RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780936|ref|YP_003065349.1| hypothetical protein CLIBASIA_04175 [Candidatus Liberibacter asiaticus str. psy62] (182 letters) >gnl|CDD|31621 COG1432, COG1432, Uncharacterized conserved protein [Function unknown]. Length = 181 Score = 125 bits (314), Expect = 1e-29 Identities = 72/185 (38%), Positives = 95/185 (51%), Gaps = 12/185 (6%) Query: 1 MFDPREKIALFIDGANLYASS-KALGFDIDYRKLLKAFRSRAIVIRAYYYTTVVGDPEQQ 59 ++IALFIDG NLYAS K LG IDYRKLL+ R + A YT GD E Q Sbjct: 1 TPIMVDRIALFIDGKNLYASQRKNLGILIDYRKLLRKELKRIYLYEAAPYTAEYGDIEIQ 60 Query: 60 FSPLHPLLDWLHYNGFQVVAKVAKEFTENCGRKRVKSSMDVELAVDAFEQS--EGLEHLV 117 + L +GF VV FT+ + K +DVELAVDA E + + ++ +V Sbjct: 61 --EVFLNEYELRSDGFTVVTSNLDGFTD---LRITKGDVDVELAVDAMELADKKNVDTIV 115 Query: 118 IFSGDGCFTTLVAALQRKVKKVTIVSTVLSDPSMASDQLRRQADYFMDLAYLKNEIARDP 177 +FSGDG F LV A + K K+V + M S LR ADY++DL L+ I Sbjct: 116 LFSGDGDFIPLVEAARDKGKRVEVAGIE----PMTSSDLRNAADYYIDLKSLEEAILLPE 171 Query: 178 DEDKK 182 E ++ Sbjct: 172 IEREE 176 >gnl|CDD|145225 pfam01936, DUF88, Protein of unknown function DUF88. This highly conserved bacterial protein has no known function. The alignment contains many conserved aspartates, suggesting an enzymatic function such as an endonuclease or glycosyl hydrolase (Bateman A pers. obs). Length = 140 Score = 105 bits (264), Expect = 7e-24 Identities = 51/162 (31%), Positives = 73/162 (45%), Gaps = 25/162 (15%) Query: 7 KIALFIDGANLYASSKALGFDIDYRKLLKAFRSRAIVIRAYYYTTVVGDPEQQFSPLHPL 66 ++A+FIDG N + IDYRK+L+ +S V+RA Y + L Sbjct: 1 RVAVFIDGENCPVPAG-----IDYRKVLEEIKSGGEVVRARAYG------DWSDPKLRKF 49 Query: 67 LDWLHYNGFQVVAKVAKEFTENCGRKRVKSSMDVELAVDAFEQSE--GLEHLVIFSGDGC 124 D L G V K K K+++DV LAVDA E + + V+ SGDG Sbjct: 50 PDALSSTGIPVQHKPLT--------KSGKNAVDVGLAVDALELAYDNNPDTFVLVSGDGD 101 Query: 125 FTTLVAALQRKVKKVTIVSTVLSDPSMASDQLRRQADYFMDL 166 F L+ L+ + K+V ++ SD L AD F+DL Sbjct: 102 FAPLLERLRERGKRVEVLGA----EPSTSDALINAADRFIDL 139 >gnl|CDD|100118 cd06167, LabA_like, LabA_like proteins. A well conserved group of bacterial proteins with no defined function. LabA, a member from Synechococcus elongatus PCC 7942, has been shown to play a role in cyanobacterial circadian timing. It is required for negative feedback regulation of the autokinase/autophosphatase KaiC, a central component of the circadian clock system. In particular, LabA seems necessary for KaiC-dependent repression of gene expression.. Length = 149 Score = 99.3 bits (248), Expect = 5e-22 Identities = 54/164 (32%), Positives = 80/164 (48%), Gaps = 18/164 (10%) Query: 6 EKIALFIDGANLYASSKALG-FDIDYRKLLKAFRSRAIVIRAYYYTTVVGDPEQQFSPLH 64 +++A+FIDG NLY S + LG DYRKLL+ R ++ A Y Q+ Sbjct: 1 KRVAVFIDGENLYYSLRDLGGKRFDYRKLLEFLRDGGEIVLARAYGNWTSPERQR----- 55 Query: 65 PLLDWLHYNGFQVVAKVAKEFTENCGRKRVKSSMDVELAVDAFEQS--EGLEHLVIFSGD 122 LD L GF+ + K + K +DV LA+DA E + ++ +V+ SGD Sbjct: 56 GFLDALRRLGFEPIQKPLRTR------GSGKKGVDVALAIDALELAYKRRIDTIVLVSGD 109 Query: 123 GCFTTLVAALQRKVKKVTIVSTVLSDPSMASDQLRRQADYFMDL 166 F LV L+ K+V +V + S +LR+ AD F+DL Sbjct: 110 SDFVPLVERLRELGKRVIVVGF----EAKTSRELRKAADRFIDL 149 >gnl|CDD|31400 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane]. Length = 460 Score = 26.7 bits (59), Expect = 3.5 Identities = 16/85 (18%), Positives = 30/85 (35%), Gaps = 24/85 (28%) Query: 90 GRKRVKSSMDVELAVDAFEQSEGL------------------EHLVIFSGDGCFTT---- 127 G ++V+ ++ V+ Q E L +++ GD T Sbjct: 55 GAEQVREALAERDDVEFVLQEEQLGTGHAVLQALPALADDYDGDVLVLYGDVPLITAETL 114 Query: 128 --LVAALQRKVKKVTIVSTVLSDPS 150 L+AA T+++ L DP+ Sbjct: 115 EELLAAHPAHGAAATVLTAELDDPT 139 >gnl|CDD|112056 pfam03225, Viral_Hsp90, Viral heat shock protein Hsp90 homologue. Length = 511 Score = 26.9 bits (60), Expect = 3.6 Identities = 6/28 (21%), Positives = 10/28 (35%) Query: 142 VSTVLSDPSMASDQLRRQADYFMDLAYL 169 V +L +P + + LR F Sbjct: 313 VVEILDEPVLVGEYLRYVESVFEVSNSN 340 >gnl|CDD|145242 pfam01960, ArgJ, ArgJ family. Members of the ArgJ family catalyse the first EC:2.3.1.1 and fifth steps EC:2.3.1.35 in arginine biosynthesis. Length = 387 Score = 25.9 bits (58), Expect = 7.0 Identities = 10/44 (22%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Query: 2 FDPREKIALFIDGANLYASSKALGFDIDYRKLLKAFRSRAIVIR 45 FDP +K+ + G + + + + FD + + I IR Sbjct: 317 FDP-DKVDISFGGVLVVENGEPVDFDEE--AASAILKEDEITIR 357 >gnl|CDD|132921 cd07038, TPP_PYR_PDC_IPDC_like, Pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC), indolepyruvate decarboxylase (IPDC) and related proteins. Thiamine pyrophosphate (TPP family), pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) subfamily. The PYR domain is found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor. TPP binds in the cleft formed by a PYR domain and a PP domain. The PYR domain, binds the aminopyrimidine ring of TPP, the PP domain binds the diphosphate residue. The PYR and PP domains have a common fold, but do not share strong sequence conservation. The PP domain is not included in this sub-family. Most TPP-dependent enzymes have the PYR and PP domains on the same subunit although these domains can be alternatively arranged in the primary structure. TPP-dependent enzymes are multisubunit proteins, the smallest catalytic unit being a dimer-of-active sites, for many the active sites lie between PP and PYR domains on different subunits. PDC catalyzes the conversion of pyruvate to acetaldehyde and CO2 in alcoholic fermentation. IPDC plays a role in the indole-3-pyruvic acid (IPA) pathway in plants and various plant-associated bacteria, it catalyzes the decarboxylation of IPA to IAA. Also belonging to this group is Mycobacterium tuberculosis alpha-keto acid decarboxylase (MtKDC) which participates in amino acid degradation via the Ehrlich pathway, and Lactococcus lactis branched-chain keto acid decarboxylase (KdcA) an enzyme identified as being involved in cheese ripening, which exhibits a very broad substrate range in the decarboxylation and carboligation reactions. Length = 162 Score = 25.9 bits (58), Expect = 7.4 Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 11/54 (20%) Query: 108 EQSEG--LEHLVIFSGDGCFTTLVAALQRKV-KKVTIVSTVLSDPSMASDQLRR 158 Q+ G L H + GDG F K+ +++T + L+DP A++++ R Sbjct: 99 AQASGLLLHHTL---GDGDFDV-----FLKMFEEITCAAARLTDPENAAEEIDR 144 >gnl|CDD|36582 KOG1368, KOG1368, KOG1368, Threonine aldolase [Amino acid transport and metabolism]. Length = 384 Score = 25.3 bits (55), Expect = 8.7 Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Query: 5 REKIALFIDGANLYASSKALGFDIDYRKLLKAFRSRAI 42 R + L +DGA ++ ++ A G + +K+ AF S +I Sbjct: 186 RHGLKLHMDGARIFNAAVASGVPV--KKICSAFDSVSI 221 >gnl|CDD|29437 cd00363, PFK, Phosphofructokinase, a key regulatory enzyme in glycolysis, catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-biphosphate. The members belong to PFK family that includes ATP- and pyrophosphate (PPi)- dependent phosphofructokinases. Some members evolved by gene duplication and thus have a large C-terminal/N-terminal extension comprising a second PFK domain. Generally, ATP-PFKs are allosteric homotetramers, and PPi-PFKs are dimeric and nonallosteric except for plant PPi-PFKs which are allosteric heterotetramers.. Length = 338 Score = 25.6 bits (56), Expect = 8.7 Identities = 14/59 (23%), Positives = 26/59 (44%), Gaps = 10/59 (16%) Query: 68 DWLHYNGFQVVAKVAKEFTENCGRKRVKSSMDVELAVDAFEQSEGLEHLVIFSGDGCFT 126 D ++ G + + KEF GR + ++ + G++ LV+ GDG +T Sbjct: 58 DIINRGGTIIGSARCKEFRTEEGRAKAAENL----------KKHGIDALVVIGGDGSYT 106 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.137 0.393 Gapped Lambda K H 0.267 0.0784 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,234,173 Number of extensions: 110721 Number of successful extensions: 311 Number of sequences better than 10.0: 1 Number of HSP's gapped: 296 Number of HSP's successfully gapped: 20 Length of query: 182 Length of database: 6,263,737 Length adjustment: 88 Effective length of query: 94 Effective length of database: 4,362,145 Effective search space: 410041630 Effective search space used: 410041630 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 54 (24.5 bits)