BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780940|ref|YP_003065353.1| ribonuclease III [Candidatus
Liberibacter asiaticus str. psy62]
         (227 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780940|ref|YP_003065353.1| ribonuclease III [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040617|gb|ACT57413.1| ribonuclease III [Candidatus Liberibacter asiaticus str. psy62]
          Length = 227

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 227/227 (100%), Positives = 227/227 (100%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF
Sbjct: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE
Sbjct: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR
Sbjct: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIWT 227
           SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIWT
Sbjct: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIWT 227


>gi|315122353|ref|YP_004062842.1| ribonuclease III [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495755|gb|ADR52354.1| ribonuclease III [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 232

 Score =  362 bits (928), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 169/225 (75%), Positives = 200/225 (88%)

Query: 3   ALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNH 62
           +L+ S LE+RIGY F+N+ LL+KALTHSSI HS QE+YERLEFLGDR+LG+LIS LLF++
Sbjct: 8   SLKLSALERRIGYTFSNKYLLKKALTHSSICHSPQENYERLEFLGDRVLGILISKLLFDY 67

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           FDSAKEGELS+RFNSLVSAETCSQVA+EL+L SFI VSSDLR +VC F+  IQADVVESL
Sbjct: 68  FDSAKEGELSIRFNSLVSAETCSQVAKELELDSFIYVSSDLRMEVCKFVKGIQADVVESL 127

Query: 123 IAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           IAALYLDGGIE A +FV KYWK+R LK+G+FRRDAKTELQEWAHAKF VTP YK+  RSG
Sbjct: 128 IAALYLDGGIESASSFVTKYWKKRVLKNGEFRRDAKTELQEWAHAKFRVTPTYKIMLRSG 187

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIWT 227
           PDHDPRFTV+V++ GL   +G+DCSKR+AEQ+AAAE+L+REGIW+
Sbjct: 188 PDHDPRFTVMVDVLGLYSGKGIDCSKRSAEQMAAAEILRREGIWS 232


>gi|222085390|ref|YP_002543920.1| ribonuclease III [Agrobacterium radiobacter K84]
 gi|254807233|sp|B9JC73|RNC_AGRRK RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|221722838|gb|ACM25994.1| ribonuclease III [Agrobacterium radiobacter K84]
          Length = 239

 Score =  278 bits (711), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 137/219 (62%), Positives = 166/219 (75%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAK 67
           TLE  IG+AF  +  L+ ALTH+S       +YERLEFLGDR+LGL I+ LLF  F +A 
Sbjct: 14  TLEAAIGHAFVEKERLDWALTHASARTHKAGNYERLEFLGDRVLGLCIAELLFRTFGTAT 73

Query: 68  EGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALY 127
           EGELSVR N LVSAETC+ VA E+ L  FIR  +D++K     M +++ADVVESLIAALY
Sbjct: 74  EGELSVRLNQLVSAETCAAVADEMQLHLFIRTGADVKKLTGKRMLNVRADVVESLIAALY 133

Query: 128 LDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDP 187
           LDGG+EVA  F+ +YW+ RA++    RRDAKTELQEWAHAKFGVTP Y+V  RSGPDHDP
Sbjct: 134 LDGGLEVARKFILRYWEGRAVRPDGARRDAKTELQEWAHAKFGVTPVYRVDDRSGPDHDP 193

Query: 188 RFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           RFTV VE++G AP  G++ SKRAAEQVAA  +L+REGIW
Sbjct: 194 RFTVTVEVAGAAPETGIERSKRAAEQVAATRILEREGIW 232


>gi|209548601|ref|YP_002280518.1| ribonuclease III [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|226741375|sp|B5ZW73|RNC_RHILW RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|209534357|gb|ACI54292.1| Ribonuclease III [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 239

 Score =  275 bits (703), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 133/226 (58%), Positives = 172/226 (76%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           +SA   + LE  IG+ FA +  L++ALTH+S       +YERLEFLGDR+LGL I+ LLF
Sbjct: 7   LSAADRAKLEGLIGHDFAEKERLDRALTHASARTEKGGNYERLEFLGDRVLGLCIAELLF 66

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F +A EGELSVR N LVSAETC+ VA EL+L  +IR  +D++K     M +++ADVVE
Sbjct: 67  RTFGTAGEGELSVRLNQLVSAETCAAVADELNLHLYIRTGADVKKLTGKRMMNVRADVVE 126

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           SLIAA+YLDGG+EVA  F+ +YW+ RA+++   +RDAKTELQEW+HAKFGVTP Y+V  R
Sbjct: 127 SLIAAIYLDGGLEVARRFILRYWQGRAVRADGAKRDAKTELQEWSHAKFGVTPNYRVDER 186

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           SGPDHDPRF V VE++G+ P  G++ SKRAAEQVAA ++L+REGIW
Sbjct: 187 SGPDHDPRFKVTVEVAGIKPETGVERSKRAAEQVAATKMLEREGIW 232


>gi|190891073|ref|YP_001977615.1| ribonuclease III protein [Rhizobium etli CIAT 652]
 gi|218515110|ref|ZP_03511950.1| ribonuclease III [Rhizobium etli 8C-3]
 gi|238692512|sp|B3PUN8|RNC_RHIE6 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|190696352|gb|ACE90437.1| ribonuclease III protein [Rhizobium etli CIAT 652]
 gi|327191322|gb|EGE58355.1| ribonuclease III protein [Rhizobium etli CNPAF512]
          Length = 239

 Score =  275 bits (702), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 133/226 (58%), Positives = 172/226 (76%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           +SA   + LE  IG+ FA +  L++ALTH+S       +YERLEFLGDR+LGL I+ LLF
Sbjct: 7   LSAADRAKLESLIGHDFAEKERLDRALTHASARTEKGSNYERLEFLGDRVLGLCIAELLF 66

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F +A EGELSVR N LVSAETC+ VA EL+L  +IR  +D++K     M +++ADVVE
Sbjct: 67  RTFGTAGEGELSVRLNQLVSAETCAAVADELNLHLYIRTGADVKKLTGKRMMNVRADVVE 126

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           SLIAA+YLDGG+EVA  F+ +YW+ RA+++   +RDAKTELQEW+HAKFGVTP Y+V  R
Sbjct: 127 SLIAAIYLDGGLEVARRFILRYWQGRAVRADGAKRDAKTELQEWSHAKFGVTPLYRVDER 186

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           SGPDHDPRF V VE++G+ P  G++ SKRAAEQVAA ++L+REGIW
Sbjct: 187 SGPDHDPRFKVTVEVAGIKPETGVERSKRAAEQVAATKMLEREGIW 232


>gi|86357028|ref|YP_468920.1| ribonuclease III [Rhizobium etli CFN 42]
 gi|123512466|sp|Q2KAE3|RNC_RHIEC RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|86281130|gb|ABC90193.1| ribonuclease III protein [Rhizobium etli CFN 42]
          Length = 239

 Score =  274 bits (701), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 133/226 (58%), Positives = 172/226 (76%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           +SA   + LE  IG+ FA +  L++ALTH+S       +YERLEFLGDR+LGL I+ LLF
Sbjct: 7   LSAADRAKLEALIGHDFAEKERLDRALTHASARTEKGSNYERLEFLGDRVLGLCIAELLF 66

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F +A EGELSVR N LVSAETC+ VA EL+L  +IR  +D++K     M +++ADVVE
Sbjct: 67  RTFGTAGEGELSVRLNQLVSAETCAAVADELNLHLYIRTGADVKKLTGKRMMNVRADVVE 126

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           SLIAA+YLDGG+EVA  F+ +YW+ RA+++   +RDAKTELQEW+HAKFGVTP Y+V  R
Sbjct: 127 SLIAAIYLDGGLEVARRFILRYWQGRAVRADGAKRDAKTELQEWSHAKFGVTPIYRVDER 186

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           SGPDHDPRF V VE++G+ P  G++ SKRAAEQVAA ++L+REGIW
Sbjct: 187 SGPDHDPRFRVTVEVAGIKPESGVERSKRAAEQVAATKMLEREGIW 232


>gi|241203889|ref|YP_002974985.1| ribonuclease III [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240857779|gb|ACS55446.1| ribonuclease III [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 239

 Score =  274 bits (700), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 133/226 (58%), Positives = 172/226 (76%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           +SA   + LE  IG+ FA +  L++ALTH+S       +YERLEFLGDR+LGL I+ LLF
Sbjct: 7   LSAADRAKLEALIGHDFAEKERLDRALTHASARTEKGGNYERLEFLGDRVLGLCIAELLF 66

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F +A EGELSVR N LVSAETC+ VA EL+L  +IR  +D++K     M +++ADVVE
Sbjct: 67  RTFGTAGEGELSVRLNQLVSAETCAAVADELNLHLYIRTGADVKKLTGKRMMNVRADVVE 126

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           SLIAA+YLDGG+EVA  F+ +YW+ RA+++   +RDAKTELQEW+HAKFGVTP Y+V  R
Sbjct: 127 SLIAAIYLDGGLEVARRFILRYWQGRAVRADGAKRDAKTELQEWSHAKFGVTPIYRVDER 186

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           SGPDHDPRF V VE++G+ P  G++ SKRAAEQVAA ++L+REGIW
Sbjct: 187 SGPDHDPRFKVTVEVAGIKPETGVERSKRAAEQVAATKMLEREGIW 232


>gi|116251277|ref|YP_767115.1| ribonuclease III [Rhizobium leguminosarum bv. viciae 3841]
 gi|189043336|sp|Q1MJ54|RNC_RHIL3 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|115255925|emb|CAK07006.1| putative ribonuclease III [Rhizobium leguminosarum bv. viciae 3841]
          Length = 239

 Score =  273 bits (699), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 133/226 (58%), Positives = 172/226 (76%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           +SA   + LE  IG+ FA +  L++ALTH+S       +YERLEFLGDR+LGL I+ LLF
Sbjct: 7   LSAADRAKLEGLIGHDFAEKERLDRALTHASARTEKGGNYERLEFLGDRVLGLCIAELLF 66

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F +A EGELSVR N LVSAETC+ VA EL+L  +IR  +D++K     M +++ADVVE
Sbjct: 67  RTFGTAGEGELSVRLNQLVSAETCAAVADELNLHLYIRTGADVKKLTGKRMMNVRADVVE 126

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           SLIAA+YLDGG+EVA  F+ +YW+ RA+++   +RDAKTELQEW+HAKFGVTP Y+V  R
Sbjct: 127 SLIAAIYLDGGLEVARRFILRYWQGRAVRADGAKRDAKTELQEWSHAKFGVTPIYRVDER 186

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           SGPDHDPRF V VE++G+ P  G++ SKRAAEQVAA ++L+REGIW
Sbjct: 187 SGPDHDPRFKVTVEVAGIKPETGVERSKRAAEQVAATKMLEREGIW 232


>gi|227821403|ref|YP_002825373.1| ribonuclease III [Sinorhizobium fredii NGR234]
 gi|259491961|sp|C3M8S4|RNC_RHISN RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|227340402|gb|ACP24620.1| ribonuclease III [Sinorhizobium fredii NGR234]
          Length = 239

 Score =  273 bits (697), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 131/226 (57%), Positives = 164/226 (72%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           +SA   + LE  IGY FA +  L++ALTHSS  ++   +Y+RLEFLGDR+LGL ++ LLF
Sbjct: 7   LSAEDRARLETAIGYQFAEKERLDRALTHSSARNARASNYQRLEFLGDRVLGLCVAELLF 66

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F  A EGELSVR N LVSAE+C++VA EL L  +IR  SD++K     M +++ADVVE
Sbjct: 67  QTFLDANEGELSVRLNQLVSAESCARVADELSLHEYIRTGSDVKKITGKHMMNVRADVVE 126

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           SLIAA+YLDGG+E A  FV ++W  RA  +   RRDAKTELQEWAHAKFG  P Y+   R
Sbjct: 127 SLIAAIYLDGGLEAARRFVLRHWTDRAASADGARRDAKTELQEWAHAKFGAAPRYRTDDR 186

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           SGPDHDPRFTV VE+ G+AP  G D SKR AEQ+AA  +L+REG+W
Sbjct: 187 SGPDHDPRFTVTVEVDGIAPETGTDRSKRGAEQIAAMRLLEREGVW 232


>gi|15964825|ref|NP_385178.1| ribonuclease III [Sinorhizobium meliloti 1021]
 gi|307300895|ref|ZP_07580664.1| ribonuclease III [Sinorhizobium meliloti BL225C]
 gi|307320712|ref|ZP_07600124.1| ribonuclease III [Sinorhizobium meliloti AK83]
 gi|22654067|sp|Q92R47|RNC_RHIME RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|15074004|emb|CAC45651.1| Probable ribonuclease III [Sinorhizobium meliloti 1021]
 gi|306893639|gb|EFN24413.1| ribonuclease III [Sinorhizobium meliloti AK83]
 gi|306903850|gb|EFN34436.1| ribonuclease III [Sinorhizobium meliloti BL225C]
          Length = 238

 Score =  273 bits (697), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 162/218 (74%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE  IGY FA +  L++ALTHSS       +Y+RLEFLGDR+LGL ++ LLF  F  A E
Sbjct: 14  LEAAIGYRFAEKERLDRALTHSSARSGRAINYQRLEFLGDRVLGLCVAELLFQTFTDANE 73

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELSVR N LVSAE+C++VA EL L  FIR  SD++K     M +++ADVVESLIAA+YL
Sbjct: 74  GELSVRLNQLVSAESCAKVADELSLHEFIRTGSDVKKITGKHMMNVRADVVESLIAAIYL 133

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           DGG++ A  FV ++W  RA  +   RRDAKTELQEWAHAKFGV P+Y+   RSGPDHDPR
Sbjct: 134 DGGLDAARRFVLEHWTHRAASADGARRDAKTELQEWAHAKFGVAPKYRTDDRSGPDHDPR 193

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           FTV VE+ G+AP  G+D SKR AEQVAA ++L+REG+W
Sbjct: 194 FTVTVEVDGIAPETGVDRSKRGAEQVAAMKLLEREGVW 231


>gi|150395906|ref|YP_001326373.1| ribonuclease III [Sinorhizobium medicae WSM419]
 gi|189043356|sp|A6U7A8|RNC_SINMW RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|150027421|gb|ABR59538.1| Ribonuclease III [Sinorhizobium medicae WSM419]
          Length = 238

 Score =  272 bits (695), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 165/226 (73%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           ++A   + LE  IGY FA +  L++ALTHSS       +Y+RLEFLGDRILGL ++ LLF
Sbjct: 6   LNAEDRARLEAAIGYQFAEKERLDRALTHSSARSGRAINYQRLEFLGDRILGLCVAELLF 65

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F  A EGELSVR N LVSAE+C++VA EL L  FIR  SD++K     M +++ADVVE
Sbjct: 66  QTFSDANEGELSVRLNQLVSAESCAKVADELSLHEFIRTGSDVKKITGKHMMNVRADVVE 125

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           SLIAA+YLDGG+E A  FV ++W  RA  +   RRDAKTELQEWAHA+FGV P+Y+   R
Sbjct: 126 SLIAAIYLDGGLEAARRFVLEHWTHRAASADGARRDAKTELQEWAHARFGVAPKYRTEDR 185

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           SGPDHDPRFTV VE+ G+ P  G+D SKR AEQVAA ++L+REG+W
Sbjct: 186 SGPDHDPRFTVTVEVDGIDPETGVDRSKRGAEQVAAMKLLEREGVW 231


>gi|325292414|ref|YP_004278278.1| ribonuclease III [Agrobacterium sp. H13-3]
 gi|325060267|gb|ADY63958.1| ribonuclease III [Agrobacterium sp. H13-3]
          Length = 237

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 165/226 (73%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           +S    S LE  IGY F  ++ L++ALTH+S   +   +YERLEFLGDR+LGL ++ LLF
Sbjct: 7   LSIAEISRLEALIGYEFKEKARLDRALTHASARSAAAGNYERLEFLGDRVLGLCVAELLF 66

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F +A EGELSVR N LVSAE+C+ +  E+ L +FIR  SD++K     M +++ADVVE
Sbjct: 67  STFRNASEGELSVRLNQLVSAESCAAIGDEMGLHNFIRTGSDVKKLTGKAMLNVRADVVE 126

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           SLIA LYLDGG+E +  F+ KYW+ RA +    RRDAKTELQEWAHA+F VTP Y+V  R
Sbjct: 127 SLIATLYLDGGLEASRKFILKYWQGRATRVDAGRRDAKTELQEWAHARFAVTPAYRVDDR 186

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           SGPDHDP FTV VEI G+ P  G++ SKRAAEQVAA  +L+REG+W
Sbjct: 187 SGPDHDPSFTVTVEIPGVKPETGVERSKRAAEQVAATRLLEREGVW 232


>gi|159184588|ref|NP_354058.2| ribonuclease III [Agrobacterium tumefaciens str. C58]
 gi|22654057|sp|Q8UGK2|RNC_AGRT5 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|159139890|gb|AAK86843.2| ribonuclease III [Agrobacterium tumefaciens str. C58]
          Length = 239

 Score =  265 bits (678), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 164/226 (72%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           +SA   S LE  IGY F  ++ L++ALTH+S   +   +YERLEFLGDR+LGL ++ LLF
Sbjct: 7   LSADEISRLEALIGYEFKEKARLDRALTHASARSAAAGNYERLEFLGDRVLGLCVAELLF 66

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F +A EGELSVR N LVSAE+C+ +  E+ L +FIR  SD++K     M +++ADVVE
Sbjct: 67  STFRNASEGELSVRLNQLVSAESCAAIGDEMGLHNFIRTGSDVKKLTGKAMLNVRADVVE 126

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           SLIA LYLDGG+E +  F+ KYW+ RA      RRDAKTELQEWAHA+F  TP Y+V  R
Sbjct: 127 SLIATLYLDGGLEASRKFILKYWQGRATSVDAGRRDAKTELQEWAHARFAATPAYRVDDR 186

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           SGPDHDP FTV VEI G+ P  G++ SKRAAEQVAA  +L+REG+W
Sbjct: 187 SGPDHDPSFTVTVEIPGVKPETGVERSKRAAEQVAATRLLEREGVW 232


>gi|163760595|ref|ZP_02167676.1| putative ribonuclease III [Hoeflea phototrophica DFL-43]
 gi|162282210|gb|EDQ32500.1| putative ribonuclease III [Hoeflea phototrophica DFL-43]
          Length = 244

 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 165/217 (76%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           E+RIG+ F++   LE+ALTH+S   +   +YERLEFLGDR+LGL ++ LLF HF +A EG
Sbjct: 16  EERIGHQFSSPVRLERALTHASTRTNTNGNYERLEFLGDRVLGLCVAELLFGHFGNATEG 75

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLD 129
           E+SVR N LVSA+TCS+VA +L L  FIR  +D++K     M +++ADVVESLIAA+YLD
Sbjct: 76  EMSVRLNQLVSAQTCSEVADDLGLHEFIRTGADVKKLTGKRMANVRADVVESLIAAIYLD 135

Query: 130 GGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
            G+E A +F+ K+WK RAL     RRDAKTELQEWAHA+FGVTP Y+VT R+GPDH+P F
Sbjct: 136 AGLEAARSFIHKHWKARALAEDGARRDAKTELQEWAHARFGVTPVYRVTDRAGPDHEPVF 195

Query: 190 TVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           TV VEI+G  PA G   SKRAAEQ AA  VL+REG+W
Sbjct: 196 TVTVEINGAKPASGESSSKRAAEQAAATAVLEREGVW 232


>gi|222148081|ref|YP_002549038.1| ribonuclease III [Agrobacterium vitis S4]
 gi|259491897|sp|B9JUN7|RNC_AGRVS RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|221735069|gb|ACM36032.1| ribonuclease III [Agrobacterium vitis S4]
          Length = 239

 Score =  261 bits (668), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 131/227 (57%), Positives = 160/227 (70%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           ++A     +E  IGY F  +  L+KALTHSS   +    YERLEFLGDR+LGL ++  LF
Sbjct: 7   LTAEEREKVEAVIGYHFIGKERLDKALTHSSARPAKGSDYERLEFLGDRVLGLCVAEHLF 66

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F +A EGELSVR N LVSAETC+ VA E+ L  +IR  +D++K     M +++ADVVE
Sbjct: 67  KVFRAATEGELSVRLNQLVSAETCAAVADEIQLHRYIRTGADVKKLTDKNMLNVRADVVE 126

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           SLIAA+YLD G+E A  FV K+W +RA +    RRDAKTELQEWAHAKF VTP Y+V  R
Sbjct: 127 SLIAAIYLDAGLEAARAFVLKFWAERASRQDAGRRDAKTELQEWAHAKFAVTPVYRVADR 186

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIWT 227
           SGPDHDP FTV VEI  L P  G+D SKRAAEQ AA  +L+REG+WT
Sbjct: 187 SGPDHDPSFTVTVEIGKLEPETGIDRSKRAAEQAAATRLLEREGVWT 233


>gi|17987570|ref|NP_540204.1| ribonuclease III [Brucella melitensis bv. 1 str. 16M]
 gi|23501548|ref|NP_697675.1| ribonuclease III [Brucella suis 1330]
 gi|62289621|ref|YP_221414.1| ribonuclease III [Brucella abortus bv. 1 str. 9-941]
 gi|82699549|ref|YP_414123.1| ribonuclease III [Brucella melitensis biovar Abortus 2308]
 gi|161618631|ref|YP_001592518.1| ribonuclease III [Brucella canis ATCC 23365]
 gi|163842933|ref|YP_001627337.1| ribonuclease III [Brucella suis ATCC 23445]
 gi|189023875|ref|YP_001934643.1| ribonuclease III [Brucella abortus S19]
 gi|225852182|ref|YP_002732415.1| ribonuclease III [Brucella melitensis ATCC 23457]
 gi|254688937|ref|ZP_05152191.1| ribonuclease III [Brucella abortus bv. 6 str. 870]
 gi|254693419|ref|ZP_05155247.1| ribonuclease III [Brucella abortus bv. 3 str. Tulya]
 gi|254697072|ref|ZP_05158900.1| ribonuclease III [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701449|ref|ZP_05163277.1| ribonuclease III [Brucella suis bv. 5 str. 513]
 gi|254703995|ref|ZP_05165823.1| ribonuclease III [Brucella suis bv. 3 str. 686]
 gi|254707631|ref|ZP_05169459.1| ribonuclease III [Brucella pinnipedialis M163/99/10]
 gi|254709787|ref|ZP_05171598.1| ribonuclease III [Brucella pinnipedialis B2/94]
 gi|254713789|ref|ZP_05175600.1| ribonuclease III [Brucella ceti M644/93/1]
 gi|254717154|ref|ZP_05178965.1| ribonuclease III [Brucella ceti M13/05/1]
 gi|254718802|ref|ZP_05180613.1| ribonuclease III [Brucella sp. 83/13]
 gi|254729968|ref|ZP_05188546.1| ribonuclease III [Brucella abortus bv. 4 str. 292]
 gi|256031277|ref|ZP_05444891.1| ribonuclease III [Brucella pinnipedialis M292/94/1]
 gi|256044358|ref|ZP_05447262.1| ribonuclease III [Brucella melitensis bv. 1 str. Rev.1]
 gi|256060789|ref|ZP_05450951.1| ribonuclease III [Brucella neotomae 5K33]
 gi|256113201|ref|ZP_05454069.1| ribonuclease III [Brucella melitensis bv. 3 str. Ether]
 gi|256159387|ref|ZP_05457169.1| ribonuclease III [Brucella ceti M490/95/1]
 gi|256254685|ref|ZP_05460221.1| ribonuclease III [Brucella ceti B1/94]
 gi|256257185|ref|ZP_05462721.1| ribonuclease III [Brucella abortus bv. 9 str. C68]
 gi|256264307|ref|ZP_05466839.1| ribonuclease III family protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|256369099|ref|YP_003106607.1| ribonuclease III [Brucella microti CCM 4915]
 gi|260168415|ref|ZP_05755226.1| ribonuclease III [Brucella sp. F5/99]
 gi|260883452|ref|ZP_05895066.1| ribonuclease III [Brucella abortus bv. 9 str. C68]
 gi|261221863|ref|ZP_05936144.1| ribonuclease III [Brucella ceti B1/94]
 gi|261324780|ref|ZP_05963977.1| ribonuclease III [Brucella neotomae 5K33]
 gi|265988360|ref|ZP_06100917.1| ribonuclease III [Brucella pinnipedialis M292/94/1]
 gi|265990773|ref|ZP_06103330.1| ribonuclease III [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994609|ref|ZP_06107166.1| ribonuclease III [Brucella melitensis bv. 3 str. Ether]
 gi|265997827|ref|ZP_06110384.1| ribonuclease III [Brucella ceti M490/95/1]
 gi|54039241|sp|P66665|RNC_BRUSU RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|54041613|sp|P66664|RNC_BRUME RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|75497081|sp|Q57E81|RNC_BRUAB RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|90101615|sp|Q2YN02|RNC_BRUA2 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|189043295|sp|A9MA35|RNC_BRUC2 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|189043296|sp|B0CKY7|RNC_BRUSI RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|238691497|sp|B2SAD9|RNC_BRUA1 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|254807239|sp|C0RI03|RNC_BRUMB RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|17983275|gb|AAL52468.1| ribonuclease iii [Brucella melitensis bv. 1 str. 16M]
 gi|23347459|gb|AAN29590.1| ribonuclease III [Brucella suis 1330]
 gi|62195753|gb|AAX74053.1| ribonuclease III [Brucella abortus bv. 1 str. 9-941]
 gi|82615650|emb|CAJ10637.1| Ribonuclease III family:Double-stranded RNA binding (DsRBD) domain
           [Brucella melitensis biovar Abortus 2308]
 gi|161335442|gb|ABX61747.1| ribonuclease III [Brucella canis ATCC 23365]
 gi|163673656|gb|ABY37767.1| ribonuclease III [Brucella suis ATCC 23445]
 gi|189019447|gb|ACD72169.1| Ribonuclease III family [Brucella abortus S19]
 gi|225640547|gb|ACO00461.1| ribonuclease III [Brucella melitensis ATCC 23457]
 gi|255999259|gb|ACU47658.1| ribonuclease III [Brucella microti CCM 4915]
 gi|260872980|gb|EEX80049.1| ribonuclease III [Brucella abortus bv. 9 str. C68]
 gi|260920447|gb|EEX87100.1| ribonuclease III [Brucella ceti B1/94]
 gi|261300760|gb|EEY04257.1| ribonuclease III [Brucella neotomae 5K33]
 gi|262552295|gb|EEZ08285.1| ribonuclease III [Brucella ceti M490/95/1]
 gi|262765722|gb|EEZ11511.1| ribonuclease III [Brucella melitensis bv. 3 str. Ether]
 gi|263001557|gb|EEZ14132.1| ribonuclease III [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094580|gb|EEZ18378.1| ribonuclease III family protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|264660557|gb|EEZ30818.1| ribonuclease III [Brucella pinnipedialis M292/94/1]
          Length = 245

 Score =  249 bits (635), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 156/220 (70%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           S LE+R G+ F N   LE+ALTHSS+    + +YERLEFLGDR+LGL ++ +LF  F  A
Sbjct: 20  SILEERTGHRFLNLKRLERALTHSSVQAPARANYERLEFLGDRVLGLTVAEMLFEAFPEA 79

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EGELSVR N+LV+AETC+ +A E+ LA  I   SD++      + +++ADVVE+LIA +
Sbjct: 80  SEGELSVRLNALVNAETCAAIADEIGLADLIHTGSDIKSLNDKRLLNVRADVVEALIATI 139

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           YLDGG+E A +F+ +YWK+R+L++G  RRDAKTELQEWAH +  V P Y +  RSGPDHD
Sbjct: 140 YLDGGLEAARSFIQRYWKKRSLETGAARRDAKTELQEWAHQQGNVHPVYAILSRSGPDHD 199

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           P F V V + G AP +G   SKR AEQ AA  +L REG+W
Sbjct: 200 PLFLVEVTVKGFAPEKGEGRSKRIAEQSAAEAMLYREGVW 239


>gi|237815116|ref|ZP_04594114.1| ribonuclease III [Brucella abortus str. 2308 A]
 gi|260545623|ref|ZP_05821364.1| ribonuclease III [Brucella abortus NCTC 8038]
 gi|260563710|ref|ZP_05834196.1| ribonuclease III [Brucella melitensis bv. 1 str. 16M]
 gi|260566758|ref|ZP_05837228.1| ribonuclease III family protein [Brucella suis bv. 4 str. 40]
 gi|260754424|ref|ZP_05866772.1| ribonuclease III [Brucella abortus bv. 6 str. 870]
 gi|260757643|ref|ZP_05869991.1| ribonuclease III [Brucella abortus bv. 4 str. 292]
 gi|260761470|ref|ZP_05873813.1| ribonuclease III [Brucella abortus bv. 2 str. 86/8/59]
 gi|261213670|ref|ZP_05927951.1| ribonuclease III [Brucella abortus bv. 3 str. Tulya]
 gi|261218969|ref|ZP_05933250.1| ribonuclease III [Brucella ceti M13/05/1]
 gi|261315123|ref|ZP_05954320.1| ribonuclease III [Brucella pinnipedialis M163/99/10]
 gi|261317321|ref|ZP_05956518.1| ribonuclease III [Brucella pinnipedialis B2/94]
 gi|261321532|ref|ZP_05960729.1| ribonuclease III [Brucella ceti M644/93/1]
 gi|261751989|ref|ZP_05995698.1| ribonuclease III [Brucella suis bv. 5 str. 513]
 gi|261754648|ref|ZP_05998357.1| ribonuclease III [Brucella suis bv. 3 str. 686]
 gi|261757876|ref|ZP_06001585.1| ribonuclease III family [Brucella sp. F5/99]
 gi|265983784|ref|ZP_06096519.1| ribonuclease III [Brucella sp. 83/13]
 gi|294852025|ref|ZP_06792698.1| ribonuclease III [Brucella sp. NVSL 07-0026]
 gi|297248033|ref|ZP_06931751.1| ribonuclease III [Brucella abortus bv. 5 str. B3196]
 gi|237789953|gb|EEP64163.1| ribonuclease III [Brucella abortus str. 2308 A]
 gi|260097030|gb|EEW80905.1| ribonuclease III [Brucella abortus NCTC 8038]
 gi|260153726|gb|EEW88818.1| ribonuclease III [Brucella melitensis bv. 1 str. 16M]
 gi|260156276|gb|EEW91356.1| ribonuclease III family protein [Brucella suis bv. 4 str. 40]
 gi|260667961|gb|EEX54901.1| ribonuclease III [Brucella abortus bv. 4 str. 292]
 gi|260671902|gb|EEX58723.1| ribonuclease III [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674532|gb|EEX61353.1| ribonuclease III [Brucella abortus bv. 6 str. 870]
 gi|260915277|gb|EEX82138.1| ribonuclease III [Brucella abortus bv. 3 str. Tulya]
 gi|260924058|gb|EEX90626.1| ribonuclease III [Brucella ceti M13/05/1]
 gi|261294222|gb|EEX97718.1| ribonuclease III [Brucella ceti M644/93/1]
 gi|261296544|gb|EEY00041.1| ribonuclease III [Brucella pinnipedialis B2/94]
 gi|261304149|gb|EEY07646.1| ribonuclease III [Brucella pinnipedialis M163/99/10]
 gi|261737860|gb|EEY25856.1| ribonuclease III family [Brucella sp. F5/99]
 gi|261741742|gb|EEY29668.1| ribonuclease III [Brucella suis bv. 5 str. 513]
 gi|261744401|gb|EEY32327.1| ribonuclease III [Brucella suis bv. 3 str. 686]
 gi|264662376|gb|EEZ32637.1| ribonuclease III [Brucella sp. 83/13]
 gi|294820614|gb|EFG37613.1| ribonuclease III [Brucella sp. NVSL 07-0026]
 gi|297175202|gb|EFH34549.1| ribonuclease III [Brucella abortus bv. 5 str. B3196]
 gi|326408683|gb|ADZ65748.1| Ribonuclease III family [Brucella melitensis M28]
 gi|326538408|gb|ADZ86623.1| ribonuclease III [Brucella melitensis M5-90]
          Length = 234

