HHsearch alignment for GI: 254780940 and conserved domain: KOG3732

>KOG3732 consensus.
Probab=99.33  E-value=4e-12  Score=94.57  Aligned_cols=73  Identities=29%  Similarity=0.330  Sum_probs=68.1

Q ss_pred             CCCCCCHHHHHHHHHHCCCCCCCCCCEECCCCCCCCCEEEEEEEECCEEEEEEEECCHHHHHHHHHHHHHHHCC
Q ss_conf             00134525889875320223333431010207788845999999999899999968989999999999999748
Q gi|254780940|r  151 GKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG  224 (227)
Q Consensus       151 ~~~~~dpK~~Lqe~~q~~~~~~P~Y~~~~~~g~~~~~~f~v~v~v~g~~~g~g~g~SkK~Ae~~AA~~AL~klg  224 (227)
T Consensus       138 ~~~~~NPI~~L~e~~q~k~~k~P~yelv~E~G~~~~rEFv~q~sv~~~~-~~GkG~sKKiAKRnAAeamLe~l~  210 (339)
T KOG3732         138 YGQVLNPIGRLQELAQAKKWKLPEYELVQESGVPHRREFVIQCSVENFT-EEGKGPSKKIAKRNAAEAMLESLG  210 (339)
T ss_pred             CCCCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCEEEEEEEECCEE-EECCCCHHHHHHHHHHHHHHHHHC
T ss_conf             0125586999999999837899955887325777664489998750302-246785088999999999999836