi|306287097|gb|EFM58602.1| rare lipoprotein A [Brucella sp. BO2]
          Length = 110

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 55/86 (63%), Gaps = 3/86 (3%)

Query: 90  GMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYVRVTNMENGISLVVRVNDRGPY 149
           G ASWY  A   R TA+GE      +TAAH TLPL S V+VTN +NG SLVVR+NDRGP+
Sbjct: 23  GGASWY--ALTSR-TASGERMNPAGLTAAHRTLPLGSKVKVTNQKNGKSLVVRINDRGPF 79

Query: 150 HSNRLIDLSNAAAKILRVEERGVSKV 175
              R++DLS  AA  L     G +KV
Sbjct: 80