 Score =  248 bits (634), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 156/220 (70%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           S LE+R G+ F N   LE+ALTHSS+    + +YERLEFLGDR+LGL ++ +LF  F  A
Sbjct: 9   SILEERTGHRFLNLKRLERALTHSSVQAPARANYERLEFLGDRVLGLTVAEMLFEAFPEA 68

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EGELSVR N+LV+AETC+ +A E+ LA  I   SD++      + +++ADVVE+LIA +
Sbjct: 69  SEGELSVRLNALVNAETCAAIADEIGLADLIHTGSDIKSLNDKRLLNVRADVVEALIATI 128

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           YLDGG+E A +F+ +YWK+R+L++G  RRDAKTELQEWAH +  V P Y +  RSGPDHD
Sbjct: 129 YLDGGLEAARSFIQRYWKKRSLETGAARRDAKTELQEWAHQQGNVHPVYAILSRSGPDHD 188

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           P F V V + G AP +G   SKR AEQ AA  +L REG+W
Sbjct: 189 PLFLVEVTVKGFAPEKGEGRSKRIAEQSAAEAMLYREGVW 228


>gi|148560325|ref|YP_001258645.1| ribonuclease III [Brucella ovis ATCC 25840]
 gi|306837522|ref|ZP_07470397.1| ribonuclease III [Brucella sp. NF 2653]
 gi|306842074|ref|ZP_07474746.1| ribonuclease III [Brucella sp. BO2]
 gi|148371582|gb|ABQ61561.1| ribonuclease III [Brucella ovis ATCC 25840]
 gi|306287824|gb|EFM59247.1| ribonuclease III [Brucella sp. BO2]
 gi|306407414|gb|EFM63618.1| ribonuclease III [Brucella sp. NF 2653]
          Length = 257

 Score =  248 bits (633), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 156/220 (70%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           S LE+R G+ F N   LE+ALTHSS+    + +YERLEFLGDR+LGL ++ +LF  F  A
Sbjct: 32  SILEERTGHRFLNLKRLERALTHSSVQAPARANYERLEFLGDRVLGLTVAEMLFEAFPEA 91

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EGELSVR N+LV+AETC+ +A E+ LA  I   SD++      + +++ADVVE+LIA +
Sbjct: 92  SEGELSVRLNALVNAETCAAIADEIGLADLIHTGSDIKSLNDKRLLNVRADVVEALIATI 151

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           YLDGG+E A +F+ +YWK+R+L++G  RRDAKTELQEWAH +  V P Y +  RSGPDHD
Sbjct: 152 YLDGGLEAARSFIQRYWKKRSLETGAARRDAKTELQEWAHQQGNVHPVYAILSRSGPDHD 211

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           P F V V + G AP +G   SKR AEQ AA  +L REG+W
Sbjct: 212 PLFLVEVTVKGFAPEKGEGRSKRIAEQSAAEAMLYREGVW 251


>gi|306845262|ref|ZP_07477838.1| ribonuclease III [Brucella sp. BO1]
 gi|306274421|gb|EFM56228.1| ribonuclease III [Brucella sp. BO1]
          Length = 257

 Score =  248 bits (633), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 156/220 (70%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           S LE+R G+ F N   LE+ALTHSS+    + +YERLEFLGDR+LGL ++ +LF  F  A
Sbjct: 32  SILEERTGHRFLNLKRLERALTHSSVQAPARANYERLEFLGDRVLGLTVAEMLFEAFPEA 91

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EGELSVR N+LV+AETC+ +A E+ LA  I   SD++      + +++ADVVE+LIA +
Sbjct: 92  SEGELSVRLNALVNAETCAAIADEIGLADLIHTGSDIKSLNDKRLLNVRADVVEALIATI 151

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           YLDGG+E A +F+ +YWK+R+L++G  RRDAKTELQEWAH +  V P Y +  RSGPDHD
Sbjct: 152 YLDGGLEAARSFIQRYWKKRSLETGAARRDAKTELQEWAHQQGNVHPVYAILSRSGPDHD 211

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           P F V V + G AP +G   SKR AEQ AA  +L REG+W
Sbjct: 212 PLFLVEVTVKGFAPEKGEGRSKRIAEQSAAEAMLYREGVW 251


>gi|153009954|ref|YP_001371169.1| ribonuclease III [Ochrobactrum anthropi ATCC 49188]
 gi|151561842|gb|ABS15340.1| Ribonuclease III [Ochrobactrum anthropi ATCC 49188]
          Length = 234

 Score =  240 bits (613), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 114/220 (51%), Positives = 154/220 (70%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + LE+R G+ F N   L++ALTHSS+    + +YERLEFLGDR+LGL ++ +LF+ F  A
Sbjct: 9   AILEERTGHRFLNLKRLDRALTHSSVQAPSRANYERLEFLGDRVLGLTVAEMLFDEFPDA 68

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EGELSVR N+LV+AETC+ +A E+ LA+ I   SD++      + +++ADVVE+LIA +
Sbjct: 69  SEGELSVRLNALVNAETCAAIADEIGLANLIHTGSDIKSLNDKRLLNVRADVVEALIATI 128

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           YLDGG+E    FV +YW++R+L++G  RRDAKTELQEWAH +  V P Y +  R+GPDHD
Sbjct: 129 YLDGGLEAVRPFVKRYWEKRSLQTGAARRDAKTELQEWAHQQGNVHPSYAIISRTGPDHD 188

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           P F V V + G A   G   SKR AEQ AA  +L REG+W
Sbjct: 189 PLFAVEVTVKGFATETGEGRSKRIAEQNAAEAMLYREGVW 228


>gi|240850197|ref|YP_002971590.1| ribonuclease III [Bartonella grahamii as4aup]
 gi|240267320|gb|ACS50908.1| ribonuclease III [Bartonella grahamii as4aup]
          Length = 235

 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 119/226 (52%), Positives = 151/226 (66%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M  L    L K  G+ F +   L+KALTHSS+  S Q +YERLEFLGDR+LGLLI+ +L+
Sbjct: 1   MKRLMIDQLFKLTGHRFKDEERLKKALTHSSVQDSEQGNYERLEFLGDRVLGLLIAEMLY 60

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F  A EGELSVR N LV+A+TC+ +ARE+ L   IRV  +++      + ++ ADVVE
Sbjct: 61  QLFPQASEGELSVRLNHLVNAQTCADIAREMRLPDMIRVGFEMKNFEGRRLINMHADVVE 120

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           +LIA +YLDGG+E    F+ KYW  RA K    RRDAKTELQEWAH +    P Y+V  R
Sbjct: 121 ALIAVIYLDGGLESVRPFIQKYWHSRAKKMDAGRRDAKTELQEWAHIQGNAQPHYQVIKR 180

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           SGPDHDP F V V ISG A   G   SKR AE++AA ++L+REG+W
Sbjct: 181 SGPDHDPVFMVEVSISGFASEIGQGSSKRYAERMAAEKILRREGVW 226


>gi|81647146|sp|Q6G082|RNC_BARQU RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|49239570|emb|CAF25927.1| Ribonuclease III [Bartonella quintana str. Toulouse]
          Length = 235

 Score =  239 bits (609), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 117/226 (51%), Positives = 153/226 (67%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+      LE+   + F +   L+KALTHSS+  S Q +YERLEFLGDR+LGLLI+ +L+
Sbjct: 1   MNCPIIDQLERLTEHHFKDEERLKKALTHSSVQDSEQGNYERLEFLGDRVLGLLIAEMLY 60

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F  A EGELSVR N LV+A+TC+ +A E+ L   I V  ++R      +T++ ADV+E
Sbjct: 61  KLFPQASEGELSVRLNGLVNAQTCADIALEMGLPDMIHVGFEMRNLKGRRLTNMHADVIE 120

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           +LIA +YLDGG++    F+ +YW+ RA +    RRDAKTELQEWAH + GV P Y+V  R
Sbjct: 121 ALIAVMYLDGGLKSVRPFIRRYWQSRAKQMDAGRRDAKTELQEWAHVQGGVQPHYRVVKR 180

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           SGPDHDP F V V I G AP  G   SKR AE++AA +VL+REGIW
Sbjct: 181 SGPDHDPVFMVEVSILGFAPEIGQGNSKRCAERMAAEKVLRREGIW 226


>gi|161761284|ref|YP_032108.2| ribonuclease III [Bartonella quintana str. Toulouse]
          Length = 246

 Score =  238 bits (608), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 151/218 (69%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE+   + F +   L+KALTHSS+  S Q +YERLEFLGDR+LGLLI+ +L+  F  A E
Sbjct: 20  LERLTEHHFKDEERLKKALTHSSVQDSEQGNYERLEFLGDRVLGLLIAEMLYKLFPQASE 79

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELSVR N LV+A+TC+ +A E+ L   I V  ++R      +T++ ADV+E+LIA +YL
Sbjct: 80  GELSVRLNGLVNAQTCADIALEMGLPDMIHVGFEMRNLKGRRLTNMHADVIEALIAVMYL 139

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           DGG++    F+ +YW+ RA +    RRDAKTELQEWAH + GV P Y+V  RSGPDHDP 
Sbjct: 140 DGGLKSVRPFIRRYWQSRAKQMDAGRRDAKTELQEWAHVQGGVQPHYRVVKRSGPDHDPV 199

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           F V V I G AP  G   SKR AE++AA +VL+REGIW
Sbjct: 200 FMVEVSILGFAPEIGQGNSKRCAERMAAEKVLRREGIW 237


>gi|163867992|ref|YP_001609196.1| ribonuclease III [Bartonella tribocorum CIP 105476]
 gi|189043294|sp|A9IRN0|RNC_BART1 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|161017643|emb|CAK01201.1| ribonuclease III [Bartonella tribocorum CIP 105476]
          Length = 235

 Score =  237 bits (605), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 117/226 (51%), Positives = 152/226 (67%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M  L    L K  G+ F +   L++ALTH+S+  S Q +YERLEFLGDR+LGLLI+ +L+
Sbjct: 1   MRRLMIDQLFKLTGHRFKDEEKLKRALTHASVQDSEQGNYERLEFLGDRVLGLLIAEMLY 60

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F  A EGELSVR N LV+A+TC+ +ARE+ L   I+V  ++R      + ++ ADVVE
Sbjct: 61  QLFPQASEGELSVRLNHLVNAQTCADIAREMRLPDMIQVGFEMRNFEGRRLINMHADVVE 120

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           +LIA +YLDGG+E    F+ KYW+ RA K    RRDAKTELQEWAH +    P Y+V  R
Sbjct: 121 ALIAVMYLDGGLESVRPFIQKYWQSRAKKMDAGRRDAKTELQEWAHIQGDAQPHYQVIKR 180

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           SGPDHDP F V V ISG A   G   SKR AE++AA ++L+REG+W
Sbjct: 181 SGPDHDPVFMVEVSISGFASEIGQGSSKRNAERMAAEKILRREGVW 226


>gi|239831496|ref|ZP_04679825.1| ribonuclease III [Ochrobactrum intermedium LMG 3301]
 gi|239823763|gb|EEQ95331.1| ribonuclease III [Ochrobactrum intermedium LMG 3301]
          Length = 234

 Score =  236 bits (603), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 112/220 (50%), Positives = 153/220 (69%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + LE+R G+ F N   L++ALTHSS+    + +YERLEFLGDR+LGL ++ +L++ F  A
Sbjct: 9   AILEERTGHRFLNVKRLDRALTHSSVQAPSRANYERLEFLGDRVLGLTVAEMLYDEFPEA 68

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EGELSVR N+LV+AETC+ +A E+ LA  I   SD++      + +++ADVVE+LIA +
Sbjct: 69  SEGELSVRLNALVNAETCAAIADEIGLADLIHTGSDIKSLNDKRLLNVRADVVEALIATI 128

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           YLDGG++    FV ++WK+R+L++G  RRDAKTELQEWAH +  V P Y +  R+GPDHD
Sbjct: 129 YLDGGLDAVRPFVKRFWKKRSLQTGAARRDAKTELQEWAHQQGNVHPAYSIISRTGPDHD 188

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           P F V V + G A   G   SKR AEQ AA  +L REG+W
Sbjct: 189 PLFMVEVTVKGFAAETGEGRSKRIAEQHAAEAMLYREGVW 228


>gi|161761286|ref|YP_033345.2| ribonuclease III [Bartonella henselae str. Houston-1]
          Length = 246

 Score =  235 bits (599), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 154/218 (70%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LEK  G+ F ++  L+KALTHSS+  S Q +YERLEFLGDR+LGLLI+ +L+  F  A E
Sbjct: 20  LEKLTGHYFKDKKKLKKALTHSSVQGSEQGNYERLEFLGDRVLGLLIAEMLYQLFPQASE 79

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELSVR NSLV+A+TC+ +A E++L   I V  +++      +T++ ADV+E+LIA +YL
Sbjct: 80  GELSVRLNSLVNAQTCADIALEMELPVMIHVGFEMKNLKGRRLTNMYADVIEALIAVIYL 139

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           DGG+E    F+ +YW+ RA +    RRDAKT+LQEWAH + GV P Y+V  RSGPDHDP 
Sbjct: 140 DGGLESVRPFIQRYWQSRAKQMDAGRRDAKTQLQEWAHVQGGVQPHYRVVKRSGPDHDPV 199

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           F V V I G A   G   SKR AE++AA ++L+REGIW
Sbjct: 200 FMVEVSIPGFASEIGQGNSKRCAERMAAEKILRREGIW 237


>gi|81648073|sp|Q6G459|RNC_BARHE RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|49238110|emb|CAF27317.1| Ribonuclease III [Bartonella henselae str. Houston-1]
          Length = 235

 Score =  235 bits (599), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 116/218 (53%), Positives = 154/218 (70%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LEK  G+ F ++  L+KALTHSS+  S Q +YERLEFLGDR+LGLLI+ +L+  F  A E
Sbjct: 9   LEKLTGHYFKDKKKLKKALTHSSVQGSEQGNYERLEFLGDRVLGLLIAEMLYQLFPQASE 68

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELSVR NSLV+A+TC+ +A E++L   I V  +++      +T++ ADV+E+LIA +YL
Sbjct: 69  GELSVRLNSLVNAQTCADIALEMELPVMIHVGFEMKNLKGRRLTNMYADVIEALIAVIYL 128

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           DGG+E    F+ +YW+ RA +    RRDAKT+LQEWAH + GV P Y+V  RSGPDHDP 
Sbjct: 129 DGGLESVRPFIQRYWQSRAKQMDAGRRDAKTQLQEWAHVQGGVQPHYRVVKRSGPDHDPV 188

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           F V V I G A   G   SKR AE++AA ++L+REGIW
Sbjct: 189 FMVEVSIPGFASEIGQGNSKRCAERMAAEKILRREGIW 226


>gi|121602768|ref|YP_988789.1| ribonuclease III [Bartonella bacilliformis KC583]
 gi|189043293|sp|A1US36|RNC_BARBK RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|120614945|gb|ABM45546.1| ribonuclease III [Bartonella bacilliformis KC583]
          Length = 235

 Score =  234 bits (598), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 111/218 (50%), Positives = 150/218 (68%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L+K  G++F N  LL+KALTHSS+  S Q +YERLEFLGDR+LGLL++ +L+  F  A E
Sbjct: 9   LKKLTGHSFKNEDLLKKALTHSSVQRSEQGNYERLEFLGDRVLGLLVAEMLYQFFPQASE 68

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELSVR N LV+A+TC+ +ARE+ L   + V  +++      + ++ ADVVE+LIA +YL
Sbjct: 69  GELSVRLNGLVNAQTCADIAREIGLPDMVHVGCEMKNLEGRRLANMHADVVEALIAVIYL 128

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           DGG++    F+ +YW+ RA K    RRDAKTELQEWAH + GV P+Y+V  R G DHDP 
Sbjct: 129 DGGLKSVRPFIQRYWQDRAKKIDASRRDAKTELQEWAHTQNGVQPQYRVIKRCGLDHDPV 188

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           F V V + G     G   SKR AE+ AA ++L+REG+W
Sbjct: 189 FVVEVSVPGFVSEVGEGGSKRHAERAAAEKILRREGMW 226


>gi|90420862|ref|ZP_01228767.1| ribonuclease III [Aurantimonas manganoxydans SI85-9A1]
 gi|90334837|gb|EAS48609.1| ribonuclease III [Aurantimonas manganoxydans SI85-9A1]
          Length = 252

 Score =  233 bits (594), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 122/224 (54%), Positives = 152/224 (67%), Gaps = 6/224 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSY------QESYERLEFLGDRILGLLISTLLFNH 62
           LE RIG  F  ++  E+ALTHSS+  S       + SYERLEFLGDR+LGL+++  LF+ 
Sbjct: 25  LESRIGITFHEKARFERALTHSSLRSSKGGKGEGERSYERLEFLGDRVLGLVVAEKLFDM 84

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           F  A EGELS+R NSLVSA+TC+++A EL L  F+R   DL+K       SI+AD+VESL
Sbjct: 85  FPGADEGELSLRLNSLVSADTCAEIADELGLYEFVRHGGDLKKLKSDRTKSIRADLVESL 144

Query: 123 IAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           IAA+YL  G+E A  F+ +YW  R  KS   RRDAKT LQEWAH +  VTP+Y++  RSG
Sbjct: 145 IAAIYLGEGLETARDFIVRYWGGRLGKSVAARRDAKTALQEWAHTRGPVTPQYEIVERSG 204

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           PDHDP FTV V I  +APA G   S+R AEQ AA  VL RE +W
Sbjct: 205 PDHDPLFTVRVSIPDVAPADGQGRSRRIAEQEAATAVLIRESVW 248


>gi|319408283|emb|CBI81936.1| ribonuclease III [Bartonella schoenbuchensis R1]
          Length = 236

 Score =  233 bits (594), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 151/218 (69%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LEK  G+ F N + L++ALTHSS+    + +YERLEFLGDR+LGLL++ +L+  F  A E
Sbjct: 10  LEKLTGHRFKNENRLKRALTHSSVQGLAEGNYERLEFLGDRVLGLLVAEMLYQFFPHASE 69

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELSVR N LV+ +TC+++A E+ L   I V  +++      + ++ ADV+E+LIA +YL
Sbjct: 70  GELSVRLNGLVNTQTCAEIALEMGLPDMIHVGFEMKNLENRRVANMYADVIEALIAVMYL 129

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           DG +E   +F+ KYW+ RA K    RRDAKTELQEWAH + G  P+Y+V  R GPDHDP 
Sbjct: 130 DGDLECVRSFIRKYWQDRARKMDAGRRDAKTELQEWAHTQDGAQPQYRVVKRYGPDHDPI 189

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           F V V++ G AP  G   SKR AE+VAA ++L+REG+W
Sbjct: 190 FMVEVKVFGFAPEIGQGSSKRHAERVAAEKILRREGVW 227


>gi|114706260|ref|ZP_01439162.1| ribonuclease III [Fulvimarina pelagi HTCC2506]
 gi|114538121|gb|EAU41243.1| ribonuclease III [Fulvimarina pelagi HTCC2506]
          Length = 234

 Score =  231 bits (588), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 116/220 (52%), Positives = 154/220 (70%), Gaps = 2/220 (0%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQE--SYERLEFLGDRILGLLISTLLFNHFDSA 66
           LEKRIG  F++   L++ALTHSS   S  +  SYERLEFLGDR+LGL+++  LF  F +A
Sbjct: 11  LEKRIGVRFSDHDRLQRALTHSSFRSSKGDGRSYERLEFLGDRVLGLVVADKLFEMFPNA 70

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EGELS+R NSLV+AETC+ VA E+ L  F+R   DLRK   S   SI+AD++ESLIAA+
Sbjct: 71  DEGELSLRLNSLVNAETCAAVADEIGLYEFVRQGGDLRKLAASRTKSIRADLMESLIAAI 130

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           YL+ G++ A  F++ +W +R  KS   RRD KT LQEWAH +    P+Y+V  RSGPDH+
Sbjct: 131 YLNSGLDDARAFIESHWGERLNKSVAARRDPKTALQEWAHQRGPEPPKYEVVDRSGPDHN 190

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           P+F + V I+G+ P++G   SKR AEQ AA  +L RE +W
Sbjct: 191 PKFRIKVSIAGVDPSEGEGSSKRLAEQSAATAMLIRENVW 230


>gi|319404018|emb|CBI77606.1| ribonuclease III [Bartonella rochalimae ATCC BAA-1498]
          Length = 227

 Score =  229 bits (584), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 145/218 (66%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LEK  G++F +   L++ALTHSS+  S Q +YERLEFLGDR+LGLLI+ +L+  F  A E
Sbjct: 9   LEKLTGHSFKDADRLKRALTHSSVQSSEQGNYERLEFLGDRVLGLLIAEMLYQIFPQASE 68

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELSVR N LV+A+TC+ +A E+ L   + V  +++      + +I ADV+E+LIA +YL
Sbjct: 69  GELSVRLNGLVNAQTCADIALEMGLPDMVHVGCEMKNLEGRRLVNIYADVIEALIAVIYL 128

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           DGG+E     + +YW  RA K    RRDAKTELQEWAH +    P Y+V  R GPDHDP 
Sbjct: 129 DGGLESVRPVIQRYWHDRAQKMNAGRRDAKTELQEWAHTQDSAQPYYQVVQRYGPDHDPV 188

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           F V V I G AP  G   SKR AE+ AA  +L+REGIW
Sbjct: 189 FMVEVSICGYAPEIGRGSSKRQAERDAAERILRREGIW 226


>gi|319407031|emb|CBI80668.1| ribonuclease III [Bartonella sp. 1-1C]
          Length = 227

 Score =  229 bits (583), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 111/218 (50%), Positives = 145/218 (66%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LEK  G++F +   L++ALTHSS+  S Q +YERLEFLGDR+LGLLI+ +L+  F  A E
Sbjct: 9   LEKLTGHSFKDADRLKRALTHSSVQSSEQGNYERLEFLGDRVLGLLIAEMLYQIFPQASE 68

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELSVR N LV+A+TC+ +A E+ L   + V  +++      + +I ADV+E+LIA +YL
Sbjct: 69  GELSVRLNGLVNAQTCADIALEMGLPDMVHVGCEMKNLEGRRLVNIYADVIEALIAVIYL 128

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           DGG+E     + +YW  RA K    RRD+KTELQEWAH +    P Y+V  R GPDHDP 
Sbjct: 129 DGGLESVRPVIQRYWHDRAKKMNAGRRDSKTELQEWAHTQDSAQPHYQVVQRYGPDHDPV 188

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           F V V I G AP  G   SKR AE+ AA  +L+REGIW
Sbjct: 189 FMVEVSICGYAPEIGRGSSKRQAERDAAERILRREGIW 226


>gi|319898692|ref|YP_004158785.1| ribonuclease III [Bartonella clarridgeiae 73]
 gi|319402656|emb|CBI76202.1| ribonuclease III [Bartonella clarridgeiae 73]
          Length = 234

 Score =  229 bits (583), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 113/218 (51%), Positives = 147/218 (67%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE+   ++F +   L+KALTHSS+  S Q +YERLEFLGDR+LGLLI+ +L+  F  A E
Sbjct: 9   LERLTEHSFKDADKLKKALTHSSVQSSEQGNYERLEFLGDRVLGLLIAEMLYQIFPQASE 68

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELSVR N LV+A+TC+ +A E+ L + IRV  +++      + ++ ADV+E+LIA +YL
Sbjct: 69  GELSVRLNGLVNAQTCADIALEMGLPNMIRVGCEMKNLEGRRLANMYADVIEALIAVIYL 128

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           +GG+E    F+ KYW+ RA K    RRDAKTELQEWAH K    P Y+V  R GPDHDP 
Sbjct: 129 EGGLESVRPFIQKYWQNRAKKMNAGRRDAKTELQEWAHTKDRAHPHYQVLQRCGPDHDPI 188

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           F V V I G A   G   SKR AE+ AA  +L+REGIW
Sbjct: 189 FVVEVSICGFASEIGRGSSKRQAERDAAERILRREGIW 226


>gi|319405458|emb|CBI79077.1| ribonuclease III [Bartonella sp. AR 15-3]
          Length = 235

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 146/218 (66%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LEK  G++F +   L++ALTH+S+  S   +YERLEFLGDR+LGLLI+ +L+  F  A E
Sbjct: 9   LEKLTGHSFKDVDRLKRALTHASVQSSENGNYERLEFLGDRVLGLLIAEMLYKIFPQASE 68

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELSVR N LV+A+TC+ +A E+ L+  + V  +++      + ++ ADV+E+LIA +YL
Sbjct: 69  GELSVRLNGLVNAQTCADIALEMGLSDMVHVGCEMKNLEGRRLANVYADVIEALIAVIYL 128

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           DGG+E     + +YW+ RA K    RRDAKTELQEWAH +    P Y+V  R GPDHDP 
Sbjct: 129 DGGLESVRPVIQRYWQDRAKKMNAGRRDAKTELQEWAHTQDNAQPHYQVVQRYGPDHDPI 188

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           F V V I G AP  G   SKR AE+ AA  +L+REGIW
Sbjct: 189 FIVEVSICGYAPEIGRGSSKRQAERDAAERILRREGIW 226


>gi|328543513|ref|YP_004303622.1| ribonuclease III [polymorphum gilvum SL003B-26A1]
 gi|326413257|gb|ADZ70320.1| Ribonuclease III [Polymorphum gilvum SL003B-26A1]
          Length = 234

 Score =  218 bits (555), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 111/223 (49%), Positives = 146/223 (65%), Gaps = 3/223 (1%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSI---SHSYQESYERLEFLGDRILGLLISTLLFNHFD 64
           TLE R+GY+F +++LL +ALTH+S      + + SY+RLEFLGDR+LGL ++T+L  HF 
Sbjct: 11  TLEGRLGYSFQDKALLMQALTHASALNAGGAARGSYQRLEFLGDRVLGLAVATMLHRHFP 70

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
            A EGEL+ R N +V  ETC+ +A ELDL   +R+S    +      T++ AD+ E++IA
Sbjct: 71  LADEGELARRLNHMVKRETCADIALELDLGEAMRISQSEAQTGGRRKTALLADICEAVIA 130

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           A+YLDGG   A  FV + W+ R L      RDAKT LQEWA +K    P Y+VT R GPD
Sbjct: 131 AIYLDGGFPAAEDFVRRLWEPRMLAWSGPLRDAKTTLQEWAQSKGLPAPGYQVTTREGPD 190

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIWT 227
           H P F V V +SG AP +G   SKR AEQ AA  VL+REG+WT
Sbjct: 191 HAPVFVVAVTVSGYAPGEGRGGSKRIAEQNAAEAVLRREGVWT 233


>gi|304392070|ref|ZP_07374012.1| ribonuclease III [Ahrensia sp. R2A130]
 gi|303296299|gb|EFL90657.1| ribonuclease III [Ahrensia sp. R2A130]
          Length = 244

 Score =  214 bits (545), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 114/227 (50%), Positives = 154/227 (67%), Gaps = 2/227 (0%)

Query: 2   SALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQES--YERLEFLGDRILGLLISTLL 59
           S  R + LE+ IGY FA+   L++ALTH+S +    ++  YERLEFLGDR+LG+ I+ +L
Sbjct: 6   STNRIAELEELIGYTFASHDRLKRALTHASATRKPGDNSHYERLEFLGDRVLGVCIAEML 65

Query: 60  FNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVV 119
           F  F +A EGELSVR N+LVS +TC+ +A E+ L +FI   +D++      M S++ADVV
Sbjct: 66  FETFPTAPEGELSVRLNALVSGKTCAAIADEIGLHAFITTGNDVKHVTGKRMRSVRADVV 125

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTF 179
           ES+IAA+YLDGG+E A  F+ +YW  R  ++G   RD+KT LQEWAH   G TP Y +  
Sbjct: 126 ESVIAAIYLDGGLEPARDFITRYWAGRLHETGAGIRDSKTALQEWAHTHSGETPVYTLVE 185

Query: 180 RSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           ++GPDHDP F + V I G++   G   SKRAAEQ AA  VL REG+W
Sbjct: 186 KTGPDHDPLFKISVAIHGVSGGNGAGRSKRAAEQAAARAVLLREGVW 232


>gi|110633304|ref|YP_673512.1| ribonuclease III [Mesorhizobium sp. BNC1]
 gi|110284288|gb|ABG62347.1| RNAse III [Chelativorans sp. BNC1]
          Length = 238

 Score =  213 bits (541), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 143/219 (65%), Gaps = 1/219 (0%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           + +RIG +F +  LLE+ALTHSS +      Y+RLEFLGDR+LGL ++ +L+  +  A E
Sbjct: 15  VNERIGLSFRDAELLERALTHSS-ARGKGGDYQRLEFLGDRVLGLAVAEMLYEAYPDASE 73

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS+R NSLV+AET +++  EL L + IR  SDL+        +++ADV+E+LIA +YL
Sbjct: 74  GELSLRLNSLVNAETLAEITEELGLDTLIRTGSDLKALAMRKQVNLRADVLEALIAVIYL 133

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
             G++ A  F+  +W +R+   G  R DAKT LQEWAH     TP+Y +  R GPDHDP 
Sbjct: 134 QDGLDGARQFIRTHWTERSTAEGAARADAKTALQEWAHRVSSATPDYVIESREGPDHDPV 193

