RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780936|ref|YP_003065349.1| hypothetical protein CLIBASIA_04175 [Candidatus Liberibacter asiaticus str. psy62] (182 letters) >gnl|CDD|183019 PRK11179, PRK11179, DNA-binding transcriptional regulator AsnC; Provisional. Length = 153 Score = 29.3 bits (66), Expect = 0.54 Identities = 17/56 (30%), Positives = 22/56 (39%), Gaps = 12/56 (21%) Query: 7 KIALFIDGANLYASSKALGFDI------------DYRKLLKAFRSRAIVIRAYYYT 50 K A I G + + K LG+D+ DY L S V+ AYY T Sbjct: 48 KQAGIITGTRVDVNPKQLGYDVCCFIGIILKSAKDYPSALAKLESLDEVVEAYYTT 103 >gnl|CDD|150554 pfam09894, DUF2121, Uncharacterized protein conserved in archaea (DUF2121). This domain, found in various hypothetical archaeal proteins, has no known function. Length = 194 Score = 29.2 bits (66), Expect = 0.57 Identities = 10/29 (34%), Positives = 13/29 (44%) Query: 80 KVAKEFTENCGRKRVKSSMDVELAVDAFE 108 K KE E +K K M ++ D FE Sbjct: 127 KYTKEIAEKELKKNWKKKMSLKDIRDIFE 155 >gnl|CDD|178323 PLN02721, PLN02721, threonine aldolase. Length = 353 Score = 26.6 bits (59), Expect = 3.9 Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Query: 8 IALFIDGANLYASSKALGFDIDYRKLLKAFRSRAI 42 + L IDGA ++ +S ALG + +L+KA S ++ Sbjct: 172 LKLHIDGARIFNASVALGVPVH--RLVKAADSVSV 204 >gnl|CDD|115693 pfam07056, DUF1335, Protein of unknown function (DUF1335). This family represents a conserved region approximately 130 residues long within a number of proteins of unknown function that seem to be specific to the white spot syndrome virus (WSSV). Length = 131 Score = 25.9 bits (57), Expect = 5.6 Identities = 14/67 (20%), Positives = 25/67 (37%), Gaps = 11/67 (16%) Query: 24 LGFDI-DYRKLLKAFRSRAIVIRAYYYTTVVGDPEQQFSPLHPLLDWLHYNGFQVVAKVA 82 LGF + + K LK+ + Y+ V P+ + Y G +V + Sbjct: 38 LGFSLRNVTKKLKSM-EGNLRKHGGKYSMV---------PVVDICHRKFYKGLIIVNPIV 87 Query: 83 KEFTENC 89 F+ +C Sbjct: 88 GSFSSHC 94 >gnl|CDD|129043 smart00807, AKAP_110, A-kinase anchor protein 110 kDa. This family consists of several mammalian protein kinase A anchoring protein 3 (PRKA3) or A-kinase anchor protein 110 kDa (AKAP 110) sequences. Agents that increase intracellular cAMP are potent stimulators of sperm motility. Anchoring inhibitor peptides, designed to disrupt the interaction of the cAMP-dependent protein kinase A (PKA) with A kinase-anchoring proteins (AKAPs), are potent inhibitors of sperm motility. PKA anchoring is a key biochemical mechanism controlling motility. AKAP110 shares compartments with both RI and RII isoforms of PKA and may function as a regulator of both motility- and head-associated functions such as capacitation and the acrosome reaction PUBMED:10319321. Length = 851 Score = 26.1 bits (57), Expect = 5.8 Identities = 20/74 (27%), Positives = 31/74 (41%), Gaps = 3/74 (4%) Query: 82 AKEFTEN--CGRKRVKSSMDVELAVDAFEQSEGLEHLVIFSGDGCFT-TLVAALQRKVKK 138 A E EN C R R S+ + + +GL + SGDG +V L V K Sbjct: 618 APEQEENKLCERPRASSAAKLSERDETGGALQGLTKMDANSGDGQMNGQMVDHLMESVMK 677 Query: 139 VTIVSTVLSDPSMA 152 + ++ D ++A Sbjct: 678 LCLIIAKSCDAALA 691 >gnl|CDD|179321 PRK01688, PRK01688, histidinol-phosphate aminotransferase; Provisional. Length = 351 Score = 26.1 bits (58), Expect = 6.0 Identities = 15/44 (34%), Positives = 19/44 (43%), Gaps = 12/44 (27%) Query: 29 DYRKLLKAFRSRAIVI--RAYYYTTVVGDPEQQFSPLHPLLDWL 70 