BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780939|ref|YP_003065352.1| type I signal peptidase [Candidatus Liberibacter asiaticus str. psy62] (248 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780939|ref|YP_003065352.1| type I signal peptidase [Candidatus Liberibacter asiaticus str. psy62] Length = 248 Score = 503 bits (1294), Expect = e-144, Method: Compositional matrix adjust. Identities = 248/248 (100%), Positives = 248/248 (100%) Query: 1 MWIAKKWTCSIFGSDTLKSILQALFFAILIRTFLFQPSVIPSGSMIPTLLVGDYIIVNKF 60 MWIAKKWTCSIFGSDTLKSILQALFFAILIRTFLFQPSVIPSGSMIPTLLVGDYIIVNKF Sbjct: 1 MWIAKKWTCSIFGSDTLKSILQALFFAILIRTFLFQPSVIPSGSMIPTLLVGDYIIVNKF 60 Query: 61 SYGYSKYSFPFSYNLFNGRIFNNQPRRGDVVVFRYPKDPSIDYVKRVIGLPGDRISLEKG 120 SYGYSKYSFPFSYNLFNGRIFNNQPRRGDVVVFRYPKDPSIDYVKRVIGLPGDRISLEKG Sbjct: 61 SYGYSKYSFPFSYNLFNGRIFNNQPRRGDVVVFRYPKDPSIDYVKRVIGLPGDRISLEKG 120 Query: 121 IIYINGAPVVRHMEGYFSYHYKEDWSSNVPIFQEKLSNGVLYNVLSQDFLAPSSNISEFL 180 IIYINGAPVVRHMEGYFSYHYKEDWSSNVPIFQEKLSNGVLYNVLSQDFLAPSSNISEFL Sbjct: 121 IIYINGAPVVRHMEGYFSYHYKEDWSSNVPIFQEKLSNGVLYNVLSQDFLAPSSNISEFL 180 Query: 181 VPKGHYFMMGDNRDKSKDSRWVEVGFVPEENLVGRASFVLFSIGGDTPFSKVWLWIPNMR 240 VPKGHYFMMGDNRDKSKDSRWVEVGFVPEENLVGRASFVLFSIGGDTPFSKVWLWIPNMR Sbjct: 181 VPKGHYFMMGDNRDKSKDSRWVEVGFVPEENLVGRASFVLFSIGGDTPFSKVWLWIPNMR 240 Query: 241 WDRLFKIL 248 WDRLFKIL Sbjct: 241 WDRLFKIL 248 >gi|254781178|ref|YP_003065591.1| cell division protein [Candidatus Liberibacter asiaticus str. psy62] Length = 304 Score = 28.5 bits (62), Expect = 0.12, Method: Compositional matrix adjust. Identities = 13/28 (46%), Positives = 16/28 (57%) Query: 215 RASFVLFSIGGDTPFSKVWLWIPNMRWD 242 R+ VL +I G T F K + WI RWD Sbjct: 202 RSFEVLSNIAGITKFVKAYNWIAERRWD 229 >gi|254780689|ref|YP_003065102.1| flagellar motor switch protein G [Candidatus Liberibacter asiaticus str. psy62] Length = 345 Score = 25.4 bits (54), Expect = 0.97, Method: Compositional matrix adjust. Identities = 10/27 (37%), Positives = 14/27 (51%) Query: 85 PRRGDVVVFRYPKDPSIDYVKRVIGLP 111 P G V+ R+P D +KR + LP Sbjct: 157 PSIGASVLLRFPNKIHADIMKRTVNLP 183 >gi|254781174|ref|YP_003065587.1| outer membrane assembly lipoprotein YfiO [Candidatus Liberibacter asiaticus str. psy62] Length = 271 Score = 22.7 bits (47), Expect = 5.6, Method: Compositional matrix adjust. Identities = 7/23 (30%), Positives = 16/23 (69%) Query: 88 GDVVVFRYPKDPSIDYVKRVIGL 110 G+ + +YP+ ++DYV ++G+ Sbjct: 117 GEEYITQYPESKNVDYVYYLVGM 139 >gi|254780263|ref|YP_003064676.1| translation elongation factor Tu [Candidatus Liberibacter asiaticus str. psy62] Length = 392 Score = 22.7 bits (47), Expect = 6.7, Method: Compositional matrix adjust. Identities = 8/14 (57%), Positives = 11/14 (78%) Query: 110 LPGDRISLEKGIIY 123 +PGDR+ LE +IY Sbjct: 350 MPGDRVDLEVELIY 363 >gi|254780150|ref|YP_003064563.1| translation elongation factor Tu [Candidatus Liberibacter asiaticus str. psy62] Length = 392 Score = 22.7 bits (47), Expect = 6.7, Method: Compositional matrix adjust. Identities = 8/14 (57%), Positives = 11/14 (78%) Query: 110 LPGDRISLEKGIIY 123 +PGDR+ LE +IY Sbjct: 350 MPGDRVDLEVELIY 363 >gi|254781208|ref|YP_003065621.1| hypothetical protein CLIBASIA_05575 [Candidatus Liberibacter asiaticus str. psy62] Length = 578 Score = 22.3 bits (46), Expect = 8.7, Method: Compositional matrix adjust. Identities = 12/37 (32%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Query: 186 YFMMGDNRDKSKDSRWVEVGFVPEENLVGRASFVLFS 222 Y++ GD +D SKD R + V P+ + +A + S Sbjct: 286 YYVWGDIKDVSKDGRSISV--APQSQTLFQAGVSVVS 320 >gi|255764510|ref|YP_003065448.2| uroporphyrinogen-III synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 232 Score = 22.3 bits (46), Expect = 9.2, Method: Compositional matrix adjust. Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Query: 97 KDPSIDYVKRVIGLPGDRISLEKGIIYINGAPVVRHMEGYFSYH 140 KD SI+ K +I + +K +IY+ G P H E Y H Sbjct: 96 KDNSINLAK-IIVEQKVLFTPQKPLIYLGGKPRNFHFEDYLIEH 138 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.325 0.143 0.454 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 182,274 Number of Sequences: 1233 Number of extensions: 8159 Number of successful extensions: 29 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 21 Number of HSP's gapped (non-prelim): 8 length of query: 248 length of database: 328,796 effective HSP length: 72 effective length of query: 176 effective length of database: 240,020 effective search space: 42243520 effective search space used: 42243520 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 37 (18.9 bits)