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIWT 227
           FT VV I+G    +G   SKR AEQ AA EVL RE +WT
Sbjct: 194 FTAVVRIAGFQEGRGRGRSKREAEQAAATEVLIREAVWT 232


>gi|118587961|ref|ZP_01545371.1| Ribonuclease III [Stappia aggregata IAM 12614]
 gi|118439583|gb|EAV46214.1| Ribonuclease III [Stappia aggregata IAM 12614]
          Length = 236

 Score =  210 bits (535), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 143/223 (64%), Gaps = 3/223 (1%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSI---SHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           S L+  + Y F +  LL  ALTH+S    S +   SY+RLEFLGDR+LGL+I+++L  HF
Sbjct: 12  SALKNALQYEFRDLELLRVALTHASALPPSETVAGSYQRLEFLGDRVLGLVIASMLHKHF 71

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             A EGEL+ RFN +V  ETC+++A+EL +   +R+     +      T++ AD+ ES+I
Sbjct: 72  PRADEGELARRFNHMVKRETCAEIAQELGVGDAMRIGLAEAQTGGRKKTALLADICESVI 131

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           AA+YLDGG E A +F+ + W+ R L      RDAKT LQEWA +K   TP Y VT R GP
Sbjct: 132 AAIYLDGGFEAAESFITRLWEPRMLSWSGPLRDAKTTLQEWAQSKSLPTPRYDVTSRDGP 191

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           DH P FTV V + GL P +G   SKR AEQ AA  VL+REG+W
Sbjct: 192 DHAPNFTVSVTVQGLPPGEGKGGSKRIAEQNAAEAVLRREGVW 234


>gi|218663008|ref|ZP_03518938.1| ribonuclease III [Rhizobium etli IE4771]
          Length = 206

 Score =  208 bits (529), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 98/159 (61%), Positives = 127/159 (79%)

Query: 68  EGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALY 127
           + ELSVR N LVSAETC+ VA EL+L  +IR  +D++K     M +++ADVVESLIAA+Y
Sbjct: 41  KAELSVRLNQLVSAETCAAVADELNLHLYIRTGADVKKLTGKRMMNVRADVVESLIAAIY 100

Query: 128 LDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDP 187
           LDGG+EVA  F+ +YW+ RA+++   +RDAKTELQEW+HAKFGVTP Y+V  RSGPDHDP
Sbjct: 101 LDGGLEVARRFILRYWQGRAVRADGAKRDAKTELQEWSHAKFGVTPIYRVDERSGPDHDP 160

Query: 188 RFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           RF V VE++G+ P  G++ SKRAAEQVAA ++L+REGIW
Sbjct: 161 RFKVTVEVAGIKPETGVERSKRAAEQVAATKMLEREGIW 199


>gi|307946585|ref|ZP_07661920.1| ribonuclease III [Roseibium sp. TrichSKD4]
 gi|307770249|gb|EFO29475.1| ribonuclease III [Roseibium sp. TrichSKD4]
          Length = 235

 Score =  207 bits (526), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 103/222 (46%), Positives = 143/222 (64%), Gaps = 3/222 (1%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSI---SHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           L +R+ Y F +  L+ KALTH+S         +SY+RLEFLGDR+LGL+++T+L  +F  
Sbjct: 13  LSERLHYTFKDEKLIRKALTHASALEPGEGDDQSYQRLEFLGDRVLGLVVATMLHKNFPK 72

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
           A EGEL+ RFN +V  ETC+++A+EL+L   +R+     +      T++ AD+ E++IAA
Sbjct: 73  ADEGELARRFNHMVKRETCAEIAQELNLGDAMRIGHSEAQTGGRKKTALLADICEAVIAA 132

Query: 126 LYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           +YLDGG + A  F+ ++WK+R L      RDAKT LQEWA +K   TP Y+V  R GPDH
Sbjct: 133 IYLDGGFDAATAFIQRFWKKRMLSWTGPLRDAKTTLQEWAQSKSLPTPFYEVISRDGPDH 192

Query: 186 DPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIWT 227
            P F V V + GL   +G   SKR AEQ AA  VL+REG+W 
Sbjct: 193 APIFVVAVAVKGLENGEGKGGSKRLAEQNAAEAVLRREGVWN 234


>gi|254469250|ref|ZP_05082655.1| ribonuclease III [Pseudovibrio sp. JE062]
 gi|211961085|gb|EEA96280.1| ribonuclease III [Pseudovibrio sp. JE062]
          Length = 235

 Score =  206 bits (525), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 103/224 (45%), Positives = 146/224 (65%), Gaps = 3/224 (1%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSS---ISHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           + LE+RIGY F N+ LL +ALTH+S   ++ +  +SY+RLEFLGDR+LGL I+T+L  +F
Sbjct: 11  AALEERIGYKFTNKELLVRALTHASALPVAKASLQSYQRLEFLGDRVLGLAIATMLEENF 70

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             A EGEL+ R N LV  ETC++V++ + +   +RV            T+I AD+ ESLI
Sbjct: 71  PKADEGELARRLNQLVKRETCAEVSKVIGIGQHMRVGEAEAHTGGRTKTAILADMCESLI 130

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           AA+YLD G + A  F+ +Y+ +R +      RDAKT LQEWA +K   TP+Y+   RSGP
Sbjct: 131 AAIYLDSGFDEAENFIKRYFAERMVSYTGPLRDAKTTLQEWAQSKGRPTPQYETISRSGP 190

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIWT 227
           DH P F + V + G+ P + +  SKR AEQ AA  +L+REG+W+
Sbjct: 191 DHAPIFKIRVNVEGVDPGEAVGSSKRIAEQSAAENILRREGVWS 234


>gi|161621443|ref|NP_108012.2| ribonuclease III [Mesorhizobium loti MAFF303099]
          Length = 237

 Score =  206 bits (523), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 112/221 (50%), Positives = 145/221 (65%), Gaps = 1/221 (0%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSISHSYQES-YERLEFLGDRILGLLISTLLFNHFDSA 66
            L +R G+AFA+R  L++ALTH+S   +   + YER EFLGDR+LGL+++ +L   F  A
Sbjct: 15  ALVERTGHAFADRQRLQRALTHASARGANAGTDYERFEFLGDRVLGLVVADMLLAAFPDA 74

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EGELS+R N+LV+AE  S++A  + L   IR  SD+R        +++AD +ESLIA L
Sbjct: 75  AEGELSLRLNALVNAEALSEIAEHIGLPDLIRAGSDVRGLEGRKRVNLRADALESLIAVL 134

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           YLDGG+E A  F+ KYW+ R+  SG  RRDAKTELQEWAH      P Y++  R GPDHD
Sbjct: 135 YLDGGLEAARAFIHKYWQPRSQASGAARRDAKTELQEWAHQAASAVPAYQIDSREGPDHD 194

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIWT 227
           P FTV V +    PA G   SKR AEQ AAA +L REG+W 
Sbjct: 195 PLFTVSVRVGAFQPATGSGRSKREAEQAAAAALLLREGVWN 235


>gi|81776564|sp|Q985A6|RNC_RHILO RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|14027203|dbj|BAB54157.1| ribonuclease III [Mesorhizobium loti MAFF303099]
          Length = 221

 Score =  205 bits (521), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 111/218 (50%), Positives = 144/218 (66%), Gaps = 1/218 (0%)

Query: 11  KRIGYAFANRSLLEKALTHSSISHSYQES-YERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           +R G+AFA+R  L++ALTH+S   +   + YER EFLGDR+LGL+++ +L   F  A EG
Sbjct: 2   ERTGHAFADRQRLQRALTHASARGANAGTDYERFEFLGDRVLGLVVADMLLAAFPDAAEG 61

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLD 129
           ELS+R N+LV+AE  S++A  + L   IR  SD+R        +++AD +ESLIA LYLD
Sbjct: 62  ELSLRLNALVNAEALSEIAEHIGLPDLIRAGSDVRGLEGRKRVNLRADALESLIAVLYLD 121

Query: 130 GGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
           GG+E A  F+ KYW+ R+  SG  RRDAKTELQEWAH      P Y++  R GPDHDP F
Sbjct: 122 GGLEAARAFIHKYWQPRSQASGAARRDAKTELQEWAHQAASAVPAYQIDSREGPDHDPLF 181

Query: 190 TVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIWT 227
           TV V +    PA G   SKR AEQ AAA +L REG+W 
Sbjct: 182 TVSVRVGAFQPATGSGRSKREAEQAAAAALLLREGVWN 219


>gi|39935763|ref|NP_948039.1| ribonuclease III [Rhodopseudomonas palustris CGA009]
 gi|192291350|ref|YP_001991955.1| ribonuclease III [Rhodopseudomonas palustris TIE-1]
 gi|81562548|sp|Q6N6C1|RNC_RHOPA RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|39649616|emb|CAE28138.1| putative ribonuclease III [Rhodopseudomonas palustris CGA009]
 gi|192285099|gb|ACF01480.1| Ribonuclease III [Rhodopseudomonas palustris TIE-1]
          Length = 272

 Score =  204 bits (519), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 105/221 (47%), Positives = 142/221 (64%), Gaps = 2/221 (0%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHFDSA 66
           +E+R+G++FA+ SLL  A TH S   S +  +SY+RLEFLGD +LGL++S +L+  F  A
Sbjct: 47  IEQRLGHSFADPSLLTTAFTHVSALKSARRTDSYQRLEFLGDHVLGLIVSDMLYRAFPDA 106

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EGELS R   LV  ETC+ VAR LDL   I++ +           S+  D+ E++I A+
Sbjct: 107 DEGELSKRLADLVRKETCADVARSLDLVEGIKLGTVGAGAGAKLRKSVLGDICEAVIGAI 166

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           YLDGG E A  FV + W +R  K  +  RD KT LQEWA A+   TP Y+   R+GP HD
Sbjct: 167 YLDGGYEAASDFVRRNWTERMRKPARSLRDPKTVLQEWAQARGLPTPVYREVERTGPHHD 226

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIWT 227
           P+F V V + GL PA+G+  SKRAAE+VAA+ +L REG+ T
Sbjct: 227 PQFRVAVILPGLEPAEGLGGSKRAAEKVAASAMLAREGVGT 267


>gi|316934144|ref|YP_004109126.1| ribonuclease III [Rhodopseudomonas palustris DX-1]
 gi|315601858|gb|ADU44393.1| ribonuclease III [Rhodopseudomonas palustris DX-1]
          Length = 272

 Score =  203 bits (516), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 105/219 (47%), Positives = 142/219 (64%), Gaps = 2/219 (0%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHFDSA 66
           +E+RIG++FA+ SLL  ALTH S   S +  +SY+RLEFLGD +LGL++S +L+  F  A
Sbjct: 47  IEQRIGHSFADPSLLTTALTHVSALKSARRTDSYQRLEFLGDHVLGLIVSDMLYRAFPDA 106

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EGELS R   LV  E+C+ VAR LDL+  I++ +           S+  D+ E++I A+
Sbjct: 107 DEGELSKRLADLVRKESCADVARHLDLSEGIKIGTVGAGAGAKLRKSVLGDICEAVIGAV 166

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           YLDGG E A  FV   W +R  K  +  RD KT LQEWA A+   TP Y+   R+GP HD
Sbjct: 167 YLDGGYEAASNFVRSNWTERMHKPVRSLRDPKTVLQEWAQARGLPTPVYREVERTGPHHD 226

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           P+F V V + GL PA+G+  SKRAAE+VAA+ +L REG+
Sbjct: 227 PQFRVAVVLPGLEPAEGVGGSKRAAEKVAASAMLAREGV 265


>gi|114570121|ref|YP_756801.1| ribonuclease III [Maricaulis maris MCS10]
 gi|114340583|gb|ABI65863.1| RNAse III [Maricaulis maris MCS10]
          Length = 228

 Score =  202 bits (515), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 109/220 (49%), Positives = 139/220 (63%), Gaps = 6/220 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHFDSA 66
           LE+RIGY F ++ L+E+ALTH S +   +   +YERLEFLGDR+LGL+ +  LF  FD A
Sbjct: 8   LEQRIGYVFTDKRLIERALTHGSFAEGRKTIPTYERLEFLGDRVLGLMTAEALFKSFDKA 67

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG L+ R NS+V  ETC+ VAR +DL + +R+     K      TSI  D  ESL+AA+
Sbjct: 68  DEGALAPRLNSMVRKETCADVARAVDLGAALRIGKSEEKGGGRNKTSILGDACESLMAAI 127

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLDGG      F D +W  R  ALK+     DAK+ LQEWA       P Y++T RSGPD
Sbjct: 128 YLDGGRAAVQAFFDHHWGPRIEALKAKPL--DAKSALQEWAAKTGRGVPRYELTERSGPD 185

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           H P FTV V ++ LAPA G   SK+ AE+ AA E+LKREG
Sbjct: 186 HRPVFTVQVTVTPLAPAVGEGGSKQVAERAAAEELLKREG 225


>gi|91977122|ref|YP_569781.1| ribonuclease III [Rhodopseudomonas palustris BisB5]
 gi|91683578|gb|ABE39880.1| RNAse III [Rhodopseudomonas palustris BisB5]
          Length = 271

 Score =  202 bits (513), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 104/222 (46%), Positives = 141/222 (63%), Gaps = 3/222 (1%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ---ESYERLEFLGDRILGLLISTLLFNHFDS 65
           +E+RIG+ FA+ SLL  ALTH S   S +   +SY+RLEFLGD +LGL++S +L+  F +
Sbjct: 45  IEQRIGHTFADPSLLNTALTHVSALKSARNRADSYQRLEFLGDHVLGLVVSDMLYRAFPN 104

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
           A EGELS R   LV  ETC+ +AR LDL   I++ +           S+  D+ E++I A
Sbjct: 105 ADEGELSKRLADLVRKETCADIARSLDLLDGIKLGTVGAGAGARLRKSVLGDICEAVIGA 164

Query: 126 LYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           ++LDGG   A  FV + W +R  K  +  RD KT LQEWA  K   TP Y+   R+GP H
Sbjct: 165 VFLDGGYPAAADFVQRNWTERMRKPARSLRDPKTVLQEWAQGKGLPTPVYREVERTGPHH 224

Query: 186 DPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIWT 227
           DP+F V V + GL PA+G+  SKRAAE+VAA+ +L REG+ T
Sbjct: 225 DPQFRVAVSLPGLEPAEGVGGSKRAAEKVAASVMLAREGVST 266


>gi|260462323|ref|ZP_05810531.1| ribonuclease III [Mesorhizobium opportunistum WSM2075]
 gi|259031817|gb|EEW33085.1| ribonuclease III [Mesorhizobium opportunistum WSM2075]
          Length = 237

 Score =  201 bits (512), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 112/221 (50%), Positives = 142/221 (64%), Gaps = 1/221 (0%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSISHSYQE-SYERLEFLGDRILGLLISTLLFNHFDSA 66
            L +R G+AFA+R  L++ALTH+S   +     YER EFLGDR+LGL+++ +L   F  A
Sbjct: 15  ALVERTGHAFADRQRLQRALTHASARGANAGIDYERFEFLGDRVLGLVVADMLLAAFPDA 74

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EGELS+R N+LV+AE  S +A  + L   IR  SD+R        +++AD +ESLIA L
Sbjct: 75  AEGELSLRLNALVNAEALSDIAEHIGLPDLIRAGSDIRGLDGRKRVNLRADALESLIAVL 134

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           YLDGG+E A  F+ KYW  R+  SG  RRDAKTELQEWAH      P Y++  R GPDHD
Sbjct: 135 YLDGGLEAARAFIHKYWLPRSQASGAARRDAKTELQEWAHQAASAVPAYQIDSREGPDHD 194

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIWT 227
           P FTV V +    PA G   SKR AEQ AAA +L REG+W 
Sbjct: 195 PLFTVSVRVGTFQPAVGSGRSKREAEQAAAAALLLREGVWN 235


>gi|86749730|ref|YP_486226.1| ribonuclease III [Rhodopseudomonas palustris HaA2]
 gi|86572758|gb|ABD07315.1| RNAse III [Rhodopseudomonas palustris HaA2]
          Length = 271

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 103/220 (46%), Positives = 141/220 (64%), Gaps = 3/220 (1%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ---ESYERLEFLGDRILGLLISTLLFNHFDS 65
           +E+RIG++FA+ SLL  ALTH S   S +   +SY+RLEFLGD +LGL++S +L+  F +
Sbjct: 45  IEQRIGHSFADPSLLNTALTHVSALKSARNRADSYQRLEFLGDHVLGLVVSDMLYRAFPN 104

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
           A EGELS R   LV  ETC+ VAR LDL   +++ +           S+  D+ E++I A
Sbjct: 105 ADEGELSKRLADLVRKETCADVARSLDLDEGVKLGTVGAGAGARLRKSVLGDICEAVIGA 164

Query: 126 LYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           ++LDGG   A  FV + W +R  K  +  RD KT LQEWA  K   TP Y+   R+GP H
Sbjct: 165 VFLDGGYPAAAEFVQRNWTERMRKPTRSLRDPKTVLQEWAQGKGLPTPVYREVERTGPHH 224

Query: 186 DPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           DP+F V V + GL PA+G+  SKRAAE+VAA+ +L REG+
Sbjct: 225 DPQFRVAVSLPGLDPAEGVGGSKRAAEKVAASVMLAREGV 264


>gi|254503847|ref|ZP_05115998.1| ribonuclease III [Labrenzia alexandrii DFL-11]
 gi|222439918|gb|EEE46597.1| ribonuclease III [Labrenzia alexandrii DFL-11]
          Length = 235

 Score =  198 bits (503), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 102/223 (45%), Positives = 141/223 (63%), Gaps = 3/223 (1%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSI---SHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           + L+  + Y F +  LL  +LTH+S    + +   SY+RLEFLGDR+LGL+++++L +HF
Sbjct: 11  AALKAALAYEFKDLELLRVSLTHASALDPADTVAGSYQRLEFLGDRVLGLVVASMLHHHF 70

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             A EGEL+ RFN +V  ETC+++A EL +   +R+     +      T++ AD+ E++I
Sbjct: 71  PKADEGELARRFNHMVKRETCAEIASELGVGDAMRIGQAEAQTGGRKKTALLADICEAII 130

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           AA+YLDGG E A  FV + W+ R L      RDAKT LQEWA +K   TP Y+V  R GP
Sbjct: 131 AAIYLDGGFEAADEFVRRLWEPRMLSWTGPLRDAKTTLQEWAQSKSLPTPHYEVASREGP 190

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           DH P FTV V + GL   +G   SKR AEQ AA  VL+REG+W
Sbjct: 191 DHAPSFTVSVIVQGLKNGEGKGGSKRIAEQHAAEAVLRREGVW 233


>gi|90424139|ref|YP_532509.1| ribonuclease III [Rhodopseudomonas palustris BisB18]
 gi|90106153|gb|ABD88190.1| RNAse III [Rhodopseudomonas palustris BisB18]
          Length = 272

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 103/217 (47%), Positives = 140/217 (64%), Gaps = 3/217 (1%)

Query: 12  RIGYAFANRSLLEKALTHSSISHSYQ---ESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           RIG+AFA+ +LL  A TH S   S +   +SY+RLEFLGD +LGL++S +L+  F +A E
Sbjct: 49  RIGHAFADPALLATAFTHVSALKSARNRADSYQRLEFLGDHVLGLVVSDMLYRAFPNADE 108

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS R   LV  E C+ VAR LDL   I++ +           S+  D+ E++I A++L
Sbjct: 109 GELSKRLADLVRKEACADVARSLDLLDGIKLGTVGAGAGARLRKSVLGDICEAVIGAIFL 168

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           DGG   A +FV + W +R  K  +  RDAKT LQEWA  K   TP Y+   R+GP HDP+
Sbjct: 169 DGGYPAAESFVQRNWLERMRKPVRPLRDAKTILQEWAQGKGLPTPVYREVERTGPHHDPQ 228

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           F V V++ GLAPA+G+  SKRAAE+VAA+ +L REG+
Sbjct: 229 FRVAVDLPGLAPAEGIGGSKRAAEKVAASVMLAREGV 265


>gi|30179749|sp|O69161|RNC_BRAJA RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
          Length = 250

 Score =  195 bits (495), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 100/222 (45%), Positives = 144/222 (64%), Gaps = 3/222 (1%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQ---ESYERLEFLGDRILGLLISTLLFNHF 63
           + LE RIG++FA+ +LL + +TH S   S +   +SY+RLEFLGD +LGL++S +L++ F
Sbjct: 23  AALEARIGHSFADPNLLMQGITHVSALKSGRKRGDSYQRLEFLGDHVLGLVVSDMLYHAF 82

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
            +A EGELS R   LV  E+C+ VA+ L L   I++ S           S+  D+ E++I
Sbjct: 83  PNADEGELSKRLAELVRKESCADVAKSLGLLDDIKLGSVGPSADARLRKSVLGDICEAVI 142

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
            A++LDGG   A  FV + W +R  K  +  RD KT LQEWA  K   TP Y+   R+GP
Sbjct: 143 GAIFLDGGHAAAAEFVKRNWTERMHKPRRPLRDPKTVLQEWAQGKGLPTPVYREVERTGP 202

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
            HDP+F V V++ GLAPA+G+  SKRAAE+VAA+ +++REG+
Sbjct: 203 HHDPQFRVAVDLPGLAPAEGIGGSKRAAEKVAASVMIEREGV 244


>gi|27380172|ref|NP_771701.1| RNase III [Bradyrhizobium japonicum USDA 110]
 gi|27353326|dbj|BAC50326.1| RNase III [Bradyrhizobium japonicum USDA 110]
          Length = 273

 Score =  195 bits (495), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 100/222 (45%), Positives = 144/222 (64%), Gaps = 3/222 (1%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQ---ESYERLEFLGDRILGLLISTLLFNHF 63
           + LE RIG++FA+ +LL + +TH S   S +   +SY+RLEFLGD +LGL++S +L++ F
Sbjct: 46  AALEARIGHSFADPNLLMQGITHVSALKSGRKRGDSYQRLEFLGDHVLGLVVSDMLYHAF 105

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
            +A EGELS R   LV  E+C+ VA+ L L   I++ S           S+  D+ E++I
Sbjct: 106 PNADEGELSKRLAELVRKESCADVAKSLGLLDDIKLGSVGPSADARLRKSVLGDICEAVI 165

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
            A++LDGG   A  FV + W +R  K  +  RD KT LQEWA  K   TP Y+   R+GP
Sbjct: 166 GAIFLDGGHAAAAEFVKRNWTERMHKPRRPLRDPKTVLQEWAQGKGLPTPVYREVERTGP 225

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
            HDP+F V V++ GLAPA+G+  SKRAAE+VAA+ +++REG+
Sbjct: 226 HHDPQFRVAVDLPGLAPAEGIGGSKRAAEKVAASVMIEREGV 267


>gi|146341377|ref|YP_001206425.1| ribonuclease III (modular protein) [Bradyrhizobium sp. ORS278]
 gi|146194183|emb|CAL78204.1| ribonuclease III (modular protein) [Bradyrhizobium sp. ORS278]
          Length = 357

 Score =  194 bits (493), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 100/217 (46%), Positives = 137/217 (63%), Gaps = 3/217 (1%)

Query: 12  RIGYAFANRSLLEKALTHSSI---SHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           RIG+ FA+ SLL  A TH S    S    +SY+RLEFLGD +LGL++S +L+  F SA E
Sbjct: 134 RIGHRFADPSLLSTAFTHVSALKSSKKRGDSYQRLEFLGDHVLGLIVSDMLYRAFPSADE 193

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS R   LV  E+C+ VA+ L L   I++ +           S+  DV E++I A++L
Sbjct: 194 GELSKRLADLVRKESCADVAKSLGLLDDIKLGAVGAGAGARLRKSVLGDVCEAVIGAIFL 253

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           DGG   A  FV++ W +R  K  +  RD KT LQEWA  K   TP Y+   R+GP HDP+
Sbjct: 254 DGGYTAAAGFVERNWTERMRKPRRPLRDPKTVLQEWAQGKGLPTPVYREVERTGPHHDPQ 313

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           F V V++ GL PA+G+  SKRAAE+VAA+ +++REG+
Sbjct: 314 FRVAVDLPGLEPAEGVGGSKRAAEKVAASVMIEREGV 350


>gi|115525028|ref|YP_781939.1| ribonuclease III [Rhodopseudomonas palustris BisA53]
 gi|115518975|gb|ABJ06959.1| RNAse III [Rhodopseudomonas palustris BisA53]
          Length = 268

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 101/217 (46%), Positives = 133/217 (61%), Gaps = 3/217 (1%)

Query: 12  RIGYAFANRSLLEKALTHSSI---SHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           RIG+ F +  LL  A TH S    SHS  +SY+R+EFLGD +LGL++S +L+  F  A E
Sbjct: 49  RIGHDFKDAGLLATAFTHVSALKSSHSRADSYQRMEFLGDHVLGLVVSDMLYRAFPKADE 108

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS R   LV  ETC+ VA  L L   I++ +           S+  D+ E++I A+YL
Sbjct: 109 GELSKRLADLVRKETCADVALALGLLDGIKLGTVGAGAGARLRKSVLGDICEAVIGAVYL 168

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           DGG   A  FV+  W +R  K  +  RD KT LQEWA  K   TP Y+   R+GPDHDP+
Sbjct: 169 DGGYPAAAKFVEANWTERMRKPTRSLRDPKTVLQEWAQGKGLPTPAYREVERTGPDHDPK 228

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           F V VE+ GL PA+G+  SKRAAE+ AA+ +L REG+
Sbjct: 229 FRVRVELPGLEPAEGIGGSKRAAEKEAASAMLAREGV 265


>gi|148256032|ref|YP_001240617.1| ribonuclease III [Bradyrhizobium sp. BTAi1]
 gi|146408205|gb|ABQ36711.1| RNAse III [Bradyrhizobium sp. BTAi1]
          Length = 368

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 99/217 (45%), Positives = 137/217 (63%), Gaps = 3/217 (1%)

Query: 12  RIGYAFANRSLLEKALTHSSI---SHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           RIG+ FA+ SLL  A+TH S    S    +SY+RLEFLGD +LGL++S +L+  F SA E
Sbjct: 145 RIGHHFADPSLLSTAVTHVSALKSSKKRGDSYQRLEFLGDHVLGLIVSDMLYRSFPSADE 204

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS R   LV  E+C+ VA+ L L   I++ +           S+  DV E++I A++L
Sbjct: 205 GELSKRLADLVRKESCADVAKSLGLLDDIKLGAVGAGAGARLRKSVLGDVCEAVIGAIFL 264

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           DGG   A  FV++ W +R  K  +  RD KT LQEWA  K   TP Y+   R+GP HDP+
Sbjct: 265 DGGYAAAAGFVERNWTERMHKPRRPLRDPKTVLQEWAQGKGLPTPVYREVERTGPHHDPQ 324

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           F V V++ GL  A+G+  SKRAAE+VAA+ +++REG+
Sbjct: 325 FRVAVDLPGLESAEGVGGSKRAAEKVAASVMIEREGV 361


>gi|3176883|gb|AAD02939.1| RNase III [Bradyrhizobium japonicum]
          Length = 231

 Score =  189 bits (479), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 98/225 (43%), Positives = 142/225 (63%), Gaps = 3/225 (1%)

Query: 4   LRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ---ESYERLEFLGDRILGLLISTLLF 60
           +R   L +  G+ FA+ +LL + +TH S   S +   +SY+RLEFLGD +LGL++S +L+
Sbjct: 1   MRTRRLRRASGHTFADPNLLMQGITHVSALKSGRKRGDSYQRLEFLGDHVLGLVVSDMLY 60

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F +A EGELS R   LV  E+C+ VA+ L L   I++ S           S+  D+ E
Sbjct: 61  HAFPNADEGELSKRLAELVRKESCADVAKSLGLLDDIKLGSVGPSADARLRKSVLGDICE 120

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           ++I A++LDGG   A  FV + W +R  K  +  RD KT LQEWA  K   TP Y+   R
Sbjct: 121 AVIGAIFLDGGHAAAAEFVKRNWTERMHKPRRPLRDPKTVLQEWAQGKGLPTPVYREVER 180

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           +GP HDP+F V V++ GLAPA+G+  SKRAAE+VAA+ +++REG+
Sbjct: 181 TGPHHDPQFRVAVDLPGLAPAEGIGGSKRAAEKVAASVMIEREGV 225


>gi|296444865|ref|ZP_06886827.1| ribonuclease III [Methylosinus trichosporium OB3b]
 gi|296257533|gb|EFH04598.1| ribonuclease III [Methylosinus trichosporium OB3b]
          Length = 233

 Score =  187 bits (475), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 132/217 (60%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE  +G+ F NR LLE ALTH S S +  ESYERLEFLGDR+LG++++ LL+  F +  E
Sbjct: 12  LEASVGHGFVNRGLLEHALTHVSGSTARTESYERLEFLGDRVLGVVVAHLLYETFPAESE 71

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS R   LV  E+C++VA    +  F+R+     +       +I  D+ E++I A+YL
Sbjct: 72  GELSRRLADLVRKESCAEVAERWGVGPFMRLGDGEAQTGGRKKRAILGDMCEAIIGAVYL 131

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           DGG   A   V + +  R    G+  RDAKT LQEWA A+   TP Y++T RSGPDH P 
Sbjct: 132 DGGAAAAEAVVREAFGARMQTQGRRLRDAKTSLQEWAQARRLPTPCYRMTSRSGPDHAPF 191

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           F V V + G  PA+G   SKR AEQ AA   L REGI
Sbjct: 192 FKVEVVVEGFVPAEGGGASKRVAEQSAAQAFLDREGI 228


>gi|154247804|ref|YP_001418762.1| ribonuclease III [Xanthobacter autotrophicus Py2]
 gi|154161889|gb|ABS69105.1| Ribonuclease III [Xanthobacter autotrophicus Py2]
          Length = 236

 Score =  182 bits (462), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 100/223 (44%), Positives = 140/223 (62%), Gaps = 3/223 (1%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQE---SYERLEFLGDRILGLLISTLLFNHF 63
           +++E+RIGY F +RS+LE AL+H S          SY+R+EFLGD +LG ++S +L+  F
Sbjct: 9   ASVEERIGYRFRDRSILELALSHISAVKGEAPRLRSYQRMEFLGDHVLGSVVSHMLYLAF 68

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
              +EGELS R   LV  E C++VA+++DL  FIR+     +       +I ADV E ++
Sbjct: 69  PEGEEGELSRRLAELVREEACAEVAQDMDLGPFIRLGPGESQSGAHKRRAILADVAEGVV 128