D R LL+ R +AIV+ AY +F P L WL Sbjct: 166 DLRTLLELTRGKAIVVADEAYI----------EFCPQASLAGWL 199 >gnl|CDD|180396 PRK06092, PRK06092, 4-amino-4-deoxychorismate lyase; Reviewed. Length = 268 Score = 25.6 bits (57), Expect = 8.5 Identities = 7/8 (87%), Positives = 7/8 (87%) Query: 121 GDGCFTTL 128 GDGCFTT Sbjct: 22 GDGCFTTA 29 >gnl|CDD|132501 TIGR03461, pabC_Proteo, aminodeoxychorismate lyase. Members of this protein family are aminodeoxychorismate lyase (ADC lyase), EC 4.1.3.38, the PabC protein of PABA biosynthesis. PABA (para-aminobenzoate) is a precursor of folate, needed for de novo purine biosynthesis. This enzyme is a pyridoxal-phosphate-binding protein in the class IV aminotransferase family (pfam01063). Length = 261 Score = 25.2 bits (56), Expect = 8.9 Identities = 13/45 (28%), Positives = 20/45 (44%), Gaps = 6/45 (13%) Query: 121 GDGCFTTL------VAALQRKVKKVTIVSTVLSDPSMASDQLRRQ 159 GDGCFTT + L ++++ + L P D LR + Sbjct: 20 GDGCFTTAKVRNGKIELLDLHLERLQDAAARLGIPLPDWDALREE 64 >gnl|CDD|131764 TIGR02717, AcCoA-syn-alpha, acetyl coenzyme A synthetase (ADP forming), alpha domain. Although technically reversible, it is believed that this group of ADP-dependent acetyl-CoA synthetases (ACS) act in the direction of acetate and ATP production in the organisms in which it has been characterized. In most species this protein exists as a fused alpha-beta domain polypeptide. In Pyrococcus and related species, however the domains exist as separate polypeptides. This model represents the alpha (N-terminal) domain. In Pyrococcus and related species there appears to have been the development of a paralogous family such that four other proteins are close relatives. In reference, one of these (along with its beta-domain partner) was characterized as ACS-II showing specificity for phenylacetyl-CoA. This model has been constructed to exclude these non-ACS-I paralogs. This may result in new, authentic ACS-I sequences falling below the trusted cutoff. Length = 447 Score = 25.3 bits (56), Expect = 9.3 Identities = 9/20 (45%), Positives = 10/20 (50%) Query: 77 VVAKVAKEFTENCGRKRVKS 96 V AK + E CG K VK Sbjct: 72 VPAKYVPQVVEECGEKGVKG 91 >gnl|CDD|148394 pfam06762, DUF1222, Protein of unknown function (DUF1222). This family, which includes bacterial and eukaryotic members, represents a conserved region located towards the C-terminal end of a number of hypothetical proteins of unknown function. These are possibly integral membrane proteins. Length = 371 Score = 25.3 bits (56), Expect = 9.8 Identities = 9/22 (40%), Positives = 12/22 (54%), Gaps = 3/22 (13%) Query: 54 GDPEQ---QFSPLHPLLDWLHY 72 GD + Q +P HP LDW + Sbjct: 267 GDVSRIPRQIAPYHPRLDWQMW 288 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.322 0.137 0.393 Gapped Lambda K H 0.267 0.0786 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,075,871 Number of extensions: 187595 Number of successful extensions: 364 Number of sequences better than 10.0: 1 Number of HSP's gapped: 363 Number of HSP's successfully gapped: 18 Length of query: 182 Length of database: 5,994,473 Length adjustment: 87 Effective length of query: 95 Effective length of database: 4,114,577 Effective search space: 390884815 Effective search space used: 390884815 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 54 (24.5 bits)