HHsearch results for GI: 254780940 and protein with PDBid: 2b7t_A

>2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A
Probab=99.29  E-value=5.1e-12  Score=92.59  Aligned_cols=67  Identities=25%  Similarity=0.312  Sum_probs=57.1

Q ss_pred             CCHHHHHHHHHHCCCCCCCCCCEECCCCCCCCCEEEEEEEECCEEEEEEEECCHHHHHHHHHHHHHHHCC
Q ss_conf             4525889875320223333431010207788845999999999899999968989999999999999748
Q gi|254780940|r  155 RDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG  224 (227)
Q Consensus       155 ~dpK~~Lqe~~q~~~~~~P~Y~~~~~~g~~~~~~f~v~v~v~g~~~g~g~g~SkK~Ae~~AA~~AL~klg  224 (227)
                      .+||+.|+++.+.  ...|+|++++++||+|++.|+|.|.|+|..+ +|.|+|||+||+.||+.||+.|.
T Consensus         4 ~~PK~~l~~L~e~--~~~~~y~~~~~~G~~h~~~F~~~v~v~g~~~-~g~G~SKK~Ae~~AA~~aL~~l~   70 (73)
T 2b7t_A            4 VLPKNALMQLNEI--KPGLQYMLLSQTGPVHAPLFVMSVEVNGQVF-EGSGPTKKKAKLHAAEKALRSFV   70 (73)
T ss_dssp             SSSHHHHHHHHHH--CSCCEEEEEEEECSSSSCEEEEEEESSSSEE-EEEESSHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHC--CCCCEEEEEEEECCCCCCEEEEEEEECCEEE-ECCCCCHHHHHHHHHHHHHHHHH
T ss_conf             7972899999873--8998799987388998977999999999988-86999899999999999999997