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           AA++LDGG E A   V+++W+ R     +  RDAKT LQEWA A+    P Y+   RSGP
Sbjct: 129 AAVFLDGGYEAAHQVVERFWRPRLETPRRPLRDAKTVLQEWAQARGLPPPSYREVTRSGP 188

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           DH PRFTV V++ GLA  Q    SK+ A++ AAA  L REG+W
Sbjct: 189 DHAPRFTVAVDLPGLASEQADGASKQNAQKAAAAAFLVREGVW 231


>gi|182679393|ref|YP_001833539.1| ribonuclease III [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182635276|gb|ACB96050.1| Ribonuclease III [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 235

 Score =  181 bits (458), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 100/218 (45%), Positives = 135/218 (61%), Gaps = 2/218 (0%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSIS-HSYQESYERLEFLGDRILGLLISTLLFNHFDSAK 67
           LE RIG+ F    LL  ALTH S++  + +E+Y+RLEFLGDR+LGL+I+ +L+  F  A+
Sbjct: 11  LETRIGHRFVEADLLTTALTHVSVTVGARRETYQRLEFLGDRVLGLVIAEMLYATFPEAE 70

Query: 68  EGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALY 127
           EGELS R   LV  E+C++VA E  +  F+R+    R+ + +   +I  DV ES+I A++
Sbjct: 71  EGELSRRLADLVRKESCAEVALEWGVGPFVRLGESERQ-IGTTKKAILGDVCESIIGAVF 129

Query: 128 LDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDP 187
           LD G  VA   + K +  R     +  RDAKT LQEWA ++   TP Y+   R GPDH P
Sbjct: 130 LDAGYTVAQQVIVKAFDARMRSPRRPLRDAKTVLQEWAQSRGHPTPLYREICRCGPDHAP 189

Query: 188 RFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
            FT+ V I G A AQ    SKR AEQ AAA  ++REGI
Sbjct: 190 EFTISVCIPGYADAQAKGPSKRLAEQAAAAHFIEREGI 227


>gi|304321233|ref|YP_003854876.1| ribonuclease III [Parvularcula bermudensis HTCC2503]
 gi|303300135|gb|ADM09734.1| ribonuclease III [Parvularcula bermudensis HTCC2503]
          Length = 238

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 95/213 (44%), Positives = 126/213 (59%)

Query: 14  GYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELSV 73
           G+ F +RSLL +ALTH+S+S    +  ERLEFLGDR+LGLL + LL+  F    EGEL+ 
Sbjct: 22  GHRFDDRSLLARALTHASVSQDGLKDLERLEFLGDRVLGLLAADLLWRRFPDMAEGELAP 81

Query: 74  RFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIE 133
           R N+LV  ETC+  AR   L   +R+S+   +       +I  D  ESL+ A+Y+DGG+ 
Sbjct: 82  RLNALVRRETCADAARHWKLGEAVRMSAGEERTGGRNKDAILGDACESLLGAIYIDGGLG 141

Query: 134 VAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVVV 193
            A T  + YW  R  +      DAKT LQEWA  K   TP Y+   R GPDH P FTV V
Sbjct: 142 AAKTAFETYWTPRVEELIDDHADAKTALQEWAQEKGLGTPSYRDIDRDGPDHAPIFTVAV 201

Query: 194 EISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
            + GL  A+    +KR+A+  AA  +L REG+W
Sbjct: 202 VVQGLESAEARGPNKRSAQMQAARSILVREGVW 234


>gi|300023749|ref|YP_003756360.1| ribonuclease III [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525570|gb|ADJ24039.1| ribonuclease III [Hyphomicrobium denitrificans ATCC 51888]
          Length = 235

 Score =  180 bits (456), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 95/222 (42%), Positives = 134/222 (60%), Gaps = 2/222 (0%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESY--ERLEFLGDRILGLLISTLLFNH 62
           ++  LE ++G+ F +  LLE+ALTH+S+       +  ERLEF+GDR+LGL I+ +L   
Sbjct: 6   KFKELETKLGHRFKDPGLLERALTHASVRGGKIARFDNERLEFIGDRVLGLAIAEILNQQ 65

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           +  A EGEL+ R+N LV  E C++VAR + L + + +S           T+I AD  E+L
Sbjct: 66  YPEASEGELARRYNRLVRGEACAKVARNIGLGAHLILSESEADSGGRDKTTILADAAEAL 125

Query: 123 IAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           + A+++D G E A   V K W++++    +   DAK+ LQEWA  +    P+Y V  R G
Sbjct: 126 LGAVFIDVGFEKARAVVRKLWQEQSEPVPEVAVDAKSALQEWAQGQGLALPKYTVVSRKG 185

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           PDH PRFT  V I+G APAQG   SKR AEQ AA  +L REG
Sbjct: 186 PDHAPRFTAEVIIAGRAPAQGEGASKRIAEQAAATALLTREG 227


>gi|85716284|ref|ZP_01047258.1| ribonuclease III [Nitrobacter sp. Nb-311A]
 gi|85696956|gb|EAQ34840.1| ribonuclease III [Nitrobacter sp. Nb-311A]
          Length = 266

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 102/222 (45%), Positives = 138/222 (62%), Gaps = 3/222 (1%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSI---SHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           + +E+R+G+ FA+ SLL  A TH S    S    +SY+RLEFLGD +LGL+IS +L+  F
Sbjct: 44  AAIEQRLGHKFADISLLTTAFTHVSALKSSRGRSDSYQRLEFLGDHVLGLVISDMLYRAF 103

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             A EGELS R   LV  ETC  VAR LDL   +++ +           S+  D+ E++I
Sbjct: 104 PQADEGELSKRLADLVRKETCIDVARSLDLQEGVKLGAVGAGAGARLRRSVLGDICEAVI 163

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
            A+YLDGG  VA  FV++ W +R  K  +  RD KT LQEWA  K   TP Y+   R+GP
Sbjct: 164 GAVYLDGGYAVAAAFVERNWLERMRKPVRPLRDPKTVLQEWAQGKGLPTPVYREVERTGP 223

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
            HDPRF V VE+ GL  ++G+  SKRAAE+ AA+ ++ REG+
Sbjct: 224 HHDPRFRVAVELPGLEVSEGIGGSKRAAEKAAASAMIAREGV 265


>gi|217977175|ref|YP_002361322.1| Ribonuclease III [Methylocella silvestris BL2]
 gi|254807894|sp|B8EK13|RNC_METSB RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|217502551|gb|ACK49960.1| Ribonuclease III [Methylocella silvestris BL2]
          Length = 235

 Score =  178 bits (451), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 97/219 (44%), Positives = 135/219 (61%), Gaps = 1/219 (0%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           S LE RIG+ F+   L+E ALTH S +   + SY+RLEFLGDR+LG++++ +L+  F  A
Sbjct: 8   SALEARIGHRFSAADLIEAALTHVSAAQGKRVSYQRLEFLGDRVLGVVVANMLYGAFPDA 67

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EGELS R   LV  E+C++VA E  + +++RV    +++  S   +I  DV ES+I A+
Sbjct: 68  DEGELSRRLADLVRKESCAEVALEWGVEAYVRVGESEKQN-ASVNRAILGDVCESIIGAV 126

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           +LDGG   A   V + ++ R     +  RD KT LQEWA A+    P Y+ T R+GPDH 
Sbjct: 127 FLDGGFAPAQRVVTQAFEPRMRSPRRPLRDPKTTLQEWAQARGLPPPSYRETARTGPDHA 186

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           P FT+ VEI+G   A+    +KR AEQ AAA  L RE I
Sbjct: 187 PEFTISVEIAGFQQAEARGFAKRLAEQAAAAAFLTREKI 225


>gi|323137544|ref|ZP_08072621.1| ribonuclease III [Methylocystis sp. ATCC 49242]
 gi|322397170|gb|EFX99694.1| ribonuclease III [Methylocystis sp. ATCC 49242]
          Length = 234

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 98/219 (44%), Positives = 135/219 (61%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + LE+ +G+ FA++SLL  ALTH S S    ESYERLEFLGDR+LGL ++ +L+  F   
Sbjct: 9   AALEESVGHRFADQSLLRWALTHVSASSQRPESYERLEFLGDRVLGLAVAHMLYEAFPGE 68

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EGELS R  +LV  ETC++VA    +  ++R+     +       +I  DV E++I A+
Sbjct: 69  SEGELSRRLAALVRKETCAEVAEIWGVGPYMRLGEGEAQTGGRKKRAILGDVCEAIIGAV 128

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           +LDGG + AG  V   +  + L++G+  RDAKT LQEWA A+    P Y++  RSGPDH 
Sbjct: 129 FLDGGADAAGRVVRAGFGPKMLEAGRDLRDAKTALQEWAQARRLPPPRYRLIARSGPDHA 188

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           P F + V+I G   A G   SKR AEQ AAA  + REG+
Sbjct: 189 PSFEMAVDIEGFESAGGAGASKRVAEQAAAAAFMAREGV 227


>gi|92117774|ref|YP_577503.1| ribonuclease III [Nitrobacter hamburgensis X14]
 gi|91800668|gb|ABE63043.1| RNAse III [Nitrobacter hamburgensis X14]
          Length = 266

 Score =  175 bits (444), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 99/222 (44%), Positives = 137/222 (61%), Gaps = 3/222 (1%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSI---SHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           + +E+R+G+ FA+ SLL  A TH S    S    +SY+RLEFLGD +LGL++S +L+  F
Sbjct: 44  AAIEQRLGHKFADMSLLTTAFTHVSALKSSRGRSDSYQRLEFLGDHVLGLVVSDMLYRAF 103

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             A EGELS R   LV  ETC  VA+ LDL   I++ +           S+  D+ E++I
Sbjct: 104 PKADEGELSKRLAELVRKETCIDVAKSLDLQDGIKLGAVGAGAGARLRRSVLGDICEAVI 163

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
            A+YLDGG   A  FV++ W +R  K  +  RD KT LQEWA  +   TP Y+   R+GP
Sbjct: 164 GAVYLDGGYAAAAAFVERNWLERMRKPVRPLRDPKTVLQEWAQGQGLPTPVYREVERTGP 223

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
            HDPRF V VE+ GL  ++G+  SKRAAE+ AA+ ++ REG+
Sbjct: 224 HHDPRFRVAVELPGLEASEGIGGSKRAAEKAAASAMIAREGV 265


>gi|319784504|ref|YP_004143980.1| ribonuclease III [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317170392|gb|ADV13930.1| ribonuclease III [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 251

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 97/218 (44%), Positives = 136/218 (62%), Gaps = 1/218 (0%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           ++ + GY F +  LLE ALTHSS   +   + +RLEFLGDR+LGL+++ +LF  F  A E
Sbjct: 15  VKAKTGYVFKDIRLLETALTHSSAVKAATNN-QRLEFLGDRVLGLVVADMLFEKFPDAPE 73

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GE++ RFN+LV A TCS++  E+ L   +R  S L+        +  AD VE+LIAA+Y+
Sbjct: 74  GEIAPRFNALVDARTCSEIGIEMQLEDLVRADSALKMRSRGSGGNYLADAVEALIAAVYV 133

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           DGGIE A  FV +YW+ R+        + K++LQEW      + PEY +  R GPDH P 
Sbjct: 134 DGGIEAARRFVLRYWEPRSHTVIAKPLNPKSDLQEWIAKTSDIRPEYVIDKREGPDHQPV 193

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           FTV +++ G AP  G   S+RAAE+ AA+  L REG+W
Sbjct: 194 FTVSLQVRGFAPISGTGGSRRAAEEAAASAFLVREGVW 231


>gi|163744855|ref|ZP_02152215.1| ribonuclease III [Oceanibulbus indolifex HEL-45]
 gi|161381673|gb|EDQ06082.1| ribonuclease III [Oceanibulbus indolifex HEL-45]
          Length = 228

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 133/216 (61%), Gaps = 6/216 (2%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           E RIG++FA   LL +A+TH+S+S + ++  +RLEFLGDR+LGL+++  L      A EG
Sbjct: 11  EARIGHSFAKPELLVRAVTHASMSSANRDDNQRLEFLGDRVLGLVMAEALLALDPGATEG 70

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA---DVVESLIAAL 126
           +L+ RFN+LV  ETC+ VARE+DL   +++    R ++ S     QA   D +E++IAA+
Sbjct: 71  QLAPRFNALVRKETCADVAREIDLGKVLKLG---RSEMISGGRRKQALLGDAIEAVIAAV 127

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           YLD G E A   V + W  R     +  RDAKT LQEWA A+  + P Y  T RSGPDH 
Sbjct: 128 YLDSGFEAAKGLVLRLWGDRLKTVKEDARDAKTALQEWAQARGLMPPRYVQTDRSGPDHA 187

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           P FT+   +   A A     SKRAAEQ AA  +L++
Sbjct: 188 PVFTITARLDNGAEAAATAPSKRAAEQAAATTLLRQ 223


>gi|83855027|ref|ZP_00948557.1| Ribonuclease III [Sulfitobacter sp. NAS-14.1]
 gi|83941550|ref|ZP_00954012.1| Ribonuclease III [Sulfitobacter sp. EE-36]
 gi|83842870|gb|EAP82037.1| Ribonuclease III [Sulfitobacter sp. NAS-14.1]
 gi|83847370|gb|EAP85245.1| Ribonuclease III [Sulfitobacter sp. EE-36]
          Length = 228

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 132/214 (61%), Gaps = 6/214 (2%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           E RIGY FA   LL +A+TH+S+S + ++  +RLEFLGDR+LGL+++  L     +A EG
Sbjct: 11  EGRIGYHFAKPELLNRAVTHASMSSANRDDNQRLEFLGDRVLGLVMAEALLKLDPAATEG 70

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA---DVVESLIAAL 126
           +L+ RFN+LV  E C++VARE+D+ + +++    R ++ S     QA   D +E++IAA+
Sbjct: 71  QLAPRFNALVRKEACAEVAREIDMGAVLKLG---RSEMLSGGRRKQALLGDAIEAIIAAV 127

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           YLDGG + A   + + W  R ++  +  RDAKT LQEWA A+    P Y  T R GPDH 
Sbjct: 128 YLDGGFDEAKALILRLWGDRVMQVKQDARDAKTALQEWAQARGLPPPAYVQTDRQGPDHA 187

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
           P FT+   I   A A     SKR AEQ AA  +L
Sbjct: 188 PVFTITARIENGASAVASAPSKRQAEQAAAKTLL 221


>gi|83858196|ref|ZP_00951718.1| ribonuclease III [Oceanicaulis alexandrii HTCC2633]
 gi|83853019|gb|EAP90871.1| ribonuclease III [Oceanicaulis alexandrii HTCC2633]
          Length = 228

 Score =  175 bits (443), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 95/221 (42%), Positives = 133/221 (60%), Gaps = 2/221 (0%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSS--ISHSYQESYERLEFLGDRILGLLISTLLFNH 62
           R    E RI Y F +R LLE+ALTH+S     S   S ERLEFLGDR+LGL+ S  L+  
Sbjct: 4   RIKDFEARINYRFKDRELLERALTHASHGDGRSRAASNERLEFLGDRVLGLMASQRLYET 63

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           F + +EG L+ R N++V+   C++ AR  DL   +R+S+   +       SI AD  E++
Sbjct: 64  FPNLEEGGLAQRLNAVVNKSACARAARRCDLGEGLRLSAAEERLGGREKESIIADACEAV 123

Query: 123 IAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           I ALYLDGG++ A  F   +W     +  +  +DAK++LQEWA  K    P Y+   R G
Sbjct: 124 IGALYLDGGLDAAWAFFTTFWADEIDQLTRRPKDAKSQLQEWAAQKGYGVPVYETVARKG 183

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKRE 223
           PDH P F + V + G+APA+G   SK+ A++ AA+E+LKRE
Sbjct: 184 PDHRPVFEIEVRLDGVAPARGEGGSKQDAQRAAASEMLKRE 224


>gi|154253314|ref|YP_001414138.1| ribonuclease III [Parvibaculum lavamentivorans DS-1]
 gi|154157264|gb|ABS64481.1| Ribonuclease III [Parvibaculum lavamentivorans DS-1]
          Length = 226

 Score =  175 bits (443), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 92/220 (41%), Positives = 129/220 (58%), Gaps = 3/220 (1%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L+ R+ + F +  LL +ALTH S   +   +Y+R EFLGDR+LGL+I+  L   F  A
Sbjct: 6   AALQVRLAHDFKDLGLLSRALTHPSADGA---NYQRFEFLGDRVLGLVIADWLLRDFPQA 62

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EGEL++R+N+LV  E C++VA  + L + I + +   K       +I AD  E++IAAL
Sbjct: 63  DEGELAIRYNALVRKEACAEVAERIGLGACITMGAGEEKAGGRRKPAILADACEAVIAAL 122

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           Y DGG++ A  F++  W     KS +  +DAKT LQEWA A+    P Y +  RSGPDH 
Sbjct: 123 YTDGGLQAARRFIETEWAYLVEKSSEIPQDAKTALQEWAQARGQGVPTYTLVGRSGPDHA 182

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           P FTV V      P +    SKR AEQ AA  +L+  G+W
Sbjct: 183 PEFTVEVSAGKAKPLRAQGNSKRQAEQTAARALLEALGVW 222


>gi|75676109|ref|YP_318530.1| ribonuclease III [Nitrobacter winogradskyi Nb-255]
 gi|90101631|sp|Q3SRB3|RNC_NITWN RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|74420979|gb|ABA05178.1| RNAse III [Nitrobacter winogradskyi Nb-255]
          Length = 266

 Score =  174 bits (442), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 99/222 (44%), Positives = 138/222 (62%), Gaps = 3/222 (1%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQ---ESYERLEFLGDRILGLLISTLLFNHF 63
           + +E+R+G+ FA+ SLL  A TH S   S +   +SY+RLEFLGD +LGL++S +L+  F
Sbjct: 44  AAIEQRLGHTFADISLLTTAFTHVSALKSSRGRCDSYQRLEFLGDHVLGLVVSDMLYRAF 103

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             A EGELS R   LV  ETC  VA+ LDL   +++ +           S+  D+ E++I
Sbjct: 104 PKADEGELSKRLADLVRKETCIDVAKSLDLQEGVKLGAVGAGAGARLRRSVLGDICEAVI 163

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
            A+YLDGG   A  FV++ W +R  K  +  RD KT LQEWA  K   TP Y+   R+GP
Sbjct: 164 GAVYLDGGYAAAAAFVERNWLERMRKPVRPLRDPKTVLQEWAQGKGLPTPVYREVERTGP 223

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
            HDPRF V VE+ GL  ++G+  SKRAAE+ AA+ ++ REG+
Sbjct: 224 HHDPRFRVAVELPGLESSEGIGGSKRAAEKAAASAMIVREGV 265


>gi|170749855|ref|YP_001756115.1| ribonuclease III [Methylobacterium radiotolerans JCM 2831]
 gi|170656377|gb|ACB25432.1| Ribonuclease III [Methylobacterium radiotolerans JCM 2831]
          Length = 259

 Score =  174 bits (441), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 90/219 (41%), Positives = 131/219 (59%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + LE+RIG++F ++ LL +ALTH+S +     SY+RLEFLGDR+LGL ++  L+  F  A
Sbjct: 29  TALEERIGHSFGDQDLLTRALTHTSKASGRGGSYQRLEFLGDRVLGLAVADRLYGAFPEA 88

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG+LS R  +LV  ETC+ VA   ++   + +             +I ADV E+++ A+
Sbjct: 89  DEGDLSRRLAALVRRETCAAVAASWEVGPHLILGQGEVMGGGRRNQTILADVCEAILGAI 148

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           YLD G + A   V+ +++     +    RDAK+ LQEWA  +    P Y V  R+GPDH 
Sbjct: 149 YLDAGFDAARAVVETHFRPGEPTAAARGRDAKSALQEWAMGRSLPIPTYAVVERTGPDHA 208

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           PRF + V++ GL P  G   SKR AEQ AA  +++REGI
Sbjct: 209 PRFRIAVQVEGLEPGLGDGTSKRIAEQAAARALMEREGI 247


>gi|254463926|ref|ZP_05077337.1| ribonuclease III [Rhodobacterales bacterium Y4I]
 gi|206684834|gb|EDZ45316.1| ribonuclease III [Rhodobacterales bacterium Y4I]
          Length = 225

 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 93/218 (42%), Positives = 134/218 (61%), Gaps = 6/218 (2%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           E+RIG+ FA   LL++A+TH+S+S S ++  +RLEFLGDR+LGL+++T L  H  +A EG
Sbjct: 11  EERIGHKFARPELLQRAVTHASVSSSNRKDNQRLEFLGDRVLGLVMATALLEHDKTATEG 70

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA---DVVESLIAAL 126
           +L+ RFN+LV  E C+ VA+E+DL + +++    R ++ S     QA   D +E++IAA+
Sbjct: 71  QLAPRFNALVRKEACADVAKEIDLGAVLKLG---RSEMMSGGRRKQALLGDAMEAVIAAV 127

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           Y D G + A   + + W  R  +     RDAKT LQEWA A+    P Y    RSGPDH 
Sbjct: 128 YKDAGFDAAAEMILRLWGTRIHQVETDARDAKTSLQEWAQARGQQVPIYVEVSRSGPDHA 187

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           P FT+   +     AQ    SKR AEQ AA  +L++ G
Sbjct: 188 PVFTIAARLQDGTEAQATAGSKRQAEQAAAKALLEQLG 225


>gi|299135102|ref|ZP_07028293.1| ribonuclease III [Afipia sp. 1NLS2]
 gi|298590079|gb|EFI50283.1| ribonuclease III [Afipia sp. 1NLS2]
          Length = 282

 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 100/220 (45%), Positives = 136/220 (61%), Gaps = 3/220 (1%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSI---SHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           +E+RIG+ F N +LL+ ALTH S    S S  +SY+RLEFLGD +LGL++S +L+  F  
Sbjct: 57  IEQRIGHTFKNPALLKTALTHVSALKSSQSRTDSYQRLEFLGDHVLGLIVSDMLYGAFPK 116

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
           A EGE+S R   LV  E C  VA+ L L   I++ +           SI  D+ E++I A
Sbjct: 117 ADEGEMSKRLADLVRKEACVDVAKSLGLHENIKLGTVGAGVGARLRNSIVGDICEAVIGA 176

Query: 126 LYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           ++LDGG   A  FV + W +R  +  +  RD KT LQEWA  K   TP Y+   R+GP H
Sbjct: 177 IFLDGGYGAAEQFVLRNWTERMRRPVRPLRDPKTVLQEWAQGKGLPTPVYREVERTGPHH 236

Query: 186 DPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           DPRF V V++ GLA A+G+  SKRAAE+ AA+ +L REG+
Sbjct: 237 DPRFRVAVDLPGLASAEGIGSSKRAAEKAAASALLSREGV 276


>gi|209884975|ref|YP_002288832.1| ribonuclease III [Oligotropha carboxidovorans OM5]
 gi|209873171|gb|ACI92967.1| ribonuclease III [Oligotropha carboxidovorans OM5]
          Length = 288

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 99/220 (45%), Positives = 136/220 (61%), Gaps = 3/220 (1%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSI---SHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           +E+RIG+ F N +LL+ ALTH S    S +  +SY+RLEFLGD +LGL++S +L+  F  
Sbjct: 63  IEQRIGHTFKNPNLLKTALTHVSALKPSQNRTDSYQRLEFLGDHVLGLIVSDMLYGAFPK 122

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
           A EGE+S R   LV  E C  VA+ L L   I++ +           SI  D+ E++I A
Sbjct: 123 ADEGEMSKRLADLVRKEACVDVAKSLGLHENIKLGTVGAGVGARLRNSIVGDICEAVIGA 182

Query: 126 LYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           ++LDGG + A  FV   W +R  +  +  RD KT LQEWA  K   TP Y+   R+GP H
Sbjct: 183 IFLDGGYDAAEQFVLSNWTERMRRPVRPLRDPKTILQEWAQGKGLPTPVYREVERTGPHH 242

Query: 186 DPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           DPRF V V++ GLA A+G+  SKRAAE+ AA+ +L REG+
Sbjct: 243 DPRFRVAVDLPGLASAEGIGSSKRAAEKAAASALLNREGV 282


>gi|56698030|ref|YP_168401.1| ribonuclease III [Ruegeria pomeroyi DSS-3]
 gi|81349082|sp|Q5LNK5|RNC_SILPO RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|56679767|gb|AAV96433.1| ribonuclease III [Ruegeria pomeroyi DSS-3]
          Length = 225

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 90/211 (42%), Positives = 129/211 (61%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           E R+GY+F    LL +ALTH SIS S ++  +RLEFLGDR+LGL+++T L      A EG
Sbjct: 11  EARLGYSFERPELLVRALTHGSISSSTRQDNQRLEFLGDRVLGLVMATALLEADKDATEG 70

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLD 129
           +L+ RFN+LV  ETC++VARE DL + +++             ++  D +E++IAA+Y D
Sbjct: 71  QLAPRFNALVRKETCAEVAREADLGAVLKLGRSEMMSGGRRKLALLGDAMEAVIAAVYRD 130

Query: 130 GGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
           GG   A   + + W  R  +     RDAKT LQEWA A+    P Y++  RSGPDH P F
Sbjct: 131 GGFAAAEAVILRLWGARVHQVEADARDAKTALQEWAQARGQTPPRYELVKRSGPDHAPVF 190

Query: 190 TVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
           T++ E++    A+    +KR AEQ AA ++L
Sbjct: 191 TILAELADGRRAEATAGAKRQAEQAAARKLL 221


>gi|170744647|ref|YP_001773302.1| ribonuclease III [Methylobacterium sp. 4-46]
 gi|168198921|gb|ACA20868.1| Ribonuclease III [Methylobacterium sp. 4-46]
          Length = 244

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 91/220 (41%), Positives = 132/220 (60%), Gaps = 1/220 (0%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           S LE RIG+AF ++ LL +ALTH S + + +ESY+RLEFLGDR+LGL ++  L      A
Sbjct: 17  SALEGRIGHAFDDKDLLARALTHVS-AGAGEESYQRLEFLGDRVLGLAVAEGLLRALPGA 75

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG+LS R + LV  E+C+ VA+  ++   +R+ +           +I ADV E+++ A+
Sbjct: 76  DEGDLSRRLSGLVRRESCAAVAQAWEVGPHLRLGAGEVHGGGRRNPAILADVCEAILGAI 135

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           +LD G   A   +D+ +       G   RD K+ LQEWA      TP Y V  R+GPDH 
Sbjct: 136 FLDAGYAAAKAVIDRAFAAAEEAEGPRGRDPKSALQEWAQGLGLPTPTYAVVERAGPDHA 195

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           P F +   ++G+AP+ G+  SKR AEQ AA  +L+REG+W
Sbjct: 196 PIFRIEARVAGVAPSLGVGGSKRLAEQEAARLLLRREGVW 235


>gi|260425711|ref|ZP_05779691.1| ribonuclease III [Citreicella sp. SE45]
 gi|260423651|gb|EEX16901.1| ribonuclease III [Citreicella sp. SE45]
          Length = 227

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 90/216 (41%), Positives = 130/216 (60%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + LE+R+G+ FA+   L +ALTHSS+S   +E  +RLEFLGDR+LGL+++  L +    A
Sbjct: 8   AALEQRLGHRFADPERLRRALTHSSMSAPGREDNQRLEFLGDRVLGLVMAEALLSEDRGA 67

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG+L+ RFN+LV  E C++VARE+DL + +++             ++  D +E++IAA+
Sbjct: 68  SEGQLAPRFNALVRKEACAEVAREIDLGAALKLGRSEMMSGGRRKMALLGDAMEAVIAAV 127

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           YLD G   A   V + W  R  +  +  RDAKT LQEWA A+  V P Y    R GPDH 
Sbjct: 128 YLDAGFGTAKALVLRLWGDRIARVEEDARDAKTSLQEWAQARGMVPPSYTEVAREGPDHA 187

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           P FT+   +   A A+    SKR AEQ AA+ +L +
Sbjct: 188 PVFTIEARLENGAAARATAGSKRKAEQQAASGLLDK 223


>gi|83951643|ref|ZP_00960375.1| ribonuclease III [Roseovarius nubinhibens ISM]
 gi|83836649|gb|EAP75946.1| ribonuclease III [Roseovarius nubinhibens ISM]
          Length = 227

 Score =  171 bits (433), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 95/212 (44%), Positives = 127/212 (59%), Gaps = 6/212 (2%)

Query: 12  RIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGEL 71
           R+G+ F   +LL +ALTHSS+S   ++  +RLEFLGDR+LGL++S  L  H   A EG L
Sbjct: 13  RLGHEFQTPALLVQALTHSSMSTPNRDDNQRLEFLGDRVLGLVMSEALLEHDRKAAEGTL 72

Query: 72  SVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA---DVVESLIAALYL 128
           + RFN+LV  ETC+ VAR++DL + +++    R ++ S     QA   D +E++IAA+YL
Sbjct: 73  APRFNALVRKETCADVARQIDLGAVLKLG---RSEMLSGGRRKQALLGDAMEAVIAAVYL 129

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           D G E A T V   W  R  +     RDAKT LQEWA A+    P Y+   RSGPDH P 
Sbjct: 130 DAGFETARTVVLALWGDRITRVEADARDAKTALQEWAQARGLAPPRYEEVARSGPDHAPE 189

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
           FT+V  +     A     SKR AEQ AA  +L
Sbjct: 190 FTIVARLETGEEAASKAGSKRQAEQAAAKALL 221


>gi|298291621|ref|YP_003693560.1| ribonuclease III [Starkeya novella DSM 506]
 gi|296928132|gb|ADH88941.1| ribonuclease III [Starkeya novella DSM 506]
          Length = 243

 Score =  170 bits (431), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 121/195 (62%), Gaps = 6/195 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTH-SSI-----SHSYQESYERLEFLGDRILGLLISTLLFNH 62
           LE  +G+ FA+R+ L  ALTH SS+     S +   SY+RLEFLGD +LGL++S +L+  
Sbjct: 21  LEAALGHRFASRAHLRLALTHISSVTGAQGSQARVRSYQRLEFLGDHVLGLVVSDMLYRA 80

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           + +A+EGELS R   LV  E C++VAR +DL  +IR+     +       +I ADV E++
Sbjct: 81  YPNAEEGELSRRLADLVCEEACAEVARAMDLGPYIRLGPGEDRTGGRERPAILADVAEAV 140

Query: 123 IAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           +AA+YLD G E A   V+K+W+ R    G   RD KT LQEWA  +    P Y++  RSG
Sbjct: 141 LAAVYLDAGFEAAEAMVEKFWRPRLSTPGSSARDPKTALQEWAQGRGLPPPHYRLVERSG 200

