RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780938|ref|YP_003065351.1| 4'-phosphopantetheinyl transferase [Candidatus Liberibacter asiaticus str. psy62] (132 letters) >gnl|CDD|31079 COG0736, AcpS, Phosphopantetheinyl transferase (holo-ACP synthase) [Lipid metabolism]. Length = 127 Score = 140 bits (354), Expect = 1e-34 Identities = 59/130 (45%), Positives = 79/130 (60%), Gaps = 4/130 (3%) Query: 1 MIIGIGSDIVSIQRISRLLQSFNRKFESRCFSSLEQDVCDLSCNRVASYAKRFAAKEAFS 60 MIIGIG DIV I+RI + L+ F +F R + E + + +R A RFAAKEA S Sbjct: 1 MIIGIGIDIVEIERIEKALERFGERFAERILTEEELEYYEKLKSRAEFLAGRFAAKEAVS 60 Query: 61 KAIGTGISKGVSWKDIEVCHFPGGKPYISISGRASDVLSSLVPKGYKPVVHLTISDDFPF 120 KA+GTGI KGVS+KDIE+ + GKP + +SG A+ L L +HL+IS D + Sbjct: 61 KALGTGIGKGVSFKDIEILNDELGKPTVRLSGEAAKALEKLGVA----NIHLSISHDRDY 116 Query: 121 AQAFVVIESL 130 A A V++E L Sbjct: 117 AIAVVILEKL 126 >gnl|CDD|145012 pfam01648, ACPS, 4'-phosphopantetheinyl transferase superfamily. Members of this family transfers the 4'-phosphopantetheine (4'-PP) moiety from coenzyme A (CoA) to the invariant serine of pfam00550. This post-translational modification renders holo-ACP capable of acyl group activation via thioesterification of the cysteamine thiol of 4'-PP. This superfamily consists of two subtypes: The ACPS type and the Sfp type. The structure of the Sfp type is known, which shows the active site accommodates a magnesium ion. The most highly conserved regions of the alignment are involved in binding the magnesium ion. Length = 58 Score = 44.1 bits (105), Expect = 1e-05 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 9/65 (13%) Query: 3 IGIGSDIVSIQRISRLLQSFNRKFESRCFSSLEQDVCD--LSCNRVASYAKRFAAKEAFS 60 +GI DI I+RI K R F+ E + ++ ++A+ + AKEA Sbjct: 1 VGI--DIEKIRRIR-----DGEKLAERIFTPEELALLAALPEPDQARAFARLWTAKEAVL 53 Query: 61 KAIGT 65 KA+G Sbjct: 54 KALGL 58 >gnl|CDD|32274 COG2091, Sfp, Phosphopantetheinyl transferase [Coenzyme metabolism]. Length = 223 Score = 34.6 bits (79), Expect = 0.010 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 7/71 (9%) Query: 3 IGIGSDIVSIQRISR-LLQSFNRKFESRCFSSLEQDVCDLSCNRVASYAKRFAAKEAFSK 61 IG+ + + + R L F FE + L++D ++ + + KEA K Sbjct: 105 IGVDIEKIRPRAGWRSLAARFFHPFEPNELAWLDKD------QDNEAFYRLWTLKEAVLK 158 Query: 62 AIGTGISKGVS 72 A G G++ G+S Sbjct: 159 ATGKGLADGLS 169 >gnl|CDD|36163 KOG0945, KOG0945, KOG0945, Alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase [Amino acid transport and metabolism, Coenzyme transport and metabolism]. Length = 289 Score = 30.8 bits (69), Expect = 0.11 Identities = 17/77 (22%), Positives = 31/77 (40%), Gaps = 5/77 (6%) Query: 5 IGSDIVSIQR---ISRLLQSFNRKFESRCFSSLEQDVCDLSCNRVASYAKRFAAKEAFSK 61 +G DI+ + L+ F R F + L+ + + + + + KEA K Sbjct: 128 VGIDIMRPKERKTAHEELELFKRVFSEDEWKMLKSAPDEEV--QRTMFYRLWTLKEAILK 185 Query: 62 AIGTGISKGVSWKDIEV 78 A G G++ +S D Sbjct: 186 ATGVGLNTDLSLLDFSA 202 >gnl|CDD|33713 COG3931, COG3931, Predicted N-formylglutamate amidohydrolase [Amino acid transport and metabolism]. Length = 263 Score = 29.5 bits (66), Expect = 0.30 Identities = 13/61 (21%), Positives = 26/61 (42%) Query: 12 IQRISRLLQSFNRKFESRCFSSLEQDVCDLSCNRVASYAKRFAAKEAFSKAIGTGISKGV 71 +QR SRLL NR ++ + + N S +R A + F + +++ + Sbjct: 76 LQRFSRLLIDCNRPEDAPDLIPQLSEGTVVPGNHPLSEEERRARIDRFYRPFHEAVTRII 135 Query: 72 S 72 + Sbjct: 136 A 136 >gnl|CDD|145467 pfam02331, P35, Apoptosis preventing protein. This viral protein functions to block the host apoptotic response caused by infection by the virus. The apoptosis preventing protein (or early 35kD protein, P35) acts by blocking caspase protease activity. Length = 300 Score = 27.1 bits (60), Expect = 1.4 Identities = 12/53 (22%), Positives = 23/53 (43%) Query: 1 MIIGIGSDIVSIQRISRLLQSFNRKFESRCFSSLEQDVCDLSCNRVASYAKRF 53 M I IVS+ R++ L+ + F LE++ + ++ + K F Sbjct: 45 MAFNISGPIVSVTRVNNNLRDMIKSKIDEQFDQLERNYHNKRSTQMDGFHKYF 97 >gnl|CDD|133094 cd06236, M14_AGBL5_like, Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-5, and related proteins. The Peptidase M14 family of metallocarboxypeptidases are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. This eukaryotic subgroup includes the human AGBL5 and the mouse cytosolic carboxypeptidase (CCP)-5. ATP/GTP binding protein (AGTPBP-1/Nna1)-like proteins are active metallopeptidases that are thought to act on cytosolic proteins such as alpha-tubulin, to remove a C-terminal tyrosine. Mutations in AGTPBP-1/Nna1 cause Purkinje cell degeneration (pcd). AGTPBP-1/Nna1 however does not belong to this subgroup. AGTPBP-1/Nna1-like proteins from the different phyla are highly diverse, but they all contain a unique N-terminal conserved domain right before the CP domain. It has been suggested that this N-terminal domain might act as a folding domain. Length = 304 Score = 25.8 bits (57), Expect = 4.1 Identities = 8/15 (53%), Positives = 9/15 (60%) Query: 79 CHFPGGKPYISISGR 93 HF GKP + IS R Sbjct: 61 PHFFFGKPVVFISSR 75 >gnl|CDD|31147 COG0804, UreC, Urea amidohydrolase (urease) alpha subunit [Amino acid transport and metabolism]. Length = 568 Score = 25.2 bits (55), Expect = 6.3 Identities = 28/100 (28%), Positives = 43/100 (43%), Gaps = 18/100 (18%) Query: 5 IGSDIVSIQR----ISRLLQSFNRKFESRCFSSLEQDVCDLSCNRVASYAKRFAAKEAFS 60 I SD ++ R I+R Q+ ++ + R +L +D RV KR+ AK + Sbjct: 358 ISSDSQAMGRVGEVITRTWQTADKMKKQR--GALPEDAGGNDNFRV----KRYIAKYTIN 411 Query: 61 KAIGTGISKGV------SWKDIEVCH--FPGGKPYISISG 92 AI GIS V D+ + F G KP + + G Sbjct: 412 PAITHGISHEVGSVEVGKLADLVLWDPAFFGVKPELVLKG 451 >gnl|CDD|32260 COG2077, Tpx, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones]. Length = 158 Score = 24.8 bits (54), Expect = 6.9 Identities = 9/20 (45%), Positives = 9/20 (45%) Query: 104 KGYKPVVHLTISDDFPFAQA 123 V L IS D PFAQ Sbjct: 72 AKLGNTVVLCISMDLPFAQK 91 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.138 0.404 Gapped Lambda K H 0.267 0.0726 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,558,567 Number of extensions: 72623 Number of successful extensions: 156 Number of sequences better than 10.0: 1 Number of HSP's gapped: 154 Number of HSP's successfully gapped: 12 Length of query: 132 Length of database: 6,263,737 Length adjustment: 83 Effective length of query: 49 Effective length of database: 4,470,190 Effective search space: 219039310 Effective search space used: 219039310 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 52 (23.8 bits)