RPSBLAST alignment of GI: 254780935 and MMDB domain: 3d30_A_1-109

>3d30_A (A:1-109) YOAJ, expansin like protein; peptidoglycan associated protein, unknown function, MLTA, bacteria autolysis, peptidoglycan-binding protein; 1.90A {Bacillus subtilis} PDB: 2bh0_ALength = 109
 Score = 90.9 bits (225), Expect = 2e-19
 Identities = 18/103 (17%), Positives = 31/103 (30%), Gaps = 7/103 (6%)

Query: 85  AYAAVGMASWYGKAFHGRLTANGEVYGTEYITAAHPTLPLPSYV-------RVTNMENGI 137
                G A++ G  + G       +     ITA +P       V        +       
Sbjct: 4   DDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKG 63

Query: 138 SLVVRVNDRGPYHSNRLIDLSNAAAKILRVEERGVSKVHVEYL 180
              V V D  P  +   +DLS  A + +   + G   +    +
Sbjct: 64  KTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVV 106