Query: 183 PDHDPRFTVVVEISG 197
           PDH+P F + VE+ G
Sbjct: 201 PDHNPEFRIAVELPG 215


>gi|329850746|ref|ZP_08265591.1| ribonuclease III [Asticcacaulis biprosthecum C19]
 gi|328841061|gb|EGF90632.1| ribonuclease III [Asticcacaulis biprosthecum C19]
          Length = 236

 Score =  169 bits (429), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 92/219 (42%), Positives = 133/219 (60%), Gaps = 3/219 (1%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSISHSYQE--SYERLEFLGDRILGLLISTLLFNHFDS 65
           T++ R+GY F ++ LLE ALTH+S++   +     ERLEFLGDR+LGL+I+  L ++F  
Sbjct: 15  TVQDRLGYRFRDKQLLEVALTHASVAEGARRIADNERLEFLGDRVLGLMIAEALMDNFPE 74

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
           A+EGELS RF++LVS E C+ +AR+L L   +R+++   K       +I  D  E+L+AA
Sbjct: 75  AEEGELSRRFHALVSREACADIARQLSLGEAVRLAAGETKSGGRSNPTILGDACEALMAA 134

Query: 126 LYLDGGIEVAGTFVDKYWKQRALKSGKF-RRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           +Y+DGG +         W+Q  L SG   R + K+ LQEWA A     P Y +  R GPD
Sbjct: 135 VYVDGGYDAVVKSFAPLWQQLLLDSGNASRSNPKSFLQEWAVANAKRPPAYNLIERRGPD 194

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKRE 223
           H P FT+ V I GL P      S++ AE+ AA  +++RE
Sbjct: 195 HAPVFTMEVVIDGLQPQSATGKSRQEAEKTAALALIERE 233


>gi|294011699|ref|YP_003545159.1| ribonuclease III [Sphingobium japonicum UT26S]
 gi|292675029|dbj|BAI96547.1| ribonuclease III [Sphingobium japonicum UT26S]
          Length = 237

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 92/214 (42%), Positives = 127/214 (59%), Gaps = 3/214 (1%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L+  IG+A  +R+   +ALTH S   ++  +YERLEFLGDRILGLLI+  +++ F    E
Sbjct: 24  LKALIGHAPKDRTAFHQALTHGS---AHAVNYERLEFLGDRILGLLIAEWVYDRFSGEPE 80

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS RFN+LVS ETC++VAR   + + + +    R D  +   ++  DV+E+LI ALYL
Sbjct: 81  GKLSRRFNALVSGETCAEVARGAGVPAHLILGKQARDDGAADSDNVLGDVMEALIGALYL 140

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           +GG+E A T V + W  R        +  K+ LQEWA A     PEY +T RSGP H  +
Sbjct: 141 EGGLEEARTLVRRLWADRVDTQASAPKHPKSALQEWAAANKRKPPEYAMTDRSGPHHALK 200

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           FTV V I G   A     SK+ AE  AA  +L +
Sbjct: 201 FTVTVSIKGAGEASATGGSKQEAETAAAKALLDK 234


>gi|254418789|ref|ZP_05032513.1| ribonuclease III [Brevundimonas sp. BAL3]
 gi|196184966|gb|EDX79942.1| ribonuclease III [Brevundimonas sp. BAL3]
          Length = 236

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 93/236 (39%), Positives = 140/236 (59%), Gaps = 12/236 (5%)

Query: 1   MSALR---YSTLEKRIGYAFANRSLLEKALTHSSIS-------HSYQESYERLEFLGDRI 50
           M+ LR    + L+ RIG+AF + +LLE+ALTH+S+        H  +++ ERLEFLGDR+
Sbjct: 1   MANLRAEAVAALQTRIGHAFRDAALLERALTHASVGEGAPVGVHGPRDN-ERLEFLGDRV 59

Query: 51  LGLLISTLLFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSF 110
           LGLL++  L   + +A EG+LS   ++LV    C++V   L + + +R+S    K     
Sbjct: 60  LGLLVAEKLSRDYPTANEGQLSSSLHALVDKTACARVGEALGVGAALRLSPGETKTGGRR 119

Query: 111 MTSIQADVVESLIAALYLDGGIEVAGTFVDKYWKQR-ALKSGKFRRDAKTELQEWAHAKF 169
              + AD VE+++AA+YLDGG+E A  F DK W +  +    +   + K+ LQEWA AK 
Sbjct: 120 KAGVIADAVEAILAAVYLDGGLEAARAFFDKAWAEEFSAPPSRTVTNPKSALQEWAQAKG 179

Query: 170 GVTPEYKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
              P Y+V  R+G DH P FT+ V + G+ P      S++ AE+ AA  +LKREG+
Sbjct: 180 RPLPTYRVADRTGSDHAPTFTIEVSVEGVEPLTAQGRSRQEAEKAAATALLKREGV 235


>gi|163738238|ref|ZP_02145654.1| 4'-phosphopantetheinyl transferase [Phaeobacter gallaeciensis
           BS107]
 gi|161388854|gb|EDQ13207.1| 4'-phosphopantetheinyl transferase [Phaeobacter gallaeciensis
           BS107]
          Length = 228

 Score =  168 bits (425), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 130/213 (61%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           E RIGY+F+  +LL +ALTH+S+S   ++  +RLEFLGDR+LGL+++T L +   +A EG
Sbjct: 11  ETRIGYSFSQPALLVRALTHASVSSPNRQDNQRLEFLGDRVLGLVMATALLDTDKAATEG 70

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLD 129
           +L+ RFN+LV  ETC+ VAR++DL + +++             ++  D +E++IAA+Y D
Sbjct: 71  QLAPRFNALVRKETCADVARDIDLGAVLKLGRSETMSGGRRKLALLGDAMEAVIAAVYKD 130

Query: 130 GGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
           GG + A   + + W  R  +     RD KT LQE+A A+    P Y +  R+GPDH P F
Sbjct: 131 GGFDAAQELILRLWGNRIGRVEADARDPKTTLQEFAQARGEQPPAYVLVERTGPDHQPEF 190

Query: 190 TVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           T+ V++      +    SKR AEQ AA  +L R
Sbjct: 191 TISVQLQDGTEGRATAGSKRQAEQAAAKFLLAR 223


>gi|94497606|ref|ZP_01304175.1| ribonuclease III [Sphingomonas sp. SKA58]
 gi|94423023|gb|EAT08055.1| ribonuclease III [Sphingomonas sp. SKA58]
          Length = 227

 Score =  167 bits (424), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 124/214 (57%), Gaps = 3/214 (1%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L+  IG A  NR+  E+ALTH S   +   +YERLEFLGDRILGLLI   +F+ F    E
Sbjct: 14  LKDLIGRAPHNRATFEQALTHGS---AKPVNYERLEFLGDRILGLLIGEWVFDRFADEPE 70

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS R+N+LVS ETC+ +AR   +   + +    R D  +   ++  DV+E+LI ALYL
Sbjct: 71  GKLSRRYNALVSGETCADIARTAGVPKHLILGKQARDDGAADSDNVLGDVMEALIGALYL 130

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           +GG++ A   V + W  R        R  K+ LQEWA A     PEY++T RSGP H  R
Sbjct: 131 EGGLDEARALVRRLWGNRVDTQTSAPRHPKSALQEWAAANRRKPPEYQMTDRSGPQHALR 190

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           FTV V I G   A     SK+ AE  AA  +L++
Sbjct: 191 FTVAVSIKGAGEASATGASKQEAETAAAKALLEK 224


>gi|163740176|ref|ZP_02147570.1| ribonuclease III [Phaeobacter gallaeciensis 2.10]
 gi|161386034|gb|EDQ10409.1| ribonuclease III [Phaeobacter gallaeciensis 2.10]
          Length = 228

 Score =  167 bits (423), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 129/213 (60%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           E RIGY+F+  +LL +ALTH+S+S   ++  +RLEFLGDR+LGL+++T L +   +A EG
Sbjct: 11  ETRIGYSFSQPALLVRALTHASVSSPNRQDNQRLEFLGDRVLGLVMATALLDTDKAATEG 70

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLD 129
           +L+ RFN+LV  ETC+ VAR++DL + +++             ++  D +E++IAA+Y D
Sbjct: 71  QLAPRFNALVRKETCADVARDIDLGAVLKLGRSETMSGGRRKLALLGDAMEAVIAAVYKD 130

Query: 130 GGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
           GG + A   + + W  R  +     RD KT LQE+A A+    P Y +  R GPDH P F
Sbjct: 131 GGFDAAQELILRLWGNRIGRVEADARDPKTTLQEFAQARGEQPPAYVLVERKGPDHQPEF 190

Query: 190 TVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           T+ V++      +    SKR AEQ AA  +L R
Sbjct: 191 TISVQLQDGTEGRATAGSKRQAEQAAAKFLLAR 223


>gi|148553136|ref|YP_001260718.1| RNAse III [Sphingomonas wittichii RW1]
 gi|148498326|gb|ABQ66580.1| RNAse III [Sphingomonas wittichii RW1]
          Length = 234

 Score =  167 bits (422), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 89/210 (42%), Positives = 123/210 (58%), Gaps = 3/210 (1%)

Query: 13  IGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELS 72
           +G+   + +L E+ALTH S   ++   YERLEFLGDR+LGL+    LF  F    EG+LS
Sbjct: 26  LGHEPRDLALFERALTHGSYGPNH---YERLEFLGDRVLGLVAGAWLFELFPDEPEGKLS 82

Query: 73  VRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGI 132
            R N++VS ETC+ V R + +A+ +++    R D      ++  DVVE+LI ALYL+GG+
Sbjct: 83  RRLNAIVSRETCADVGRAIGVATHMKLGKQARDDGAVQSDNVLGDVVEALIGALYLEGGL 142

Query: 133 EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVV 192
           + A  FV + W  RA    +  +  K+ LQEWA A     P Y +  RSGP H PRFTV 
Sbjct: 143 DAAQAFVRRAWDDRATGQAQAPKHPKSALQEWAAAHRCKPPVYTMGNRSGPHHAPRFTVT 202

Query: 193 VEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           V I G A A     SK+ AE  AA  +L++
Sbjct: 203 VAIPGRAEASAEGSSKQEAETAAAKALLEK 232


>gi|254474637|ref|ZP_05088023.1| ribonuclease III [Ruegeria sp. R11]
 gi|214028880|gb|EEB69715.1| ribonuclease III [Ruegeria sp. R11]
          Length = 222

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 126/213 (59%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           E RIGY F   +LL +ALTH+S+S   ++  +RLEFLGDR+LGL+++T L      A EG
Sbjct: 5   EARIGYQFTEPALLVRALTHASVSSPNRKDNQRLEFLGDRVLGLVMATALLETDKDASEG 64

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLD 129
           +L+ RFN+LV  ETC+ VAR++D+ S +++             ++  D +E++IAA+Y D
Sbjct: 65  QLAPRFNALVRKETCADVARQIDVGSVLKLGRSETLSGGRRKMALLGDAMEAVIAAVYKD 124

Query: 130 GGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
           GG + A   + + W  R  +     RDAKT LQE+A A+    P Y +  R GPDH P F
Sbjct: 125 GGFDAAQELILRLWGDRIGRVEADARDAKTTLQEFAQARGEQPPTYVLVERKGPDHQPEF 184

Query: 190 TVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           T+ V++      +    SKR AEQ AA  +L R
Sbjct: 185 TISVQLQDGTEGRATAGSKRQAEQAAAKSLLAR 217


>gi|126733741|ref|ZP_01749488.1| ribonuclease III [Roseobacter sp. CCS2]
 gi|126716607|gb|EBA13471.1| ribonuclease III [Roseobacter sp. CCS2]
          Length = 226

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 85/216 (39%), Positives = 129/216 (59%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           +   +R+G++F    +L +A+THSSI   +++  +RLEFLGDR+LGL+++  L     SA
Sbjct: 8   TAFSQRLGHSFDKPEILIRAVTHSSIVSPHRDDNQRLEFLGDRVLGLVMAEALLKADPSA 67

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG L+ R+N+LV  E C++VAR++DL + +++     K       ++ AD +E++IAA+
Sbjct: 68  PEGLLAPRYNALVRREACAEVARQIDLGAVLKLGRSEMKSGGRRKEALLADAMEAVIAAV 127

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           Y DGG + A   + + W  R        RDAKT LQEWA A+  V P+Y    R+GPDH 
Sbjct: 128 YQDGGFDAARAAILRLWGDRIHNVAADARDAKTALQEWAQARGEVPPQYVEVARTGPDHQ 187

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           P FT+   ++     Q    SKR AEQ AA  +LK+
Sbjct: 188 PVFTIEARLASGPSEQATAGSKRQAEQAAATALLKK 223


>gi|114765524|ref|ZP_01444632.1| Ribonuclease III [Pelagibaca bermudensis HTCC2601]
 gi|114542117|gb|EAU45149.1| Ribonuclease III [Roseovarius sp. HTCC2601]
          Length = 227

 Score =  166 bits (419), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 86/201 (42%), Positives = 121/201 (60%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE+R+G+ F    LL +ALTHSS+S   +E  +RLEFLGDR+LGL+++  L     +A E
Sbjct: 10  LEERLGHRFDRPELLRRALTHSSMSAPGREDNQRLEFLGDRVLGLVMAEALLADDRNASE 69

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+L+ R+N+LV  ETC+ VARE+DL + +++             ++  D +E++IAA+YL
Sbjct: 70  GQLAPRYNALVRKETCADVAREVDLGAALKLGRSEMMSGGRRKMALLGDAMEAVIAAVYL 129

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           D G E A   V + W  R  +  +  RDAKT LQEWA A+    P Y  T RSGPDH P 
Sbjct: 130 DAGFEAAKDLVRRLWGDRVTRVDEDARDAKTSLQEWAQARGMPPPAYVETARSGPDHAPV 189

Query: 189 FTVVVEISGLAPAQGMDCSKR 209
           FT+   +S    AQ    +KR
Sbjct: 190 FTIEARLSSGETAQATAGAKR 210


>gi|254486436|ref|ZP_05099641.1| ribonuclease III [Roseobacter sp. GAI101]
 gi|214043305|gb|EEB83943.1| ribonuclease III [Roseobacter sp. GAI101]
          Length = 228

 Score =  165 bits (417), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 87/208 (41%), Positives = 126/208 (60%), Gaps = 6/208 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
            E RIGY F+   LL +A+TH+S+S + ++  +RLEFLGDR+LGL+++  L      A E
Sbjct: 10  FEGRIGYKFSKPELLIRAVTHASMSSANRDDNQRLEFLGDRVLGLVMAEALLMLDPKATE 69

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA---DVVESLIAA 125
           G+L+ RFN+LV  E C+ VARE+D+ + +++    R ++ S     QA   D +E++IAA
Sbjct: 70  GQLAPRFNALVRKEACADVAREIDMGAVLKLG---RSEMLSGGRRKQALLGDAIEAIIAA 126

Query: 126 LYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           +Y+DGG + A   + + W  R     +  RDAKT LQEWA A+    P Y  T R GPDH
Sbjct: 127 VYMDGGFDAARDLIIRLWGDRVQTVKQDARDAKTALQEWAQARGFPPPSYVQTDRQGPDH 186

Query: 186 DPRFTVVVEISGLAPAQGMDCSKRAAEQ 213
            P FT+  ++   A A  +  SKR AEQ
Sbjct: 187 APVFTITAKVQNGASAVAVAPSKRQAEQ 214


>gi|89053013|ref|YP_508464.1| ribonuclease III [Jannaschia sp. CCS1]
 gi|122499604|sp|Q28V23|RNC_JANSC RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|88862562|gb|ABD53439.1| RNAse III [Jannaschia sp. CCS1]
          Length = 227

 Score =  165 bits (417), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 89/209 (42%), Positives = 124/209 (59%)

Query: 12  RIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGEL 71
           R+GY F + +LL +ALTHSS+S   +   +RLEFLGDR+LGL+++  +      AKEG L
Sbjct: 13  RLGYVFEDPALLARALTHSSLSSPTRGDNQRLEFLGDRVLGLVMAEAVLAADTDAKEGTL 72

Query: 72  SVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGG 131
           + RFN+LV  E C+ VAR++DL + +R+             ++  D +E++IAA+YLDGG
Sbjct: 73  APRFNALVRKEACADVARQIDLGAAMRLGKSEMSAGGRRRMALLGDAMEAVIAAVYLDGG 132

Query: 132 IEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTV 191
              A   V + W +R     +  RDAKT LQEWA A+    P Y    RSGPDH P F V
Sbjct: 133 FASARDLVLRLWSERVQSVEEDARDAKTALQEWAQARGMAPPTYTEVARSGPDHAPVFRV 192

Query: 192 VVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
            V +S    A+    +KR AEQ AA ++L
Sbjct: 193 RVTLSSGENAEAQAKAKRQAEQQAAKDLL 221


>gi|254439178|ref|ZP_05052672.1| ribonuclease III [Octadecabacter antarcticus 307]
 gi|198254624|gb|EDY78938.1| ribonuclease III [Octadecabacter antarcticus 307]
          Length = 229

 Score =  164 bits (416), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 91/213 (42%), Positives = 124/213 (58%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           + RIG+ FA    L +A+THSS+S   ++  +RLEFLGDR+LGL++S  L     +A EG
Sbjct: 11  QDRIGHTFAKPDQLIRAVTHSSMSSPNRDDNQRLEFLGDRVLGLVMSEALLQADVNAPEG 70

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLD 129
            L+ RFN+LV  ETC+ VARE+DL + +++             ++ AD +E++IAA+Y+D
Sbjct: 71  LLAPRFNALVRKETCADVAREIDLGAVLKLGRSEMLTGGRRKEALLADAMEAVIAAVYID 130

Query: 130 GGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
            G +VA   V   W  R     K  RD KT LQEWA  +    P Y  T RSGPDH P F
Sbjct: 131 AGFDVARERVVALWGDRITNVEKDARDPKTALQEWAQGQGEPPPSYIETARSGPDHAPIF 190

Query: 190 TVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           T+ V +       G   SKR AEQ AA  +L+R
Sbjct: 191 TIEVRLQSGPTDIGQAPSKRQAEQAAAKSLLER 223


>gi|158423628|ref|YP_001524920.1| ribonuclease III [Azorhizobium caulinodans ORS 571]
 gi|226735365|sp|A8I3B5|RNC_AZOC5 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|158330517|dbj|BAF88002.1| ribonuclease III [Azorhizobium caulinodans ORS 571]
          Length = 235

 Score =  164 bits (415), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 96/225 (42%), Positives = 138/225 (61%), Gaps = 3/225 (1%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQ---ESYERLEFLGDRILGLLISTLLFNH 62
           ++ LE R+G++FA+RS L  ALTH S          SY+RLEFLGD +LG ++S +L+  
Sbjct: 7   FAALEARLGHSFADRSHLVLALTHISSVKGQAVRVRSYQRLEFLGDHVLGSVVSHMLYAA 66

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           F  A+EGELS R   LV  E C++VA+++ L  ++R+     +       +I ADV E++
Sbjct: 67  FPKAEEGELSRRLAELVREEACAEVAQDMGLGPYLRLGPGEAQSGARQRRAILADVAEAV 126

Query: 123 IAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           +AA+YLDGG E A   V+++W+ R     +  RD KT LQEWA A+    P Y+   RSG
Sbjct: 127 VAAVYLDGGYEAASALVERFWRGRLEAPRRPLRDPKTVLQEWAQARGLPPPVYRDVERSG 186

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIWT 227
           PDH PRF V V++ GL  A+    SK+ A++ AA+  L REG+ T
Sbjct: 187 PDHAPRFRVAVDLPGLECAEAEGGSKQTAQKAAASAFLAREGVVT 231


>gi|218530503|ref|YP_002421319.1| ribonuclease III [Methylobacterium chloromethanicum CM4]
 gi|218522806|gb|ACK83391.1| Ribonuclease III [Methylobacterium chloromethanicum CM4]
          Length = 256

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 92/223 (41%), Positives = 126/223 (56%), Gaps = 6/223 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQE----SYERLEFLGDRILGLLISTLLFNH 62
           + LE RIG+ FA+ +LL  ALTH  +S + Q     SY+RLEFLGDR+LGL ++  L+  
Sbjct: 25  AVLEARIGHVFADPTLLPLALTH--VSKAGQSGRVGSYQRLEFLGDRVLGLAVAETLYKA 82

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
              A+EGELS R   LV  ETC+ VA   ++   + +     +       +I ADV E++
Sbjct: 83  LPGAEEGELSRRLAGLVRRETCAVVAEAWEVGPHLNLGPGEIRTGGRRNQTILADVCEAI 142

Query: 123 IAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           + A++LD G E     V + ++     +    RDAK+ LQEWA A+    P Y+V  RSG
Sbjct: 143 LGAVFLDAGYEATRAIVQRAFRPGEETAAPRGRDAKSALQEWAMARSLAIPVYEVVERSG 202

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           PDH P F +   + G+ P  G   SKR AEQ AA  VL REGI
Sbjct: 203 PDHAPVFRIAARVEGIEPGYGEGASKRVAEQEAARAVLAREGI 245


>gi|254293934|ref|YP_003059957.1| ribonuclease III [Hirschia baltica ATCC 49814]
 gi|254042465|gb|ACT59260.1| ribonuclease III [Hirschia baltica ATCC 49814]
          Length = 255

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 85/220 (38%), Positives = 132/220 (60%), Gaps = 2/220 (0%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSI--SHSYQESYERLEFLGDRILGLLISTLLFNHFD 64
           +T+++  G  F + SLL++A TH+S     +   S ERLEFLGDR+LGL+ ++ L   F+
Sbjct: 33  ATIQEIAGIKFKDVSLLDRAFTHTSAVPGEAADWSNERLEFLGDRVLGLVAASQLITRFE 92

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
             +EG L+ R N+LVS +TC+++A E++L  ++ + +       +   S+ A+V E+LI 
Sbjct: 93  KEREGGLAPRLNALVSRDTCAKIAAEINLGQYLILDASESSAGGTTKPSLLANVTEALIG 152

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           A+YLD G+  +  F+ KYWK+         RD K+ LQEWA       P Y+   R+GPD
Sbjct: 153 AIYLDAGLAASERFIVKYWKEYFKTLTDVPRDPKSALQEWAQGDGRPAPNYENIDRTGPD 212

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           H P FTV V + G+ PA+G   SK+ A++ AA+ +L   G
Sbjct: 213 HAPVFTVEVRVEGVRPAKGEGSSKQEAQRAAASAMLNNVG 252


>gi|163851697|ref|YP_001639740.1| ribonuclease III [Methylobacterium extorquens PA1]
 gi|163663302|gb|ABY30669.1| Ribonuclease III [Methylobacterium extorquens PA1]
          Length = 256

 Score =  162 bits (411), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 92/223 (41%), Positives = 126/223 (56%), Gaps = 6/223 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQE----SYERLEFLGDRILGLLISTLLFNH 62
           + LE RIG+ FA+ +LL  ALTH  +S + Q     SY+RLEFLGDR+LGL ++  L+  
Sbjct: 25  AVLEARIGHVFADPTLLPLALTH--VSKAGQSGRVGSYQRLEFLGDRVLGLAVAETLYKA 82

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
              A+EGELS R   LV  ETC+ VA   ++   + +     +       +I ADV E++
Sbjct: 83  LPGAEEGELSRRLAGLVRRETCAVVAEAWEVGPHLNLGPGEIQTGGRRNQTILADVCEAI 142

Query: 123 IAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           + A++LD G E     V + ++     +    RDAK+ LQEWA A+    P Y+V  RSG
Sbjct: 143 LGAVFLDAGYEATRAIVQRAFRPGEETAAPRGRDAKSALQEWAMARSLAIPVYEVVERSG 202

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           PDH P F +   + G+ P  G   SKR AEQ AA  VL REGI
Sbjct: 203 PDHAPVFRIAARVEGIEPGYGEGASKRVAEQEAARAVLAREGI 245


>gi|240138862|ref|YP_002963337.1| ribonuclease III [Methylobacterium extorquens AM1]
 gi|240008834|gb|ACS40060.1| ribonuclease III [Methylobacterium extorquens AM1]
          Length = 256

 Score =  162 bits (410), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 92/223 (41%), Positives = 126/223 (56%), Gaps = 6/223 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQE----SYERLEFLGDRILGLLISTLLFNH 62
           + LE RIG+ FA+ +LL  ALTH  +S + Q     SY+RLEFLGDR+LGL ++  L+  
Sbjct: 25  AVLEARIGHVFADPTLLPLALTH--VSKAGQSGRVGSYQRLEFLGDRVLGLAVAETLYKA 82

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
              A+EGELS R   LV  ETC+ VA   ++   + +     +       +I ADV E++
Sbjct: 83  LPGAEEGELSRRLAGLVRRETCAVVAEAWEVGPHLNLGPGEIQTGGRRNQTILADVCEAI 142

Query: 123 IAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           + A++LD G E     V + ++     +    RDAK+ LQEWA A+    P Y+V  RSG
Sbjct: 143 LGAVFLDAGYEATRAIVQRAFRPGEETAAPRGRDAKSALQEWAMARSLAIPVYEVVERSG 202

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           PDH P F +   + G+ P  G   SKR AEQ AA  VL REGI
Sbjct: 203 PDHAPVFRIAARVEGIEPGYGEGASKRVAEQEAARAVLAREGI 245


>gi|254561469|ref|YP_003068564.1| ribonuclease III [Methylobacterium extorquens DM4]
 gi|254268747|emb|CAX24708.1| ribonuclease III [Methylobacterium extorquens DM4]
          Length = 256

 Score =  162 bits (410), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 92/223 (41%), Positives = 126/223 (56%), Gaps = 6/223 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQE----SYERLEFLGDRILGLLISTLLFNH 62
           + LE RIG+ FA+ +LL  ALTH  +S + Q     SY+RLEFLGDR+LGL ++  L+  
Sbjct: 25  AVLEARIGHVFADPTLLPLALTH--VSKAGQSGRVGSYQRLEFLGDRVLGLAVAETLYKA 82

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
              A+EGELS R   LV  ETC+ VA   ++   + +     +       +I ADV E++
Sbjct: 83  LPGAEEGELSRRLAGLVRRETCAVVAEAWEVGPHLNLGPGEIQTGGRRNQTILADVCEAI 142

Query: 123 IAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           + A++LD G E     V + ++     +    RDAK+ LQEWA A+    P Y+V  RSG
Sbjct: 143 LGAVFLDAGYEATRAIVQRAFRPGEETAAPRGRDAKSALQEWAMARSLAIPVYEVVERSG 202

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           PDH P F +   + G+ P  G   SKR AEQ AA  VL REGI
Sbjct: 203 PDHAPVFRIAARVEGIEPGYGEGASKRVAEQEAARAVLAREGI 245


>gi|332187768|ref|ZP_08389502.1| ribonuclease III [Sphingomonas sp. S17]
 gi|332012118|gb|EGI54189.1| ribonuclease III [Sphingomonas sp. S17]
          Length = 235

 Score =  162 bits (409), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 88/206 (42%), Positives = 119/206 (57%), Gaps = 3/206 (1%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           S L +  G A  + +   +ALTH S +    E+YERLEFLGDR+LGL+++  L+  F + 
Sbjct: 20  SWLTQIFGRAPQDSAPFHRALTHGSQA---AENYERLEFLGDRVLGLIMAEWLWEQFPNE 76

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG+LS R NSLV+   C+ VAR+L +   +R+    R D  S   ++  DV+E+LI A 
Sbjct: 77  PEGQLSRRLNSLVTGPVCADVARDLGVRDHLRLGKQARDDGASDSDNVLGDVMEALIGAW 136

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           Y + G++ A  FV K W  R    GK  +  K+ LQEWA A     PEY+VT RSGP H 
Sbjct: 137 YREAGLDAARAFVRKAWGDRVHSQGKAPQHPKSALQEWAAAHNRKAPEYEVTDRSGPHHA 196

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAE 212
           PRFTV V I   A A     +K+ AE
Sbjct: 197 PRFTVTVRIGRTAEASASGANKQEAE 222


>gi|310815100|ref|YP_003963064.1| ribonuclease III [Ketogulonicigenium vulgare Y25]
 gi|308753835|gb|ADO41764.1| ribonuclease III [Ketogulonicigenium vulgare Y25]
          Length = 228

 Score =  162 bits (409), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 88/210 (41%), Positives = 121/210 (57%)

Query: 12  RIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGEL 71
           R+G+ F N  +L +ALTH S S   +   +RLEFLGDR+LGL+++  L      A EG++
Sbjct: 13  RLGHRFINTEVLMRALTHGSASSPDRSDNQRLEFLGDRVLGLVVAEALLAADKFATEGQI 72

Query: 72  SVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGG 131
           + RFN LV  ETC++VAR +DL + +R+     K       ++ AD +E++IAA+YLD G
Sbjct: 73  APRFNRLVRRETCAEVARAMDLGAALRIGRSEMKTGGRKKEAVLADAMEAVIAAVYLDAG 132

Query: 132 IEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTV 191
            + A + V K+W           RDAKT LQEWA  +    P Y    RSGPDH P FTV
Sbjct: 133 FDAAKSVVLKHWAAHIANVDDDARDAKTALQEWAQGRGETPPAYIEEARSGPDHAPIFTV 192

Query: 192 VVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
            V +     A G   SKR AE  AA ++L+
Sbjct: 193 RVTLQSGPTATGEAGSKRLAEHAAATKLLQ 222


>gi|302383079|ref|YP_003818902.1| ribonuclease III [Brevundimonas subvibrioides ATCC 15264]
 gi|302193707|gb|ADL01279.1| ribonuclease III [Brevundimonas subvibrioides ATCC 15264]
          Length = 237

 Score =  162 bits (409), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 88/227 (38%), Positives = 131/227 (57%), Gaps = 8/227 (3%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQES-------YERLEFLGDRILGLLISTLL 59
           + L +R+G+ F + +LLE+ALTHSS+     ++        ERLEFLGDR+LGLL++  L
Sbjct: 10  TALVQRLGHDFRDPALLERALTHSSVGEGADKAAGKPARHNERLEFLGDRVLGLLVAQRL 69

Query: 60  FNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVV 119
            + F +A EGELS R ++LV    C +V   L +   +R+S    K        + AD V
Sbjct: 70  HHDFPAADEGELSSRLHALVDKHACGRVGEALKIGDALRLSPGETKTGGRRKEGVVADAV 129

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQR-ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           E+L+AA++LDGG+E A    D+ W    A  + +   + K+ LQEWA       P Y+V 
Sbjct: 130 EALLAAVFLDGGLEAARAVFDRAWAHELASPAPRALNNPKSALQEWAQGHGRPLPSYRVA 189

