BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780937|ref|YP_003065350.1| DNA-directed RNA polymerase subunit omega [Candidatus Liberibacter asiaticus str. psy62] (122 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780937|ref|YP_003065350.1| DNA-directed RNA polymerase subunit omega [Candidatus Liberibacter asiaticus str. psy62] Length = 122 Score = 250 bits (638), Expect = 7e-69, Method: Compositional matrix adjust. Identities = 122/122 (100%), Positives = 122/122 (100%) Query: 1 MARTTVEDCIDKVDNRFLLVLLASHRTRHLSQGAKPTVDVGKDKNTVVALREIASGTLSP 60 MARTTVEDCIDKVDNRFLLVLLASHRTRHLSQGAKPTVDVGKDKNTVVALREIASGTLSP Sbjct: 1 MARTTVEDCIDKVDNRFLLVLLASHRTRHLSQGAKPTVDVGKDKNTVVALREIASGTLSP 60 Query: 61 DDLEEDFIHSLQKHVEIDEPDSPTENSDFSWHKPEALSFGQMSEGDLLEGINNIVTPDKR 120 DDLEEDFIHSLQKHVEIDEPDSPTENSDFSWHKPEALSFGQMSEGDLLEGINNIVTPDKR Sbjct: 61 DDLEEDFIHSLQKHVEIDEPDSPTENSDFSWHKPEALSFGQMSEGDLLEGINNIVTPDKR 120 Query: 121 DD 122 DD Sbjct: 121 DD 122 >gi|254780456|ref|YP_003064869.1| 30S ribosomal protein S1 [Candidatus Liberibacter asiaticus str. psy62] Length = 576 Score = 21.9 bits (45), Expect = 3.2, Method: Compositional matrix adjust. Identities = 6/25 (24%), Positives = 15/25 (60%) Query: 87 SDFSWHKPEALSFGQMSEGDLLEGI 111 SD W++P + ++GD+++ + Sbjct: 400 SDLDWNRPGEKVIAEYAKGDIVKAV 424 >gi|254780711|ref|YP_003065124.1| signal recognition particle protein [Candidatus Liberibacter asiaticus str. psy62] Length = 461 Score = 21.9 bits (45), Expect = 3.8, Method: Compositional matrix adjust. Identities = 16/61 (26%), Positives = 26/61 (42%), Gaps = 15/61 (24%) Query: 11 DKVDNRFL----LVLLASHRTRHLSQGAKPTVDVGKDKNTVVALREIASGTLSPDDLEED 66 D++ NR L +V L R+L+ +K + ++IA G +DL E Sbjct: 288 DRIANRILGMGDVVSLVEKAARNLN-----------EKQAALTAKKIAKGKFDLEDLAEQ 336 Query: 67 F 67 F Sbjct: 337 F 337 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.313 0.132 0.380 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,318 Number of Sequences: 1233 Number of extensions: 3207 Number of successful extensions: 4 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 122 length of database: 328,796 effective HSP length: 64 effective length of query: 58 effective length of database: 249,884 effective search space: 14493272 effective search space used: 14493272 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 33 (17.3 bits)