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
            ++G DH P FTV V I G+ P   +  S++ AE+ AA  +L+REG+
Sbjct: 190 SQTGSDHAPTFTVEVSIEGVEPLTAVGRSRQDAEKAAATALLQREGV 236


>gi|85708367|ref|ZP_01039433.1| ribonuclease III [Erythrobacter sp. NAP1]
 gi|85689901|gb|EAQ29904.1| ribonuclease III [Erythrobacter sp. NAP1]
          Length = 232

 Score =  161 bits (408), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 134/232 (57%), Gaps = 8/232 (3%)

Query: 1   MSALRYSTLE--KRIGYAFANRSLLEKALTHSSISHSY------QESYERLEFLGDRILG 52
           MSAL   T +    IG+   + S+  +ALTH S + ++      +  Y+RLEFLGDR+LG
Sbjct: 1   MSALPPETRDWLGTIGFEVKDGSMWLEALTHGSFNSTHTATGQPEADYQRLEFLGDRVLG 60

Query: 53  LLISTLLFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMT 112
           L +++ LF   D +KEG+LS R N+LVS  TC+++AR + L+  IR+    R+D  S   
Sbjct: 61  LSVASWLFRSSDRSKEGQLSQRLNALVSGATCARIARTIGLSDHIRLGKQAREDGGSDSD 120

Query: 113 SIQADVVESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVT 172
           +I  DV+E++I A +LD G +     + + W+          +  K+ LQEWA       
Sbjct: 121 NILGDVMEAIIGASFLDNGFDTTRAIILELWEPELAGDAGKAKHPKSALQEWAAGNRRAM 180

Query: 173 PEYKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           P+Y V  RSGPDH  RFTV V I  +  A+G+  SK  AE++AAAE L++ G
Sbjct: 181 PQYDVIDRSGPDHAARFTVRVSIHKVGEAEGVATSKHEAEKLAAAEFLEKYG 232


>gi|260432756|ref|ZP_05786727.1| ribonuclease III [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416584|gb|EEX09843.1| ribonuclease III [Silicibacter lacuscaerulensis ITI-1157]
          Length = 226

 Score =  161 bits (407), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 122/202 (60%), Gaps = 6/202 (2%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           +KR+G+ FAN  LL +ALTH S+S + +   +RLEFLGDR+LGL++++ L     +A EG
Sbjct: 11  QKRLGHQFANPELLVRALTHGSVSSATRPDNQRLEFLGDRVLGLVMASALLEADKTATEG 70

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA---DVVESLIAAL 126
           +L+ RFN+LV  ETC+ VAR++DL + +++    R ++ S     QA   D +E++IAA+
Sbjct: 71  QLAPRFNALVRKETCADVARQIDLGAVLKLG---RSEMMSGGRRKQALLGDAMEAVIAAV 127

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           Y D G E A   V K W  R  +     RDAKT LQEWA A+    P Y    R+GPDH 
Sbjct: 128 YRDAGFEAARDVVLKLWGDRLHQVKADARDAKTALQEWAQARGQKPPSYVELSRTGPDHA 187

Query: 187 PRFTVVVEISGLAPAQGMDCSK 208
           P FT+V  +     AQ    SK
Sbjct: 188 PVFTIVARLESGPEAQATAPSK 209


>gi|114770106|ref|ZP_01447644.1| Ribonuclease III [alpha proteobacterium HTCC2255]
 gi|114548943|gb|EAU51826.1| Ribonuclease III [alpha proteobacterium HTCC2255]
          Length = 226

 Score =  161 bits (407), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 124/214 (57%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           +   KR+GY F    LL +A+THSS+S + +   +R EFLGDR+LGL IS  LF+    A
Sbjct: 8   TAFSKRLGYDFQKPELLIQAMTHSSLSSTTRGDNQRFEFLGDRVLGLSISDALFHKDSDA 67

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG L+ RFN+LV  ETC+++A E+ L   +++             ++  D +E++I A+
Sbjct: 68  SEGLLAPRFNALVRKETCAEIAIEIKLGEALKMGRSEMLSGGRRKIAVLGDAMEAVIGAV 127

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           YLD G E+A   V + W      +    RD+KT LQEWA AK   TP+Y    RSGPDH 
Sbjct: 128 YLDAGFEIARDMVIRLWSNHIDNAAHDARDSKTILQEWAQAKKLPTPKYIEVDRSGPDHA 187

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
           P FT+ V I     A+    SKRAA Q AAA++L
Sbjct: 188 PIFTIEVSIETGQSAKAQAQSKRAASQDAAADLL 221


>gi|2500552|sp|Q52698|RNC_RHOCA RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|1177610|emb|CAA92647.1| endoribonuclease III [Rhodobacter capsulatus]
          Length = 228

 Score =  160 bits (406), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 90/222 (40%), Positives = 127/222 (57%), Gaps = 12/222 (5%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           S    R+G+ F     L +ALTHSS+  + +   +RLEFLGDR+LGL ++  LF+    A
Sbjct: 8   SAFMDRLGHRFTTPEHLVRALTHSSLGSATRPDNQRLEFLGDRVLGLSMAEALFHADGRA 67

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIR------VSSDLRKDVCSFMTSIQADVVE 120
            EG+L+ RFN+LV  ETC+ VAR++DL + ++      +S   RKD      ++  D +E
Sbjct: 68  SEGQLAPRFNALVRKETCAAVARDIDLGAVLKLGRSEMMSGGRRKD------ALLGDAME 121

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           ++IAA+YLD G EVA   V + W  R        RD KT LQEWA A+    P Y+   R
Sbjct: 122 AVIAAVYLDAGFEVARALVLRLWAARIQSVDNDARDPKTALQEWAQARGLPPPRYETLGR 181

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
            GPDH P+F + V ++     +    SKR AEQ AA  +L+R
Sbjct: 182 DGPDHAPQFRIAVVLASGETEEAQAGSKRNAEQAAAKALLER 223


>gi|254459764|ref|ZP_05073180.1| ribonuclease III [Rhodobacterales bacterium HTCC2083]
 gi|206676353|gb|EDZ40840.1| ribonuclease III [Rhodobacteraceae bacterium HTCC2083]
          Length = 228

 Score =  160 bits (405), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 88/214 (41%), Positives = 120/214 (56%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L+KRI Y F    LL +A+THSS+S   +   +RLEFLGDR+LGL+++  L      A E
Sbjct: 10  LQKRIDYRFEQGELLTEAVTHSSMSSPSRGDNQRLEFLGDRVLGLVMAEALLGADVKASE 69

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+L+ R+N+LV  ETC+ VAR++ L   +R+     K       ++  D +E+LIAA+Y+
Sbjct: 70  GQLAPRYNALVRKETCADVARDIGLGDVLRLGRSEMKSGGRRKLALLGDGMEALIAAVYV 129

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           DGG   A   + + W  R        RD KT LQEWA ++    P Y  T RSGPDH P 
Sbjct: 130 DGGFNAAQALILRLWGSRITSVEADARDPKTSLQEWAQSRGLTPPAYVETARSGPDHAPH 189

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           FT+   +     A     SKR AEQ AA  +L R
Sbjct: 190 FTIEARLDTGETASAEAGSKRLAEQAAAKALLTR 223


>gi|294678827|ref|YP_003579442.1| ribonuclease III [Rhodobacter capsulatus SB 1003]
 gi|294477647|gb|ADE87035.1| ribonuclease III [Rhodobacter capsulatus SB 1003]
          Length = 228

 Score =  160 bits (405), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 90/222 (40%), Positives = 127/222 (57%), Gaps = 12/222 (5%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           S    R+G+ F     L +ALTHSS+  + +   +RLEFLGDR+LGL ++  LF+    A
Sbjct: 8   SAFMDRLGHRFTTPEHLVRALTHSSLGSATRPDNQRLEFLGDRVLGLSMAEALFHADGRA 67

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIR------VSSDLRKDVCSFMTSIQADVVE 120
            EG+L+ RFN+LV  ETC+ VAR++DL + ++      +S   RKD      ++  D +E
Sbjct: 68  SEGQLAPRFNALVRKETCAAVARDIDLGAVLKLGRSEMMSGGRRKD------ALLGDAME 121

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           ++IAA+YLD G EVA   V + W  R        RD KT LQEWA A+    P Y+   R
Sbjct: 122 AVIAAVYLDAGFEVARALVLRLWAGRIQSVDNDARDPKTALQEWAQARGLPPPRYETLGR 181

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
            GPDH P+F + V ++     +    SKR AEQ AA  +L+R
Sbjct: 182 EGPDHAPQFRIAVVLASGETEEAQAGSKRNAEQAAAKALLER 223


>gi|85068686|gb|ABC54695.1| ribonuclease III [Ehrlichia sp. P-Mtn]
          Length = 228

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 88/219 (40%), Positives = 130/219 (59%), Gaps = 3/219 (1%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQE---SYERLEFLGDRILGLLISTLLFNHF 63
           + + + IGY+F N  LL +ALTH S+S S      +YERLEFLGD +L L+IS +LFN F
Sbjct: 4   NNISEIIGYSFKNIQLLNEALTHPSVSSSKDNINFNYERLEFLGDAVLNLVISEMLFNIF 63

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
               EG L+ +  +LV      +VA+ ++L +FI +S   R    +  +S   + +E+LI
Sbjct: 64  PKDTEGNLAKKKTALVCGTKLVEVAQFINLGTFIIMSDGERTCGGANNSSNLENALEALI 123

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
            A+YLDGG++ A  F+  +WK  A       +DAKT LQEWA A+  + P Y +  +SGP
Sbjct: 124 GAIYLDGGLKAAKNFIFLFWKNSAKHMKVPPQDAKTILQEWAQAQGLLAPSYHIVNKSGP 183

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           DH+P FTV V ++     Q    +K+ AEQ AA+ +L +
Sbjct: 184 DHNPTFTVEVRMNSHETLQATGNNKKIAEQKAASLMLAK 222


>gi|85705112|ref|ZP_01036212.1| Ribonuclease III [Roseovarius sp. 217]
 gi|85670434|gb|EAQ25295.1| Ribonuclease III [Roseovarius sp. 217]
          Length = 238

 Score =  159 bits (403), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 123/213 (57%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           + R+G+ F    LL +ALTHSS+    ++  +RLEFLGDR+LGL++S  L +    A EG
Sbjct: 22  QTRLGHEFTATELLIRALTHSSMVTPNRDDNQRLEFLGDRVLGLVMSEALLSQDKGATEG 81

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLD 129
           +L+ RFN+LV  E C+ VARE+DL + +++             ++  D +E++IAA+YLD
Sbjct: 82  QLAPRFNALVRKEACADVAREIDLGAVLKLGRSEMLSGGRRKEALLGDAMEAVIAAIYLD 141

Query: 130 GGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
            G + A   V + W  R  +     RDAKT LQEWA A+    P+Y    R GPDH P F
Sbjct: 142 AGFDAARAVVLRLWGARIGEVKDDARDAKTALQEWAQARGLPPPDYIELRRKGPDHAPVF 201

Query: 190 TVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           T+  ++     A+    SKR AEQ AA  +L R
Sbjct: 202 TISAQLKSGESAEATAGSKRQAEQTAAKALLAR 234


>gi|84515163|ref|ZP_01002526.1| ribonuclease III [Loktanella vestfoldensis SKA53]
 gi|84511322|gb|EAQ07776.1| ribonuclease III [Loktanella vestfoldensis SKA53]
          Length = 226

 Score =  159 bits (403), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 90/216 (41%), Positives = 128/216 (59%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           ++  +R+GY+F    LL +++THSS+   +++  +RLEFLGDR+LGL+++  L     SA
Sbjct: 8   ASFSQRLGYSFVRPDLLVRSVTHSSMVSIHRDDNQRLEFLGDRVLGLVMAEALLKADPSA 67

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG L+ R+N+LV  ETC+ VARE+DL + I++     K       ++ AD +E++IAA+
Sbjct: 68  PEGLLAPRYNALVRRETCADVAREVDLGAVIKLGRSEMKSGGRRKEALLADAMEAVIAAI 127

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           Y DGG + A   V   W  R        RDAKT LQEWA A+    P Y  T R+GPDH 
Sbjct: 128 YQDGGFDAARKVVLHLWGARITNVADDARDAKTALQEWAQARGEAPPSYTETARTGPDHQ 187

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           P FT+ V +           SKR AEQ AAA +LK+
Sbjct: 188 PAFTIAVTLESGQTETATAGSKRQAEQAAAAALLKK 223


>gi|307292852|ref|ZP_07572698.1| ribonuclease III [Sphingobium chlorophenolicum L-1]
 gi|306880918|gb|EFN12134.1| ribonuclease III [Sphingobium chlorophenolicum L-1]
          Length = 227

 Score =  159 bits (403), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 88/210 (41%), Positives = 122/210 (58%), Gaps = 3/210 (1%)

Query: 13  IGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELS 72
           IG    + +   +ALTH S +     +YERLEFLGDRILGLLI+  +++ F +  EG+LS
Sbjct: 18  IGRKPKDPAAFTQALTHGSAN---AVNYERLEFLGDRILGLLIAEWVYDRFSTEPEGKLS 74

Query: 73  VRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGI 132
            RFN+LVS ETC++VAR   + + + +    R D  +   ++  DV+E+LI ALYL+GG+
Sbjct: 75  RRFNALVSGETCAEVARSAGVPTHLILGKQARDDGAADSDNVLGDVMEALIGALYLEGGL 134

Query: 133 EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVV 192
           + A T V + W  R        +  K+ LQEWA A     PEY +T RSGP H  +FTV 
Sbjct: 135 KEARTLVRRLWADRVDTQASAPKHPKSALQEWAAANKRKPPEYAMTDRSGPHHALKFTVT 194

Query: 193 VEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           V I G   A     SK+ AE  AA  +L +
Sbjct: 195 VSIKGAGEASATGGSKQEAETAAAKALLDK 224


>gi|84684005|ref|ZP_01011907.1| Ribonuclease III [Maritimibacter alkaliphilus HTCC2654]
 gi|84667758|gb|EAQ14226.1| Ribonuclease III [Rhodobacterales bacterium HTCC2654]
          Length = 226

 Score =  159 bits (402), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 123/214 (57%)

Query: 11  KRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGE 70
            RIG+ F    LL +ALTH SIS   +   +RLEFLGDR+LGL+++  +      A EG+
Sbjct: 12  NRIGHDFKRPELLIRALTHGSISSDTRPDNQRLEFLGDRVLGLVMAEAMLAADKEASEGQ 71

Query: 71  LSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDG 130
           L+ RFN+LV  E C+ VAR+++L + +++    +        ++  D +E++IAA+YLD 
Sbjct: 72  LAPRFNALVRKEACADVARQVELGAVLKLGRSEQMSGGRRKQALLGDAMEAVIAAVYLDA 131

Query: 131 GIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFT 190
           G E A   + + W  R     +  RDAKT LQEWA A+    P Y    R GPDH P FT
Sbjct: 132 GFEAAREMIVRLWGDRIGAVEEDARDAKTALQEWAQARKMQPPTYVEIARDGPDHAPEFT 191

Query: 191 VVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           +  ++     A+    SKRAAEQ AA  +L+R G
Sbjct: 192 IEAQLENGEAARAKANSKRAAEQDAARALLERLG 225


>gi|315499946|ref|YP_004088749.1| ribonuclease iii [Asticcacaulis excentricus CB 48]
 gi|315417958|gb|ADU14598.1| ribonuclease III [Asticcacaulis excentricus CB 48]
          Length = 242

 Score =  159 bits (401), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 89/223 (39%), Positives = 126/223 (56%), Gaps = 6/223 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSIS-----HSYQESYERLEFLGDRILGLLISTLLFNHF 63
           LE ++GY FA+R LL+ ALTH+S+S      +     ERLEFLGDR+LGLL++  L   F
Sbjct: 19  LEAKLGYRFADRQLLDSALTHASVSDGRPKKTVSSDNERLEFLGDRVLGLLVAEALMQAF 78

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             A EGE+S R + LVS ETC+ VA  L + + +R++    K       +I  D  E+LI
Sbjct: 79  PQAAEGEMSQRLHGLVSRETCAAVAMSLGVGAAMRLAPGETKSGGRSNLTILGDACEALI 138

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKS-GKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           AA+YLDGG E A       W+     S  +   + K+ LQEWA  K   +P+Y++  RSG
Sbjct: 139 AAVYLDGGFETARRIFGPLWQPHIRASHSRSHLNPKSHLQEWAAQKKLPSPKYEIVERSG 198

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           PDH P F V + + G  P      S++ AE+ AA   ++  G+
Sbjct: 199 PDHAPIFKVALTLEGYDPVVASGKSRQEAEKAAALSFIEHAGL 241


>gi|89070097|ref|ZP_01157427.1| Ribonuclease III [Oceanicola granulosus HTCC2516]
 gi|89044318|gb|EAR50461.1| Ribonuclease III [Oceanicola granulosus HTCC2516]
          Length = 226

 Score =  158 bits (400), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 125/211 (59%)

Query: 12  RIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGEL 71
           R+G+ F N  LL +ALTH S S + +   +RLEFLGDR+LGL+++  LF     A+EG L
Sbjct: 13  RLGHRFENPELLLRALTHPSFSSTGRGDNQRLEFLGDRVLGLVMAEALFEADPEAREGLL 72

Query: 72  SVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGG 131
           + R+N+LV  ETC++VARE+D+ + +++     K       ++ AD +E++IAA+Y D G
Sbjct: 73  APRYNALVRKETCAEVAREIDIGAVLKLGRSEMKTGGRRKEALLADAMEAVIAAIYRDAG 132

Query: 132 IEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTV 191
              A   V  +W +R     +  RDAKT LQE A A+    P Y+   R GPDH P FT+
Sbjct: 133 FARAREVVRAHWGKRIGAVAEDARDAKTALQELAQARGEPPPGYREISRHGPDHQPLFTI 192

Query: 192 VVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
            V ++    A+    SKR AEQ AA  +L R
Sbjct: 193 EVRLATGESARAEAGSKRQAEQAAARTLLDR 223


>gi|16125807|ref|NP_420371.1| ribonuclease III [Caulobacter crescentus CB15]
 gi|221234567|ref|YP_002517003.1| ribonuclease III [Caulobacter crescentus NA1000]
 gi|22654073|sp|Q9A805|RNC_CAUCR RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|254807242|sp|B8H627|RNC_CAUCN RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|13422947|gb|AAK23539.1| ribonuclease III [Caulobacter crescentus CB15]
 gi|220963739|gb|ACL95095.1| ribonuclease III [Caulobacter crescentus NA1000]
          Length = 231

 Score =  158 bits (399), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 100/219 (45%), Positives = 137/219 (62%), Gaps = 3/219 (1%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQE--SYERLEFLGDRILGLLISTLLFNHFDSA 66
           LE+RIG+ F +R LLE+ALTH+S+    ++    E LEF+GDR+LGLL +  L   F  A
Sbjct: 11  LERRIGHRFEDRELLERALTHASVGDGAKKVRDNEVLEFIGDRVLGLLAAEALAQRFPKA 70

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           KEGEL+ R N+LVS ETC++VAR+ +L   +R+S+   K       SI A   E+L+AAL
Sbjct: 71  KEGELAPRLNALVSRETCARVARKAELGPALRLSASSSKIGGRETDSILAGATEALMAAL 130

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFR-RDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           Y DGG+E A       W     ++G+ R RD KT LQEWA  +    P Y+V  R+GPDH
Sbjct: 131 YQDGGLEAARKVFLDLWNDEFDRAGEGRPRDPKTALQEWAQGQGRPLPTYRVLDRTGPDH 190

Query: 186 DPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
            P FTV V ++G+ PA     S++ AE+ AA  +L+REG
Sbjct: 191 APVFTVEVSVTGVDPAIAKGKSRQEAEKAAAKALLEREG 229


>gi|163733862|ref|ZP_02141304.1| ribonuclease III [Roseobacter litoralis Och 149]
 gi|161392973|gb|EDQ17300.1| ribonuclease III [Roseobacter litoralis Och 149]
          Length = 228

 Score =  158 bits (399), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 124/203 (61%), Gaps = 6/203 (2%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           +KR+G+ F   SLL +A+TH+S+S + +   +R+EFLGDR+LGL+++  L    + A EG
Sbjct: 11  QKRLGHQFNQPSLLAQAVTHASMSTANRGDNQRMEFLGDRVLGLVMAEALLGLDNDATEG 70

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA---DVVESLIAAL 126
           +L+ RFN+LV  ETC+ VARE+DL + +R+    R ++ S     QA   D +E++IAA+
Sbjct: 71  QLAPRFNALVRKETCADVAREIDLGAVLRLG---RSEMLSGGRRKQALLGDAIEAVIAAV 127

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           Y D G + A   + + W  R  +  +  RDAKT LQEWA A+    P Y+   R GPDH 
Sbjct: 128 YQDAGFDAARALILRLWGDRVHEVEEDARDAKTALQEWAQARGLQPPHYEEVHRKGPDHA 187

Query: 187 PRFTVVVEISGLAPAQGMDCSKR 209
           P FT+ V++S     Q    SKR
Sbjct: 188 PIFTISVQLSTGETDQATAGSKR 210


>gi|220927101|ref|YP_002502403.1| ribonuclease III [Methylobacterium nodulans ORS 2060]
 gi|219951708|gb|ACL62100.1| ribonuclease III [Methylobacterium nodulans ORS 2060]
          Length = 244

 Score =  158 bits (399), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 94/220 (42%), Positives = 132/220 (60%), Gaps = 1/220 (0%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           STLE++IG+ FA++ LL +ALTH S + +  ESY+RLEFLGDR+LGL ++  LF     A
Sbjct: 17  STLEEKIGHRFADQELLVRALTHVSAA-TGPESYQRLEFLGDRVLGLAVADGLFAALPGA 75

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG+LS R + LV  E+C+ VA   D+   +++ +           +I ADV E+++ A+
Sbjct: 76  DEGDLSRRLSGLVRRESCAAVATAWDVGPHLKLGAGEVYGGGRRNPAILADVCEAILGAI 135

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           +LD G E A T +D+ +       G   RD K+ LQEWA      TP Y V  R+GPDH 
Sbjct: 136 FLDAGYEAAKTVIDRAFAAGNEVEGTRTRDPKSALQEWAQGLGLPTPTYAVVERAGPDHA 195

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           P F +   + G+AP  G+  SKR AEQ AA  +L REG+W
Sbjct: 196 PIFRIEARVLGVAPGVGVGGSKRLAEQEAARLLLMREGVW 235


>gi|329890079|ref|ZP_08268422.1| ribonuclease III [Brevundimonas diminuta ATCC 11568]
 gi|328845380|gb|EGF94944.1| ribonuclease III [Brevundimonas diminuta ATCC 11568]
          Length = 238

 Score =  157 bits (396), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 86/224 (38%), Positives = 127/224 (56%), Gaps = 5/224 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHS----YQESYERLEFLGDRILGLLISTLLFNH 62
           + L +R+G+ F + SLLE+ALTHSS+            ERLEFLGDR+LGLL++  L   
Sbjct: 14  AALRQRLGHDFEDASLLERALTHSSVGEGAGPQVPADNERLEFLGDRVLGLLVADRLVRD 73

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           + SA EG+LS R ++LV    C++V   L +   +R+S    K        + AD VE++
Sbjct: 74  YPSADEGQLSARLHALVDKSACARVGERLGVGDALRLSPGETKTGGRRKAGVIADAVEAI 133

Query: 123 IAALYLDGGIEVAGTFVDKYWKQR-ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +AA+Y DGG+  A T  ++ W +  A        + K+ LQEWA  +    P Y+V  R+
Sbjct: 134 LAAVYRDGGLIAAQTVFERAWAEELAAPPSAAVTNPKSALQEWAQGQGRPLPTYEVVQRT 193

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           G DH P FTV   ++G  PA+    S++ AE+ AA  +LKRE +
Sbjct: 194 GSDHAPTFTVEATVTGYEPARAQGRSRQEAEKAAAIALLKREDV 237


>gi|330814142|ref|YP_004358381.1| signal peptidase I [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487237|gb|AEA81642.1| signal peptidase I [Candidatus Pelagibacter sp. IMCC9063]
          Length = 224

 Score =  157 bits (396), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 87/215 (40%), Positives = 125/215 (58%), Gaps = 1/215 (0%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + +EK +   F N + LEKALTH SI+     + ERLEF+GDR+LGL+I+T L   +   
Sbjct: 7   TKVEKILNIKFKNTNFLEKALTHKSITKISASNNERLEFIGDRVLGLVIATKLSILYPED 66

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG L  +  SLV+ +TCSQ+  +L+L  +I +SS  +K+       I  D+ ESLI A+
Sbjct: 67  VEGSLDKKLASLVNKDTCSQIIEKLNLGKYILLSSSQQKNKIGH-KKIYGDLCESLIGAV 125

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           YLD G   A  FV   W++   +S     D+KT+LQE++   F V P YK     GP H 
Sbjct: 126 YLDKGFSEANKFVLSLWRENLKRSTIVEVDSKTQLQEYSLKFFKVLPIYKNLSNKGPSHK 185

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           P F + V+I+      G   SK+ AEQ+AA+++LK
Sbjct: 186 PSFKISVKITNSKLCTGEGTSKKKAEQLAASKLLK 220


>gi|126739723|ref|ZP_01755415.1| ribonuclease III [Roseobacter sp. SK209-2-6]
 gi|126719369|gb|EBA16079.1| ribonuclease III [Roseobacter sp. SK209-2-6]
          Length = 228

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 116/201 (57%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
            E+RIGY F    LL +ALTH S+S   ++  +RLEFLGDR+LGL+++T +      A E
Sbjct: 10  FEERIGYRFKRVDLLVRALTHPSVSSPNRKDNQRLEFLGDRVLGLVMATAMLESDKEASE 69

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+L+ RFN+LV  ETC+ VARE+DL + +++             ++  D +E++IAA+Y 
Sbjct: 70  GQLAPRFNALVRKETCADVAREIDLGAVLKLGRSEMMSGGRRKLALLGDGMEAVIAAVYK 129

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           D G EVA   + + W QR  +  +  RD KT LQE+  A+    P Y    R GPDH+P 
Sbjct: 130 DAGFEVAQDMILRLWGQRIFQVEEDARDPKTALQEYVQARRQPPPAYVQVSRQGPDHEPI 189

Query: 189 FTVVVEISGLAPAQGMDCSKR 209
           FT+ V +      Q    SKR
Sbjct: 190 FTIAVRLQDGTEEQASAGSKR 210


>gi|197105333|ref|YP_002130710.1| ribonuclease III [Phenylobacterium zucineum HLK1]
 gi|238690159|sp|B4RCU4|RNC_PHEZH RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|196478753|gb|ACG78281.1| ribonuclease III [Phenylobacterium zucineum HLK1]
          Length = 238

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 89/222 (40%), Positives = 129/222 (58%), Gaps = 4/222 (1%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHFD 64
           + LE+RIGY F +R LLE+ALTH+S+    +     ERLEFLGDR+L L  +  L     
Sbjct: 9   AELERRIGYVFTDRDLLERALTHASVGDGARAVRHNERLEFLGDRVLNLCAAERLMALDP 68

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
            A+EGE+S    SLV+   C++ A+   L   +R+S+   K       ++  D  E+LIA
Sbjct: 69  DAREGEMSRLLASLVNYHACARAAKRAGLQEALRLSASATKVGARKSDAVLGDACEALIA 128

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFR-RDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           ALY+DGG+E A  F  K+W +   +  + R +D KT+LQEW        P Y++  + GP
Sbjct: 129 ALYIDGGLETARAFFLKFWDEEFARLDEPRAKDPKTQLQEWVQGMGLPLPTYEIVSQEGP 188

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA-AEVLKREG 224
            H P FTV V+++G    +G   S++AAE+ AA   +LKREG
Sbjct: 189 PHAPSFTVEVQVAGFGAERGEGRSRQAAEKAAAQCMLLKREG 230


>gi|188581484|ref|YP_001924929.1| ribonuclease III [Methylobacterium populi BJ001]
 gi|179344982|gb|ACB80394.1| Ribonuclease III [Methylobacterium populi BJ001]
          Length = 256

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 89/221 (40%), Positives = 121/221 (54%), Gaps = 2/221 (0%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQE--SYERLEFLGDRILGLLISTLLFNHFD 64
           + LE RIG+ F + +LL  ALTH S +       SY+RLEFLGDR+LGL ++  L+    
Sbjct: 25  AVLEARIGHVFTDPTLLPLALTHVSKAGPSGRVGSYQRLEFLGDRVLGLAVAETLYRALP 84

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
            A+EGELS R   LV  ETC+ VA   ++   + +     +       +I ADV E+++ 
Sbjct: 85  DAEEGELSRRLAGLVRRETCAAVAEAWEVGPHLNLGPGEIQTGGRRNQTILADVCEAILG 144

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           A++LD G E     V + ++          RDAK+ LQEWA A+    P Y+V  RSGPD
Sbjct: 145 AVFLDAGYEATRAIVQRSFRPGEDTGAPRGRDAKSALQEWAMARSLAIPVYEVVERSGPD 204

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           H P F + V +  + P  G   SKR AEQ AA  VL RE I
Sbjct: 205 HAPVFRIAVRVESIEPGYGEGASKRVAEQEAARAVLDRENI 245


>gi|119383173|ref|YP_914229.1| ribonuclease III [Paracoccus denitrificans PD1222]
 gi|119372940|gb|ABL68533.1| RNAse III [Paracoccus denitrificans PD1222]
          Length = 241

 Score =  155 bits (393), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 123/213 (57%), Gaps = 1/213 (0%)

Query: 11  KRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGE 70
           +R+G+ F+   LL +ALTH SI+ + +   +RLEFLGDR+LGL I+  LF+   +A EG+
Sbjct: 24  ERLGHEFSRPELLRRALTHGSIASTTRPDNQRLEFLGDRVLGLTIAEALFSADRAATEGQ 83

Query: 71  LSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDG 130
           L+ R+N+LV  ETC+ +ARE+ L   +++             ++ AD +E++IAA+YLD 
Sbjct: 84  LAPRYNALVKGETCAAIAREIGLGEVLKLGRSEMMSGGRRKEALLADAMEAVIAAVYLDA 143

Query: 131 GIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFT 190
           G E A   V   W  R        RDAKT LQEWA A+    P Y    R+GPDH P F 
Sbjct: 144 GFETARGVVLGLWSDRLANVETDARDAKTALQEWAQAQGMSPPRYVQIARTGPDHAPEFQ 203

Query: 191 VVVEI-SGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           + V +  G   +     +KR+ EQ AA  +L++
Sbjct: 204 ITVRLDDGREASASGKGTKRSIEQAAATAMLEQ 236


>gi|110678686|ref|YP_681693.1| ribonuclease III [Roseobacter denitrificans OCh 114]
 gi|123362135|sp|Q16AI6|RNC_ROSDO RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|109454802|gb|ABG31007.1| ribonuclease III [Roseobacter denitrificans OCh 114]
          Length = 228

 Score =  155 bits (392), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 124/205 (60%), Gaps = 6/205 (2%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAK 67
           + +KR+G+ F   +LL +A+TH+S+S + +   +R+EFLGDR+LGL+++  L    ++A 
Sbjct: 9   SFQKRLGHQFNQPALLAQAVTHASMSTANRGDNQRMEFLGDRVLGLVMAEALLRLDNNAT 68

Query: 68  EGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA---DVVESLIA 124
           EG+L+ RFN+LV  ETC+ VARE+DL + +R+    R ++ S     QA   D +E++IA
Sbjct: 69  EGQLAPRFNALVRKETCADVAREIDLGAVLRLG---RSEMLSGGRRKQALLGDAIEAVIA 125

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           A+Y D G + A   + + W  R  +  +  RD KT LQEWA A+    P Y+   R GPD
Sbjct: 126 AVYQDAGFDAARALILRLWGDRVHEVEEDARDPKTALQEWAQARGLQPPRYEEVSRKGPD 185

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKR 209
           H P FT+ V IS     Q    SKR
Sbjct: 186 HAPIFTISVRISTGETDQATAGSKR 210


>gi|241761668|ref|ZP_04759755.1| Ribonuclease III [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|260754033|ref|YP_003226926.1| ribonuclease III [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|283856457|ref|YP_163110.2| ribonuclease III [Zymomonas mobilis subsp. mobilis ZM4]
 gi|292495068|sp|Q9Z5U2|RNC_ZYMMO RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|241373976|gb|EER63509.1| Ribonuclease III [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|258553396|gb|ACV76342.1| ribonuclease III [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|283775461|gb|AAV89999.2| Ribonuclease III [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 246

 Score =  155 bits (391), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 78/202 (38%), Positives = 119/202 (58%), Gaps = 3/202 (1%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           S +EK +G+   + +L  +A+TH S  +S    Y+RLEFLGDR+LGL+I+  L++ F   
Sbjct: 31  SWIEKNLGHRPKDPALFLRAMTHPSHGNS---DYQRLEFLGDRVLGLVIANWLYDLFPRE 87

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG+LS R NSLVS  +C+ +AR + L  ++R+    R D  +   ++  DV+E++I A+
Sbjct: 88  PEGKLSRRLNSLVSGASCASIARIVGLPQWLRLGKQARDDGAAASDNVLGDVMEAMIGAI 147

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           +L+ GIE AG  + KYW           +  K+ LQEWA A     P Y++  R+GP H+
Sbjct: 148 FLESGIEAAGKLIHKYWAPLVTGQESAPKHPKSALQEWAAAHNRRPPVYEIVSRTGPQHN 207

Query: 187 PRFTVVVEISGLAPAQGMDCSK 208
           P FT+ V I+G+  A     SK
Sbjct: 208 PCFTIQVSIAGVGEASAEGSSK 229


>gi|146278605|ref|YP_001168764.1| ribonuclease III [Rhodobacter sphaeroides ATCC 17025]
 gi|189043338|sp|A4WVP5|RNC_RHOS5 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|145556846|gb|ABP71459.1| RNAse III [Rhodobacter sphaeroides ATCC 17025]
          Length = 229

 Score =  154 bits (390), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 119/204 (58%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           E RIG+AF     L +A+TH+S+S + +   +RLEFLGDR+LGL+++  L     +A EG
Sbjct: 11  ESRIGHAFREPDRLLRAVTHASLSSATRPDNQRLEFLGDRVLGLVMAEALLAADKAATEG 70

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLD 129
           +L+ RFN+LV  ETC+ VARE+ L   +++             ++  D +E++IAA+YLD
Sbjct: 71  QLAPRFNALVRKETCAAVAREVGLGDVLKLGRSEMMSGGRRKEALLGDALEAVIAAVYLD 130

Query: 130 GGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
            G E A   V + W +R  +     RDAKT LQEWA A+    P Y+   RSGPDH P F
Sbjct: 131 AGFEAARRLVLRLWGERIAQVEADARDAKTALQEWAQARGLPPPCYEAVDRSGPDHAPIF 190

Query: 190 TVVVEISGLAPAQGMDCSKRAAEQ 213
           TV V +      +    +KR AEQ
Sbjct: 191 TVEVRLGNGETERSAAGTKRVAEQ 214


>gi|295690019|ref|YP_003593712.1| ribonuclease III [Caulobacter segnis ATCC 21756]
 gi|295431922|gb|ADG11094.1| ribonuclease III [Caulobacter segnis ATCC 21756]
          Length = 231

 Score =  154 bits (390), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 124/203 (61%), Gaps = 3/203 (1%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQE--SYERLEFLGDRILGLLISTLLFNHFDSA 66
           LE+RIG+ F +R LLE+ALTH+S+    ++    E LEF+GDR+LGLL +  L   F  A
Sbjct: 11  LERRIGHQFEDRELLERALTHASVGDGAKKVRDNEVLEFIGDRVLGLLAAEALAQRFPKA 70

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           KEGEL+ R N+LVS ETC++VAR  +L   +R+S+   K       SI A   E+L+AAL
Sbjct: 71  KEGELAPRLNALVSRETCARVARVAELGPALRLSASSSKIGGRETESILAGATEALMAAL 130

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFR-RDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           Y DGG++ A       W     ++G+ R RD KT LQEWA  K    P Y+V  R+GPDH
Sbjct: 131 YQDGGLDAARRVFLSLWADEFDRAGEGRPRDPKTALQEWAQGKGRPLPTYRVLDRTGPDH 190

Query: 186 DPRFTVVVEISGLAPAQGMDCSK 208
            P FTV V ++G+ PA     S+
Sbjct: 191 APVFTVEVVVAGVDPAMAKGKSR 213


>gi|312115946|ref|YP_004013542.1| ribonuclease III [Rhodomicrobium vannielii ATCC 17100]
 gi|311221075|gb|ADP72443.1| ribonuclease III [Rhodomicrobium vannielii ATCC 17100]
          Length = 236

 Score =  154 bits (389), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 96/222 (43%), Positives = 128/222 (57%), Gaps = 1/222 (0%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSI-SHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           R   LE  +GY F  R LL +ALTHSS  S       ERLEFLGDR+LGL I+ LLF  F
Sbjct: 7   RVEELEASLGYKFQERGLLAEALTHSSARSEKGGRDNERLEFLGDRVLGLSIAALLFERF 66

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             A+E EL+  FN+LV   TC++VA +L+L   + ++    +        I AD VE+L+
Sbjct: 67  PKAREVELARHFNALVCKTTCAEVALKLELGPHLVMAPSEARSGGRKKDVILADAVEALL 126

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
            A+ +DGG   A T V ++W+     S     DAKT LQE+A ++    P+Y    RSG 
Sbjct: 127 GAISVDGGFAAAETVVHRHWEPFIASSEPPAPDAKTALQEFAQSQKRGLPDYHEVERSGA 186

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           DH P FTV V + GL P +G   S + A+Q AA  +LKREG+
Sbjct: 187 DHAPNFTVEVRVQGLKPERGTGSSLKKAQQAAAEALLKREGV 228


>gi|144899862|emb|CAM76726.1| ribonuclease III [Magnetospirillum gryphiswaldense MSR-1]
          Length = 229

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 85/217 (39%), Positives = 116/217 (53%), Gaps = 4/217 (1%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSY----QESYERLEFLGDRILGLLIS 56
           M A     L +R+G+ FA   LL +ALTH S++          YERLEFLGDR+LGL+++
Sbjct: 1   MDAGPIHDLCQRLGHEFAQSQLLTQALTHPSVAQGRAPRRNTPYERLEFLGDRVLGLVVA 60

Query: 57  TLLFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA 116
            +LF+ F +  EG L+ R  +LV  E+ + VA ++ L   + +S            ++ A
Sbjct: 61  DMLFHRFPTEAEGALARRHAALVRRESLAVVAGQIGLPPCLTLSKGEEDAGGRGNPALLA 120

Query: 117 DVVESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYK 176
           D  E++I ALY D G EVA  FV   W      + +  +DAKT LQEWA       P Y 
Sbjct: 121 DACEAVIGALYADAGFEVAARFVRSAWTALMDAAAQPPKDAKTALQEWAQGLGKPLPVYT 180

Query: 177 VTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQ 213
           V  + GP HDP F V V + G+ P  G   SKR AEQ
Sbjct: 181 VVGQDGPPHDPTFVVSVTVEGVDPVHGTGASKRVAEQ 217


>gi|163793042|ref|ZP_02187018.1| SsrA-binding protein [alpha proteobacterium BAL199]
 gi|159181688|gb|EDP66200.1| SsrA-binding protein [alpha proteobacterium BAL199]
          Length = 227

 Score =  153 bits (387), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 85/215 (39%), Positives = 123/215 (57%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           S L + +G+ F +  +L +A+TH+S       +YERLEFLGDR+L L ++  L + F   
Sbjct: 9   SHLAEVLGHTFNHPDILRRAVTHASAEPRAWNAYERLEFLGDRVLALAVAEQLLDRFPHE 68

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           +EG ++ R  SLV  ET + VA  +DL  ++ VS            +I +D +E++IAAL
Sbjct: 69  REGAIAKRHVSLVRRETLADVAHTIDLGRYLIVSRGEDDAGARASDTILSDSMEAVIAAL 128

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           YLDGG+  A  F+ K+W        +  +D KT LQEWA  +    P Y    ++GP H 
Sbjct: 129 YLDGGLAAAQKFILKHWNPLLEMDHRPPQDPKTGLQEWAQGRRLPLPVYTTVEQTGPAHA 188

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           P FTV V + GLAP +    SKR AEQ+AAA +L+
Sbjct: 189 PEFTVEVVVEGLAPQRASGKSKRLAEQLAAAAMLE 223


>gi|77462220|ref|YP_351724.1| RNAse III [Rhodobacter sphaeroides 2.4.1]
 gi|126461082|ref|YP_001042196.1| ribonuclease III [Rhodobacter sphaeroides ATCC 17029]
 gi|221641174|ref|YP_002527436.1| Ribonuclease 3 [Rhodobacter sphaeroides KD131]
 gi|332560101|ref|ZP_08414423.1| ribonuclease III [Rhodobacter sphaeroides WS8N]
 gi|90101641|sp|Q3J5W1|RNC_RHOS4 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|189043337|sp|A3PGF8|RNC_RHOS1 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|254807895|sp|B9KSA7|RNC_RHOSK RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|77386638|gb|ABA77823.1| RNAse III [Rhodobacter sphaeroides 2.4.1]
 gi|126102746|gb|ABN75424.1| RNAse III [Rhodobacter sphaeroides ATCC 17029]
 gi|221161955|gb|ACM02935.1| Ribonuclease 3 [Rhodobacter sphaeroides KD131]
 gi|332277813|gb|EGJ23128.1| ribonuclease III [Rhodobacter sphaeroides WS8N]
          Length = 229

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 117/204 (57%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           E RIG+ F     L +A+THSS+S   +   +RLEFLGDR+LGL+++  L     +A EG
Sbjct: 11  EGRIGHQFREPERLLRAVTHSSLSSVTRSDNQRLEFLGDRVLGLVMAEALLAADRAASEG 70

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLD 129
           +L+ RFN+LV  ETC+ VARE+ L   +++             ++  D +E++IAA+YLD
Sbjct: 71  QLAPRFNALVRKETCAAVAREVALGDVLKLGRSEMMSGGRRKEALLGDALEAVIAAVYLD 130

Query: 130 GGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
            G E A   V + W  R  +  +  RDAKT LQEWA A+    P Y+   RSGPDH P F
Sbjct: 131 AGFEAARQLVLRLWGARIAQVERDARDAKTALQEWAQARGLPPPTYEAVDRSGPDHAPIF 190

Query: 190 TVVVEISGLAPAQGMDCSKRAAEQ 213
           TV V +      +    +KR AEQ
Sbjct: 191 TVEVRLGNGETDRAAAGTKRVAEQ 214


>gi|149200806|ref|ZP_01877781.1| Ribonuclease III [Roseovarius sp. TM1035]
 gi|149145139|gb|EDM33165.1| Ribonuclease III [Roseovarius sp. TM1035]
          Length = 227

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 76/186 (40%), Positives = 112/186 (60%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           + R+G+ F N +LL +ALTHSS++   ++  +RLEFLGDR+LGL+++  L +    A EG
Sbjct: 11  QARLGHEFTNAALLVRALTHSSMATPNRDDNQRLEFLGDRVLGLVMAEALLSQDQGATEG 70

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLD 129
           +L+ RFN+LV  E C+ VARE+DL   +++             ++  D +E++IAA+YLD
Sbjct: 71  QLAPRFNALVRKEACADVAREIDLGGVLKLGRSEMLSGGRRKEALLGDAMEAVIAAVYLD 130

Query: 130 GGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
            G E A   V + W  R     +  RDAKT LQEWA A+    P+Y    R GPDH P F
Sbjct: 131 AGFETARGVVLRLWGARLGAVKEDARDAKTSLQEWAQARGLPPPDYVELARKGPDHAPIF 190

Query: 190 TVVVEI 195
           T+  ++
Sbjct: 191 TICAQL 196


>gi|126726095|ref|ZP_01741937.1| ribonuclease III [Rhodobacterales bacterium HTCC2150]
 gi|126705299|gb|EBA04390.1| ribonuclease III [Rhodobacterales bacterium HTCC2150]
          Length = 228

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 80/183 (43%), Positives = 115/183 (62%), Gaps = 6/183 (3%)

Query: 12  RIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGEL 71
           RIG+ F+   LL +A+TH+SIS + +   +RLEFLGDRILGL+++  L N   SA EG L
Sbjct: 13  RIGHEFSKPELLVEAVTHASISSANRSDNQRLEFLGDRILGLVMAEALLNADTSANEGTL 72

Query: 72  SVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSF---MTSIQADVVESLIAALYL 128
           + RFN+LV  ETC+ VARE+DL + +++    R ++ S      ++  D +E++IAA+YL
Sbjct: 73  APRFNALVRKETCADVAREIDLGAVLKLG---RSEMISGGRRKLALLGDAMEAVIAAVYL 129

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           D G E A  F+ + W +R     +  RD K+ LQEWA A+    P YK+  R G DH P 
Sbjct: 130 DAGFEAARDFILRSWGERINAVDEDARDPKSSLQEWAQARKMPPPVYKLLRREGADHAPM 189

Query: 189 FTV 191
           FT+
Sbjct: 190 FTI 192


>gi|58584360|ref|YP_197933.1| dsRNA-specific ribonuclease [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|75498100|sp|Q5GTI3|RNC_WOLTR RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|58418676|gb|AAW70691.1| dsRNA-specific ribonuclease [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
          Length = 243

 Score =  152 bits (385), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 84/219 (38%), Positives = 123/219 (56%), Gaps = 4/219 (1%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSI----SHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           T+ K I Y F N ++LE+ALTH S+    S +  E+YERLEFLGD IL +++S +LF  F
Sbjct: 17  TISKIINYRFKNDAILEEALTHPSLNKRNSKNQIENYERLEFLGDSILNMIVSAILFRLF 76

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
              KEG L+ R   LV   T + VA+E+ L +FI +++  R +          + +E+LI
Sbjct: 77  PKEKEGALARRKTDLVCGNTIANVAKEIKLGNFIIMNNSERCNGGKRNLKNLENALEALI 136

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
            A+Y+DGG      FV K+W++RA       +D KT LQEW        PEY++  ++GP
Sbjct: 137 GAIYIDGGFANVKKFVTKHWEERAKGMLSLPQDPKTSLQEWTQKNKLPLPEYELMKQTGP 196

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
            H P FT+ + I           SK+ AEQ AA  +L++
Sbjct: 197 AHSPEFTISICIENYGKVFACASSKKVAEQKAAELMLEK 235


>gi|99082399|ref|YP_614553.1| RNAse III [Ruegeria sp. TM1040]
 gi|99038679|gb|ABF65291.1| RNAse III [Ruegeria sp. TM1040]
          Length = 242

 Score =  152 bits (384), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 121/203 (59%), Gaps = 6/203 (2%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           + R+G+ F++  LL +ALTH S+S   ++  +RLEFLGDR+LGL+++T L  H   A EG
Sbjct: 25  QARLGHEFSSPELLIRALTHPSVSSPNRQDNQRLEFLGDRVLGLVMATALLEHDKDATEG 84

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA---DVVESLIAAL 126
           +L+ RFN+LV  ETC+ VAR++DL + +++    R ++ S     QA   D +E++IAA+
Sbjct: 85  QLAPRFNALVRKETCADVARQIDLGAVLKLG---RSEMLSGGRRKQALLGDAMEAVIAAV 141

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           Y D G E A + + + W +R     +  RD KT LQE+  A+    P Y +  R GPDH+
Sbjct: 142 YRDAGFEAAQSVILRLWGKRVGTVEEDARDPKTALQEFVQARRQPPPAYVLVARKGPDHE 201

Query: 187 PRFTVVVEISGLAPAQGMDCSKR 209
           P FT+   +      Q    SKR
Sbjct: 202 PIFTIAARLEDGTEEQATAGSKR 224


>gi|103486701|ref|YP_616262.1| ribonuclease III [Sphingopyxis alaskensis RB2256]
 gi|123253313|sp|Q1GTU3|RNC_SPHAL RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|98976778|gb|ABF52929.1| RNAse III [Sphingopyxis alaskensis RB2256]
          Length = 226

 Score =  152 bits (383), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 119/208 (57%), Gaps = 7/208 (3%)

Query: 4   LRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           L    L   IG    + +L + ALTH S   +    Y+RLEFLGDR+LGL++++ L+  F
Sbjct: 5   LNTEALADIIGCIPDDLTLYDLALTHGSTGRA---DYQRLEFLGDRVLGLVLASELYTRF 61

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
            +A EGE+S R + L S  TC+ +A+ LDL + IR  +  R D      +I AD +E+LI
Sbjct: 62  PAASEGEMSSRLHVLASGATCAAIAQRLDLPALIRFGAQARSDGGRHSDNIAADAIEALI 121

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGK--FRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
            AL+L+ GIE A TF+   W   AL  G+    +  K  LQEWA A+    PEY++  R 
Sbjct: 122 GALFLERGIEAARTFILAQWG--ALIDGQQAAPKHPKAALQEWALARGRRPPEYEIVSRE 179

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKR 209
           GPDH PRF + V I  LA A+    SK+
Sbjct: 180 GPDHAPRFRIAVSIGKLARAEAQGASKQ 207


>gi|87199824|ref|YP_497081.1| ribonuclease III [Novosphingobium aromaticivorans DSM 12444]
 gi|87135505|gb|ABD26247.1| RNAse III [Novosphingobium aromaticivorans DSM 12444]
          Length = 252

 Score =  151 bits (381), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 114/203 (56%), Gaps = 3/203 (1%)

Query: 14  GYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELSV 73
           G A A   +  +ALTH S+       Y+RLEFLGDR+LGL I+  L    D+A EG+LS 
Sbjct: 45  GAAPARPEIWAEALTHGSMGEP--RDYQRLEFLGDRVLGLAIADWLHEKSDAA-EGKLSQ 101

Query: 74  RFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIE 133
           R N+LVS ETC+ VAR + LA  IR+    R D  +   +I  DV+E+LI AL+++ G E
Sbjct: 102 RLNALVSRETCADVARTIGLAGHIRLGKQARDDGGAQSDNILGDVMEALIGALFVERGFE 161

Query: 134 VAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVVV 193
            A  FV K W++  L     R+  K  LQEWA       P Y +  R GPDH   FTV V
Sbjct: 162 AARKFVRKAWEKPMLSGTGQRKHPKAALQEWAAGNRRKPPVYTLVSREGPDHAATFTVSV 221

Query: 194 EISGLAPAQGMDCSKRAAEQVAA 216
           E+ G+  A     SK+ AE  AA
Sbjct: 222 EVKGVGEASARGSSKQEAETAAA 244


>gi|254511570|ref|ZP_05123637.1| ribonuclease III [Rhodobacteraceae bacterium KLH11]
 gi|221535281|gb|EEE38269.1| ribonuclease III [Rhodobacteraceae bacterium KLH11]
          Length = 225

 Score =  151 bits (381), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 82/202 (40%), Positives = 117/202 (57%), Gaps = 6/202 (2%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           ++R+GY F++  LL ++LTH S+S S +   +RLEFLGDR+LGL+++T L      A EG
Sbjct: 11  QQRLGYEFSDPELLVRSLTHGSVSSSTRPDNQRLEFLGDRVLGLVMATALLEADKKASEG 70

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA---DVVESLIAAL 126
           +L+ RFN+LV  E C+ VAR++DL + +++    R ++ S     QA   D +E++IAA+
Sbjct: 71  QLAPRFNALVRKEACADVARQIDLGAVLKLG---RSEMLSGGRRKQALLGDAMEAVIAAI 127

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           Y D G E A   +   W  R        RDAKT LQEWA A+    P Y    R+GPDH 
Sbjct: 128 YRDAGFEAARDVILALWGDRIHMVEADARDAKTSLQEWAQARGQKPPAYVEVKRTGPDHA 187

Query: 187 PRFTVVVEISGLAPAQGMDCSK 208
           P FT+   +     AQ    SK
Sbjct: 188 PVFTIAARLQDGTEAQATAGSK 209


>gi|149913470|ref|ZP_01902003.1| 4'-phosphopantetheinyl transferase [Roseobacter sp. AzwK-3b]
 gi|149812590|gb|EDM72419.1| 4'-phosphopantetheinyl transferase [Roseobacter sp. AzwK-3b]
          Length = 227

 Score =  150 bits (380), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 116/185 (62%), Gaps = 6/185 (3%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           E+R+G+ F   +LL +A+THSS++   ++  +RLEFLGDR+LGL+++  L     SA+EG
Sbjct: 11  EERLGHRFEQSALLVRAVTHSSMASPTRDDNQRLEFLGDRVLGLVMAEALLERDRSAEEG 70

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA---DVVESLIAAL 126
            L+ RFN+LV  E C+ VARE+ L   +++    R ++ S     QA   D +E++IAA+
Sbjct: 71  LLAPRFNALVRKEACADVAREIALGDVLKLG---RSEMLSGGRRKQALLGDAMEAVIAAV 127

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           Y D G +VA   V + W +R     +  RDAKT LQEWA A+    P Y  T RSGPDH 
Sbjct: 128 YRDAGFDVAKAVVLRLWGKRIDSVKEDARDAKTALQEWAQARGQTPPAYVETARSGPDHA 187

Query: 187 PRFTV 191
           P+FT+
Sbjct: 188 PQFTI 192


>gi|126728500|ref|ZP_01744316.1| Ribonuclease III [Sagittula stellata E-37]
 gi|126711465|gb|EBA10515.1| Ribonuclease III [Sagittula stellata E-37]
          Length = 225

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 73/183 (39%), Positives = 113/183 (61%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE ++G+ F +++LL +A+TH+S+S   +E  +RLEFLGDR+LGL+++  L  H  +A E
Sbjct: 10  LEDKLGHTFRDKALLRRAVTHASMSGPGREDNQRLEFLGDRVLGLVMAEALLAHDRNASE 69

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G L+ RFN+LV  ETC++VAR + +   +++    +        ++  D +E++IAA+YL
Sbjct: 70  GLLAPRFNALVRKETCAEVARTIGVGDALKLGRSEQMSGGRRKQALLGDAMEAVIAAVYL 129

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           DGG +VA   + + W        +  +DAKT LQEWA  +    P Y    RSGPDH P 
Sbjct: 130 DGGFDVAQDMILRLWAPLIASVEEDAKDAKTTLQEWAQGRGMTPPSYTEVERSGPDHAPV 189

Query: 189 FTV 191
           FT+
Sbjct: 190 FTI 192


>gi|83311357|ref|YP_421621.1| dsRNA-specific ribonuclease [Magnetospirillum magneticum AMB-1]
 gi|82946198|dbj|BAE51062.1| dsRNA-specific ribonuclease [Magnetospirillum magneticum AMB-1]
          Length = 228

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 121/214 (56%), Gaps = 4/214 (1%)

Query: 13  IGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           +G+AFA   LL +ALTH S+    +    + YERLEFLGDR+LGL+++ +LF+ F +  E
Sbjct: 12  LGHAFARPELLAQALTHPSMHQGRKSRTSDPYERLEFLGDRVLGLVVAEMLFSRFPNEAE 71

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G L+ R  +LV  E  +++A E+ L   + ++             I AD  E++I ALY 
Sbjct: 72  GALARRHAALVRREAVARIATEIGLGRCLVLAKGEDDAGGRANPGILADACEAVIGALYA 131

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           D G  VA +FV   W+    ++    +DAKT LQEWA  +    P Y+V  + GP H+P 
Sbjct: 132 DAGFAVAASFVRSRWEPMMEEALAPPKDAKTGLQEWAQGRGKPLPHYQVLGQEGPPHEPI 191

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           F + V + G+  A G   SKR AEQ AA  +L++
Sbjct: 192 FLIEVSVEGVGSAVGRGASKRVAEQAAAGLLLEQ 225


>gi|86135727|ref|ZP_01054306.1| ribonuclease III [Roseobacter sp. MED193]
 gi|85826601|gb|EAQ46797.1| ribonuclease III [Roseobacter sp. MED193]
          Length = 222

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 114/200 (57%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           E+RIG+ F    LL +ALTH S+S   ++  +RLEFLGDR+LGL+++T L +H   A EG
Sbjct: 5   EQRIGHQFVRPELLVRALTHPSVSSPNRKDNQRLEFLGDRVLGLVMATALLDHDKDASEG 64

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLD 129
           +L+ RFN+LV  E C+ VARE++L   +++             ++  D +E++IAA+Y D
Sbjct: 65  QLAPRFNALVRKEACADVAREIELGEVLKLGRSEMMSGGRRKLALLGDGMEAVIAAVYKD 124

Query: 130 GGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
            G EVA   + + W  R  +     RD KT LQE+  A+    P Y    R+GPDH P F
Sbjct: 125 AGFEVAQAMILRLWGARIHQVEADARDPKTALQEYVQARRQNPPAYVQVARTGPDHQPIF 184

Query: 190 TVVVEISGLAPAQGMDCSKR 209
           T+ V +      +    SKR
Sbjct: 185 TIAVRLEDGTEERATAGSKR 204


>gi|259417917|ref|ZP_05741836.1| ribonuclease III [Silicibacter sp. TrichCH4B]
 gi|259346823|gb|EEW58637.1| ribonuclease III [Silicibacter sp. TrichCH4B]
          Length = 228

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 79/203 (38%), Positives = 119/203 (58%), Gaps = 6/203 (2%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           + R+G+ F++  LL +ALTH S+S   ++  +RLEFLGDR+LGL+++T L  H   A EG
Sbjct: 11  QARLGHEFSSPELLIRALTHPSVSSPNRQDNQRLEFLGDRVLGLVMATALLEHDKHATEG 70

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA---DVVESLIAAL 126
           +L+ RFN+LV  E C+ VAR++DL + +++    R ++ S     QA   D +E++IAA+
Sbjct: 71  QLAPRFNALVRKEACADVARQIDLGAVLKLG---RSEMLSGGRRKQALLGDAMEAVIAAV 127

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           Y D G E A   + + W +R        RD KT LQE+  A+    P Y +  R+GPDH+
Sbjct: 128 YKDAGFEAAQNVILRLWGKRVGTVEDDARDPKTALQEFVQARRQPPPAYVLIARTGPDHE 187

Query: 187 PRFTVVVEISGLAPAQGMDCSKR 209
           P FT+   +      Q    SKR
Sbjct: 188 PVFTIAARLEDGTEEQATAGSKR 210


>gi|73667460|ref|YP_303476.1| ribonuclease III [Ehrlichia canis str. Jake]
 gi|90101626|sp|Q3YQX7|RNC_EHRCJ RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|72394601|gb|AAZ68878.1| RNAse III [Ehrlichia canis str. Jake]
          Length = 226

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 85/217 (39%), Positives = 122/217 (56%), Gaps = 2/217 (0%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSI--SHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           T+ K I Y F N  LL +ALTH SI    S + +YERLEFLGD +L ++IS +LFN F  
Sbjct: 4   TISKTIKYHFKNPQLLHEALTHPSIISKDSLKFNYERLEFLGDAVLNIVISEMLFNIFPK 63

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG L+ +  +LV      +VA+ ++L  FI +S   R    +   +   + +E+LI A
Sbjct: 64  DTEGNLAKKKTALVCGNQLVKVAQSINLGQFIIMSDGERTCGGANNHNNLENALEALIGA 123

Query: 126 LYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           +YLDGG+  A  F+  +WK  A+      +DAKT LQE+   K    P Y +  +SGPDH
Sbjct: 124 IYLDGGLTAAQNFIHSFWKHTAIHMDIPPQDAKTILQEFIQGKRLPAPTYHIIDKSGPDH 183

Query: 186 DPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           +P FTV + I      Q    +K+ AEQ AA+ +L +
Sbjct: 184 NPIFTVELRIPLYKTIQATGNNKKLAEQKAASLMLNQ 220


>gi|149186754|ref|ZP_01865065.1| ribonuclease III [Erythrobacter sp. SD-21]
 gi|148829662|gb|EDL48102.1| ribonuclease III [Erythrobacter sp. SD-21]
          Length = 223

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 91/227 (40%), Positives = 132/227 (58%), Gaps = 7/227 (3%)

Query: 1   MSALRYSTLE--KRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTL 58
           MSAL   T E  ++ G+   N +L + ALTH S+    ++ YERLEFLGDR+LGL I+  
Sbjct: 1   MSALEPDTREWLEKTGFTVNNEALWQAALTHGSMGE--KDDYERLEFLGDRVLGLSIAHW 58

Query: 59  LFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADV 118
           L+   D A EG+L+ R N++VS E C+ VAR ++L+  +R+S   R D      +I  DV
Sbjct: 59  LYEQSD-APEGKLAQRLNAIVSREMCAIVARGIELSEHMRISKQARADGGKDSDNILGDV 117

Query: 119 VESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFR-RDAKTELQEWAHAKFGVTPEYKV 177
           +E+L+ A +LD G + +   V   W+  AL+SG    +  K+ LQEWA       PEY+V
Sbjct: 118 MEALLGAQFLDNGFKKSRELVHVLWRP-ALESGAGESKHPKSALQEWAAGNRRKPPEYEV 176

Query: 178 TFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
             RSGPDH  +FTV V +  +  A     SK  AE+ AA + +++ G
Sbjct: 177 VERSGPDHAAQFTVKVSVHKVGEATATAGSKGEAERAAAKKFMEKFG 223


>gi|91201952|emb|CAJ75012.1| similar to ribonuclease III [Candidatus Kuenenia stuttgartiensis]
          Length = 236

 Score =  149 bits (376), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 124/211 (58%), Gaps = 3/211 (1%)

Query: 13  IGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELS 72
           IGY+F    LLEKALTH+S       S ERLEFLGD +LG++IS  L+       EGEL+
Sbjct: 20  IGYSFKKMLLLEKALTHTSCRVENNFSNERLEFLGDAVLGMIISDYLYKTMPHYSEGELT 79

Query: 73  VRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGI 132
              + +VS  T ++V  E  L  F+ V   L  D   F  S+ A+V E+LIAA+Y+DGGI
Sbjct: 80  NVKSVVVSQSTLAKVGMEAGLKEFLLVGRGLN-DRDLFPKSLLANVFEALIAAIYIDGGI 138

Query: 133 EVAGTFVDKYWKQRA--LKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFT 190
           E A  F  +Y K+    +   + +++ K+ LQ+++  ++G+TP Y++  + GPDH   F 
Sbjct: 139 EAASEFTLRYLKKEIDLVCKNQHKKNYKSILQQYSQKEYGITPTYRLLQQIGPDHGKSFE 198

Query: 191 VVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           +VV I G    +G   SK+ AEQ AA E LK
Sbjct: 199 IVVSIKGSEYGRGWGKSKKEAEQSAAKEALK 229


>gi|99035124|ref|ZP_01314908.1| hypothetical protein Wendoof_01000254 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 234

 Score =  149 bits (375), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 83/220 (37%), Positives = 123/220 (55%), Gaps = 4/220 (1%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQE----SYERLEFLGDRILGLLISTLLFNHFD 64
           + K I Y F N ++LE+ALTH S++    +    SYERLEFLGD +L +++S  LF  F 
Sbjct: 10  ISKIIDYKFTNYAILEEALTHPSVNKRNSKNQIVSYERLEFLGDSVLNMVVSATLFKLFP 69

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
             KEG L+ R   LV   T + VA+E+ L SFI +++  R +          + +E+LI 
Sbjct: 70  EEKEGALAKRKTDLVCGNTIANVAKEIKLGSFIIMNNSERCNGGRCNLKNLENSLEALIG 129

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           A+Y+DGG+E    F+ +YW++ A       +D KT LQEW        PEY++  ++GP 
Sbjct: 130 AIYIDGGLENVEKFIIQYWEKLAKGMLDPPQDPKTSLQEWTQKNKLPLPEYELVKQTGPA 189

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           H+P FT+ V I           SK+ AEQ AA  +L++ G
Sbjct: 190 HNPEFTISVCIEDYGKVSACASSKKIAEQKAAELMLEKIG 229


>gi|42521037|ref|NP_966952.1| ribonuclease III, putative [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|225630900|ref|YP_002727691.1| ribonuclease III, putative [Wolbachia sp. wRi]
 gi|225677311|ref|ZP_03788288.1| ribonuclease III, putative [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|81652137|sp|Q73FT3|RNC_WOLPM RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|254807910|sp|C0R4Q8|RNC_WOLWR RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|42410778|gb|AAS14886.1| ribonuclease III, putative [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|225590638|gb|EEH11888.1| ribonuclease III, putative [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225592881|gb|ACN95900.1| ribonuclease III, putative [Wolbachia sp. wRi]
          Length = 232

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 83/220 (37%), Positives = 123/220 (55%), Gaps = 4/220 (1%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQE----SYERLEFLGDRILGLLISTLLFNHFD 64
           + K I Y F N ++LE+ALTH S++    +    SYERLEFLGD +L +++S  LF  F 
Sbjct: 8   ISKIIDYKFTNYAILEEALTHPSVNKRNSKNQIVSYERLEFLGDSVLNMVVSATLFKLFP 67

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
             KEG L+ R   LV   T + VA+E+ L SFI +++  R +          + +E+LI 
Sbjct: 68  EEKEGALAKRKTDLVCGNTIANVAKEIKLGSFIIMNNSERCNGGRCNLKNLENSLEALIG 127

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           A+Y+DGG+E    F+ +YW++ A       +D KT LQEW        PEY++  ++GP 
Sbjct: 128 AIYIDGGLENVEKFIIQYWEKLAKGMLDPPQDPKTSLQEWTQKNKLPLPEYELVKQTGPA 187

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           H+P FT+ V I           SK+ AEQ AA  +L++ G
Sbjct: 188 HNPEFTISVCIEDYGKVSACASSKKIAEQKAAELMLEKIG 227


>gi|57239534|ref|YP_180670.1| ribonuclease III [Ehrlichia ruminantium str. Welgevonden]
 gi|58579518|ref|YP_197730.1| ribonuclease III [Ehrlichia ruminantium str. Welgevonden]
 gi|81352757|sp|Q5HA74|RNC_EHRRW RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|57161613|emb|CAH58541.1| ribonuclease III [Ehrlichia ruminantium str. Welgevonden]
 gi|58418144|emb|CAI27348.1| Ribonuclease III [Ehrlichia ruminantium str. Welgevonden]
          Length = 227

 Score =  148 bits (374), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 84/218 (38%), Positives = 124/218 (56%), Gaps = 2/218 (0%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSI--SHSYQESYERLEFLGDRILGLLISTLLFNHFD 64
           + + K I Y F N  LL +ALTH S+    +   +YERLEFLGD +L L+IS +LFN F 
Sbjct: 4   NAISKIIKYDFKNTQLLNEALTHPSVLSKDNNNFNYERLEFLGDAVLNLVISEMLFNIFP 63

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EG L+ +  +LV      ++A+ ++L  FI +S   R    +  ++   + +E+LI 
Sbjct: 64  YDTEGNLAKKKTALVCGTKLVEIAQSINLGIFIIMSDGERSCGGANNSNNLENALEALIG 123

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           A+YLDGG++ A  F+  +WK  A       +DAKT LQEWA +K    P Y +  +SGPD
Sbjct: 124 AIYLDGGLKAAKDFIFLFWKNSATHMKVPPQDAKTILQEWAQSKGFPAPSYHIINKSGPD 183

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           H+P FTV V I+          +K+ AEQ AA+ +L +
Sbjct: 184 HNPCFTVEVRINSHETLHATGHNKKLAEQKAASLMLAK 221


>gi|213018872|ref|ZP_03334680.1| ribonuclease III [Wolbachia endosymbiont of Culex quinquefasciatus
           JHB]
 gi|212995823|gb|EEB56463.1| ribonuclease III [Wolbachia endosymbiont of Culex quinquefasciatus
           JHB]
          Length = 233

 Score =  148 bits (374), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 80/219 (36%), Positives = 125/219 (57%), Gaps = 4/219 (1%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSISHSYQE----SYERLEFLGDRILGLLISTLLFNHF 63
           T+ K I Y F + ++LE+ALTH S++    E    SYERLEFLGD +L +++S +LF  F
Sbjct: 10  TISKVINYKFTDYAILEEALTHPSVNKRNSEDQVVSYERLEFLGDSVLNMVVSVMLFKMF 69

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
              KEG L+ R   LV   T + VA+E++L +FI +++  R +          + +E+LI
Sbjct: 70  PEEKEGALAKRKTDLVCGSTIANVAKEIELGNFIIMNNSERCNGGKCNLKNLENSLEALI 129

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
            A+Y+DGG+E    F+ ++W++ A       +D KT LQEW        P+Y++  ++GP
Sbjct: 130 GAIYIDGGLESVEKFIIRHWEKLAKDILDPPQDPKTSLQEWTQRNKLPLPKYELVKQTGP 189

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
            H+P FT+ V I           SK+ AEQ AA  +L++
Sbjct: 190 AHNPEFTISVCIESYDKVSACAPSKKIAEQKAAELILEK 228


>gi|190571469|ref|YP_001975827.1| ribonuclease III [Wolbachia endosymbiont of Culex quinquefasciatus
           Pel]
 gi|238056573|sp|B3CMS0|RNC_WOLPP RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|190357741|emb|CAQ55192.1| ribonuclease III [Wolbachia endosymbiont of Culex quinquefasciatus
           Pel]
          Length = 230

 Score =  148 bits (374), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 80/219 (36%), Positives = 125/219 (57%), Gaps = 4/219 (1%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSISHSYQE----SYERLEFLGDRILGLLISTLLFNHF 63
           T+ K I Y F + ++LE+ALTH S++    E    SYERLEFLGD +L +++S +LF  F
Sbjct: 7   TISKVINYKFTDYAILEEALTHPSVNKRNSEDQVVSYERLEFLGDSVLNMVVSVMLFKMF 66

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
              KEG L+ R   LV   T + VA+E++L +FI +++  R +          + +E+LI
Sbjct: 67  PEEKEGALAKRKTDLVCGSTIANVAKEIELGNFIIMNNSERCNGGKCNLKNLENSLEALI 126

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
            A+Y+DGG+E    F+ ++W++ A       +D KT LQEW        P+Y++  ++GP
Sbjct: 127 GAIYIDGGLESVEKFIIRHWEKLAKDILDPPQDPKTSLQEWTQRNKLPLPKYELVKQTGP 186

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
            H+P FT+ V I           SK+ AEQ AA  +L++
Sbjct: 187 AHNPEFTISVCIESYDKVSACAPSKKIAEQKAAELILEK 225


>gi|4378851|gb|AAD19719.1| ribonuclease III [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 222

 Score =  148 bits (373), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 74/190 (38%), Positives = 112/190 (58%), Gaps = 3/190 (1%)

Query: 19  NRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELSVRFNSL 78
           + +L  +A+TH S  +S    Y+RLEFLGDR+LGL+I+  L++ F    EG+LS R NSL
Sbjct: 19  DPALFLRAMTHPSHGNS---DYQRLEFLGDRVLGLVIANWLYDLFPREPEGKLSRRLNSL 75

Query: 79  VSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIEVAGTF 138
           VS  +C+ +AR + L  ++R+    R D  +   ++  DV+E++I A++L+ GIE AG  
Sbjct: 76  VSGASCASIARIVGLPQWLRLGKQARDDGAAASDNVLGDVMEAMIGAIFLESGIEAAGKL 135

Query: 139 VDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVVVEISGL 198
           + KYW           +  K+ LQEWA A     P Y++  R+GP H+P FT+ V I+G+
Sbjct: 136 IHKYWAPLVTGQESAPKHPKSALQEWAAAHNRRPPVYEIVSRTGPQHNPCFTIQVSIAGV 195

Query: 199 APAQGMDCSK 208
             A     SK
Sbjct: 196 GEASAEGSSK 205


>gi|58698421|ref|ZP_00373332.1| ribonuclease III [Wolbachia endosymbiont of Drosophila ananassae]
 gi|58535076|gb|EAL59164.1| ribonuclease III [Wolbachia endosymbiont of Drosophila ananassae]
          Length = 232

 Score =  147 bits (372), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 82/218 (37%), Positives = 122/218 (55%), Gaps = 4/218 (1%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQE----SYERLEFLGDRILGLLISTLLFNHFD 64
           + K I Y F N ++LE+ALTH S++    +    SYERLEFLGD +L +++S  LF  F 
Sbjct: 8   ISKIIDYKFTNYAILEEALTHPSVNKRNSKNQIVSYERLEFLGDSVLNMVVSATLFKLFP 67

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
             KEG L+ R   LV   T + VA+E+ L SFI +++  R +          + +E+LI 
Sbjct: 68  EEKEGALAKRKTDLVCGNTIANVAKEIKLGSFIIMNNSERCNGGRCNLKNLENSLEALIG 127

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           A+Y+DGG+E    F+ +YW++ A       +D KT LQEW        PEY++  ++GP 
Sbjct: 128 AIYIDGGLENVEKFIIQYWEKLAKGMLDPPQDPKTSLQEWTQKNKLPLPEYELVKQTGPA 187

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           H+P FT+ V I           SK+ AEQ AA  +L++
Sbjct: 188 HNPEFTISVCIEDYGKVSACASSKKIAEQKAAELMLEK 225


>gi|58617572|ref|YP_196771.1| ribonuclease III [Ehrlichia ruminantium str. Gardel]
 gi|75432734|sp|Q5FGH0|RNC_EHRRG RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|58417184|emb|CAI28297.1| Ribonuclease III [Ehrlichia ruminantium str. Gardel]
          Length = 227

 Score =  147 bits (372), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 83/218 (38%), Positives = 124/218 (56%), Gaps = 2/218 (0%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSI--SHSYQESYERLEFLGDRILGLLISTLLFNHFD 64
           + + K I Y F N  LL +ALTH S+    +   +YERLEFLGD +L L++S +LFN F 
Sbjct: 4   NAISKIIKYDFKNTQLLNEALTHPSVLSKDNNNFNYERLEFLGDAVLNLVVSEMLFNIFP 63

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EG L+ +  +LV      ++A+ ++L  FI +S   R    +  ++   + +E+LI 
Sbjct: 64  YDTEGNLAKKKTALVCGTKLVEIAQSINLGIFIIMSDGERSCGGANNSNNLENALEALIG 123

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           A+YLDGG++ A  F+  +WK  A       +DAKT LQEWA +K    P Y +  +SGPD
Sbjct: 124 AIYLDGGLKAAKDFIFLFWKNSATHMKVPPQDAKTILQEWAQSKGFPAPSYHIINKSGPD 183

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           H+P FTV V I+          +K+ AEQ AA+ +L +
Sbjct: 184 HNPCFTVEVRINSHETLHATGHNKKLAEQKAASLMLAK 221


>gi|326402425|ref|YP_004282506.1| ribonuclease III [Acidiphilium multivorum AIU301]
 gi|325049286|dbj|BAJ79624.1| ribonuclease III [Acidiphilium multivorum AIU301]
          Length = 221

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 85/215 (39%), Positives = 127/215 (59%), Gaps = 3/215 (1%)

Query: 10  EKRIGYAFANRSLLEKALTH-SSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           E  +G+ FA   LL +ALTH S++      S ERLEF+GDR+LGLLI+  L   F   +E
Sbjct: 6   EALLGHRFARPDLLAQALTHRSAVGQGGLGSNERLEFIGDRVLGLLIAEWLIERFPHERE 65

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G L  R   LVS ++ +++A    +A  + VS    +       ++ AD +E+LI ALYL
Sbjct: 66  GGLGPRLAHLVSRQSLAEIAEHGGIAGLLSVSPGESRRGVRNRATVLADALEALIGALYL 125

Query: 129 DGGIEVAGTFVDKYWKQRA-LKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDP 187
           DGG+E A  F+ + +  R   +     +D KT LQE+A A+  V P Y++  R+GP H P
Sbjct: 126 DGGLEPARLFIRRIFAPRIDGQPSAPPKDPKTALQEYALARGPVLPAYELVERTGPSHAP 185

Query: 188 RFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           RF + V ++G A A+G+  +KR AEQ AA ++L++
Sbjct: 186 RFRIRVTVAGRA-AEGLAGTKREAEQNAARDLLEQ 219


>gi|254455346|ref|ZP_05068775.1| ribonuclease III [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082348|gb|EDZ59774.1| ribonuclease III [Candidatus Pelagibacter sp. HTCC7211]
          Length = 220

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 84/218 (38%), Positives = 122/218 (55%), Gaps = 3/218 (1%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFD 64
            Y +LEK+I   F N +LL ++LTH S  H+  ++ E++EFLGDR+LGL+I+  L   + 
Sbjct: 4   NYQSLEKKINIKFKNTNLLIQSLTHKS--HNSLKNNEKIEFLGDRVLGLVIAKKLLEIYP 61

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
             KEG L  +F SLV+  TC ++A+ ++L  +I ++ +L          I +D  E+LI 
Sbjct: 62  DEKEGILDKKFASLVNKRTCLEIAKNINLEKYI-LTFNLNNKKIKIEDKIISDCCEALIG 120

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           ALYLD G+ +    +   WK    KS   + DAKT+LQE A   F   P YK+   +GP 
Sbjct: 121 ALYLDKGLNITEKIILDLWKNHIKKSVVTQIDAKTKLQELALKNFKKLPIYKLISNTGPR 180

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           H P F V V++        +  SK+ AEQ AA E LK 
Sbjct: 181 HKPLFKVGVKLPNTKYFIALGKSKKDAEQNAAIECLKN 218


>gi|330993372|ref|ZP_08317307.1| Ribonuclease 3 [Gluconacetobacter sp. SXCC-1]
 gi|329759402|gb|EGG75911.1| Ribonuclease 3 [Gluconacetobacter sp. SXCC-1]
          Length = 258

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 85/230 (36%), Positives = 123/230 (53%), Gaps = 15/230 (6%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQE--------------SYERLEFLGDRILGLL 54
           LE  +GY F    LL +ALTH S +H                  S ERLEF+GDR+LGL+
Sbjct: 14  LEACLGYHFTRPELLLRALTHRSAAHERSGNRRTRQNVATRGAGSNERLEFIGDRVLGLV 73

Query: 55  ISTLLFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSI 114
           ++  L   F + +EG L  R   LVS    ++VA  + L S + V+    +     M ++
Sbjct: 74  MAEWLLERFPTEQEGALGPRHAHLVSRTVLAEVAHAMALQSALDVAEHEARAGVRQMANV 133

Query: 115 QADVVESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPE 174
            AD VE+++ A+YLDGG++ A  FV + W+   +   +  +D KT LQEW   +    P 
Sbjct: 134 LADAVEAILGAIYLDGGLDPARAFVRRMWQDAIVAQARPPKDPKTALQEWVLGRGLPLPR 193

Query: 175 YKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           Y+V    GP H PRF + V+  G    QG+  SKRAAE  AAA++L++ G
Sbjct: 194 YRVVSAEGPSHAPRFVIAVDAQGKT-GQGVAGSKRAAESDAAADLLRQLG 242


>gi|111073612|emb|CAL29457.1| Ribonuclease III [Wolbachia endosymbiont of Onchocerca volvulus]
          Length = 243

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 118/213 (55%), Gaps = 4/213 (1%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSI----SHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           T+ + I Y F N S+L++ALTH S+    S +  E+YERLEFLGD IL +++ST+LF  F
Sbjct: 15  TISEIINYRFKNYSILKEALTHPSLNKRNSKNQIENYERLEFLGDSILNMVVSTILFKLF 74

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
              KEG L+ R   LV   T + VA+ + L  FI + +  R +   +      + +E+LI
Sbjct: 75  PKEKEGRLAKRKTDLVCGSTIANVAKVIKLGDFIIMDNSERCNGGKYNLKNLENALEALI 134

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
            A+Y+DGG      FV +YW++ A       +D KT LQEW        P+Y++  ++GP
Sbjct: 135 GAIYIDGGFRNVERFVTQYWEKLAKYMLNPPQDPKTSLQEWTQKNKLPLPKYELKKQTGP 194

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
            H+P FT+ V I           SK+ AEQ AA
Sbjct: 195 AHNPEFTISVYIKNYGRVSACASSKKVAEQKAA 227


>gi|288958023|ref|YP_003448364.1| ribonuclease III [Azospirillum sp. B510]
 gi|288910331|dbj|BAI71820.1| ribonuclease III [Azospirillum sp. B510]
          Length = 261

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 81/227 (35%), Positives = 128/227 (56%), Gaps = 10/227 (4%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSI---------SHSYQE-SYERLEFLGDRILGLLISTL 58
           L + +G+ F+N +LL  A+TH S+          H     +YERLEFLGDR++GL+++  
Sbjct: 31  LARALGHEFSNPTLLCDAVTHPSLMGLERTGRKGHKGPGIAYERLEFLGDRVVGLVVAQW 90

Query: 59  LFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADV 118
           L   +   +EG L+ R  +LV  E+  +VA  + L +++R+S    +       +I  D 
Sbjct: 91  LLERYPDEREGALAKRHAALVRRESLGRVADAIGLGAYLRLSPAEAQSGGRENRTILGDA 150

Query: 119 VESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
            E+++ A+YLDGG+E    FV +       K+     D+KT LQEWA  +    P Y++T
Sbjct: 151 CEAVLGAMYLDGGLEPVTRFVRQALAGEIDKATPPPLDSKTTLQEWAQGRGKPLPRYELT 210

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
            RSGP H+P F V V ++G+ P  G   SKR AE+ AA+ +L++ G+
Sbjct: 211 ERSGPAHEPLFVVAVHVAGMDPVSGSGSSKRIAEKKAASALLRQVGV 257


>gi|209964796|ref|YP_002297711.1| ribonuclease III [Rhodospirillum centenum SW]
 gi|209958262|gb|ACI98898.1| ribonuclease III [Rhodospirillum centenum SW]
          Length = 236

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 88/219 (40%), Positives = 119/219 (54%), Gaps = 3/219 (1%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSS---ISHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           S LE  +GY F +R LL +ALTH S   +  +    YERLEFLGDR+LGL+I+  L   F
Sbjct: 12  SELETGLGYHFRHRDLLVQALTHPSLGGVERNAGRGYERLEFLGDRVLGLVIAEWLLERF 71

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
            +  EG L+ R  +LV AE  + VA  + L  F+R++   R        +I AD  E++I
Sbjct: 72  PAEAEGALARRHTALVRAEALTVVAETIGLGPFLRLAPSERDSGGQAKPAILADACEAVI 131

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
            A++ DGG+E A T +   W           +D KT LQEWA  +    P Y+   R GP
Sbjct: 132 GAIFQDGGLEPARTLIRTRWTPLIEADLSPPQDPKTALQEWALGRGRPLPAYETLSREGP 191

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           DH P F V V + G  PA     SKRAAE+ AA  +L++
Sbjct: 192 DHAPVFRVRVRVEGAEPATATGPSKRAAEKAAAEALLRQ 230


>gi|260576288|ref|ZP_05844280.1| ribonuclease III [Rhodobacter sp. SW2]
 gi|259021556|gb|EEW24860.1| ribonuclease III [Rhodobacter sp. SW2]
          Length = 231

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 81/190 (42%), Positives = 110/190 (57%), Gaps = 12/190 (6%)

Query: 12  RIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGEL 71
           RIG+ F    LL +A+THSSIS   +   +RLEFLGDR+LGL+++  L     +A EG+L
Sbjct: 13  RIGHVFRQPELLLRAVTHSSISSKTRPDNQRLEFLGDRVLGLVMAEALLTADTAASEGQL 72

Query: 72  SVRFNSLVSAETCSQVARELDLASFIR------VSSDLRKDVCSFMTSIQADVVESLIAA 125
           + RFN+LV  E C+ VAR+L L   ++      +S   RKD      ++  D +E++IAA
Sbjct: 73  APRFNALVRKEACADVARDLGLGEVMKLGRSEMMSGGRRKD------ALLGDALEAVIAA 126

Query: 126 LYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           +YLD G + A   V + W  R        RDAKT LQEWA A+    P Y    R GPDH
Sbjct: 127 VYLDSGFDAARGLVLRLWGGRIGAVQSDARDAKTSLQEWAQARGLPPPAYIELGRDGPDH 186

Query: 186 DPRFTVVVEI 195
            P+FTV V +
Sbjct: 187 QPQFTVEVRL 196


>gi|148259270|ref|YP_001233397.1| ribonuclease III [Acidiphilium cryptum JF-5]
 gi|146400951|gb|ABQ29478.1| RNAse III [Acidiphilium cryptum JF-5]
          Length = 221

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 126/215 (58%), Gaps = 3/215 (1%)

Query: 10  EKRIGYAFANRSLLEKALTH-SSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           E  +G+ FA   LL +ALTH S++      S ERLEF+GDR+LGLLI+  L   F   +E
Sbjct: 6   EALLGHRFARPDLLAQALTHRSAVGQGGLGSNERLEFIGDRVLGLLIAEWLIERFPHERE 65

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G L  R   LVS ++ +++A    +A  + VS    +       ++ AD +E+LI ALYL
Sbjct: 66  GGLGPRLAHLVSRQSLAEIAEHGGIAGLLSVSPGESRRGVRNRATVLADALEALIGALYL 125

Query: 129 DGGIEVAGTFVDKYWKQRA-LKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDP 187
           DGG+E A  F+ + +  R   +     +D KT LQE+A A+  V P Y++  R+GP H P
Sbjct: 126 DGGLEPARLFIRRIFAPRIDGQPSAPPKDPKTALQEYALARGPVLPAYELVERTGPSHAP 185

Query: 188 RFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           RF + V ++G   A+G+  +KR AEQ AA ++L++
Sbjct: 186 RFRIRVTVAGRT-AEGLAGTKREAEQNAARDLLEQ 219


>gi|83593187|ref|YP_426939.1| RNAse III [Rhodospirillum rubrum ATCC 11170]
 gi|83576101|gb|ABC22652.1| RNAse III [Rhodospirillum rubrum ATCC 11170]
          Length = 221

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 83/216 (38%), Positives = 119/216 (55%), Gaps = 2/216 (0%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L+  + + F + +LL +ALTH S     + SYERLEFLGDR+LGL+++ +L+  F + 
Sbjct: 6   NALQIALDHRFTDPALLARALTHRS--REGRPSYERLEFLGDRVLGLVVAEMLYARFPTE 63

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG L+ R  SLV  +T ++VA+ + L   + +S    +    F  S+  DV E+++ AL
Sbjct: 64  DEGALARRHASLVRQDTVARVAQSVGLGELMELSRGEEELGGQFNPSLLCDVCEAVLGAL 123

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           +LDGG   A  FV+  W     +     +DAKT LQEWA  +    P Y V  R GP H 
Sbjct: 124 HLDGGYAKAQRFVEARWAPLMAEDLTPPKDAKTALQEWAQGRGLPLPTYAVEGRDGPPHK 183

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           P FTV V +        +  SKR AEQ AA  +L R
Sbjct: 184 PMFTVSVTVKDNGSESALGASKRLAEQAAAQRLLDR 219


>gi|159042756|ref|YP_001531550.1| ribonuclease III [Dinoroseobacter shibae DFL 12]
 gi|189043308|sp|A8LLD9|RNC_DINSH RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|157910516|gb|ABV91949.1| ribonuclease III [Dinoroseobacter shibae DFL 12]
          Length = 229

 Score =  145 bits (366), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 117/204 (57%), Gaps = 12/204 (5%)

Query: 12  RIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGEL 71
           RIG+ F    LL +ALTH+S S + +   +RLEFLGDR+LGL+++  L      A+EG+L
Sbjct: 13  RIGHRFDRPELLVRALTHASRSTAGRSDNQRLEFLGDRVLGLVMAEALLEADPQAREGQL 72

Query: 72  SVRFNSLVSAETCSQVARELDLASFIR------VSSDLRKDVCSFMTSIQADVVESLIAA 125
           + R+N+LV  ETC++VARE+ L   +R      ++   RKD      ++  D +E++IAA
Sbjct: 73  APRYNALVRKETCAEVAREIGLGDVLRLGRSEMLTGGRRKD------ALLGDGMEAVIAA 126

Query: 126 LYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           +Y D G E A   + + W +R        RD KT LQEWA A+    P Y  + RSGPDH
Sbjct: 127 VYRDAGFEAAKALILRLWGKRIGAVEADARDPKTALQEWAQARGLPPPAYIESARSGPDH 186

Query: 186 DPRFTVVVEISGLAPAQGMDCSKR 209
            P FT+   +   A A+    SKR
Sbjct: 187 APVFTISARLETGACAEAQAGSKR 210


>gi|68171854|ref|ZP_00545186.1| Ribonuclease III [Ehrlichia chaffeensis str. Sapulpa]
 gi|88658070|ref|YP_507839.1| ribonuclease III [Ehrlichia chaffeensis str. Arkansas]
 gi|123492713|sp|Q2GFE4|RNC_EHRCR RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|67998723|gb|EAM85443.1| Ribonuclease III [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599527|gb|ABD44996.1| ribonuclease III [Ehrlichia chaffeensis str. Arkansas]
          Length = 226

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 83/219 (37%), Positives = 120/219 (54%), Gaps = 6/219 (2%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSI--SHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           ++ K I Y F N  LL +ALTH S+    + + +YERLEFLGD +L ++IS +LFN F  
Sbjct: 4   SISKIIKYNFKNPQLLNEALTHPSLVSKDTLKFNYERLEFLGDAVLNIVISEMLFNIFPK 63

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA--DVVESLI 123
             EG L+ +  +LV      +VA+ ++L  FI +S   R   C  + + +   + +E+LI
Sbjct: 64  DTEGNLAKKKTALVCGNKLVEVAQSINLGQFIMMSDGER--ACGGINNFRNLENALEALI 121

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
            A+YLDGG   A  F+  +W+  A       +DAKT LQE    K    P Y    +SGP
Sbjct: 122 GAIYLDGGFTAAQDFIYLFWEHSATHMNVPPQDAKTILQELVQGKRLPAPAYHTIDKSGP 181

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           DH+P FTV V I      Q    +K+ AEQ AA+ +L +
Sbjct: 182 DHNPTFTVEVRIPSYQAIQATGHNKKLAEQKAASLMLNQ 220


>gi|84500562|ref|ZP_00998811.1| Ribonuclease III [Oceanicola batsensis HTCC2597]
 gi|84391515|gb|EAQ03847.1| Ribonuclease III [Oceanicola batsensis HTCC2597]
          Length = 226

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 111/198 (56%)

Query: 12  RIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGEL 71
           RIG+ F    LL +++THSS+S   ++  +RLEFLGDR+LGL+++  L     +A EG+L
Sbjct: 13  RIGHDFRRPELLVQSVTHSSVSSPTRDDNQRLEFLGDRVLGLVMAEALLASDRAASEGQL 72

Query: 72  SVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGG 131
           + RFN+LV  E C+ VARE+ L + +++    +        ++  D +E++IAA+YLDGG
Sbjct: 73  APRFNALVRKEACADVAREVGLGAVLKLGRSEQLSGGRRKQALLGDAMEAVIAAVYLDGG 132

Query: 132 IEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTV 191
              A   + + W  R  +     RDAKT LQEWA  +    P Y    R GPDH P F +
Sbjct: 133 FAAARDMILRLWGARVAQVDVDARDAKTALQEWAQGRGLPPPSYIEVAREGPDHAPEFRI 192

Query: 192 VVEISGLAPAQGMDCSKR 209
              +     AQ    SKR
Sbjct: 193 EARLVTGETAQASAGSKR 210


>gi|296283699|ref|ZP_06861697.1| ribonuclease III [Citromicrobium bathyomarinum JL354]
          Length = 223

 Score =  142 bits (359), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 80/211 (37%), Positives = 116/211 (54%), Gaps = 2/211 (0%)

Query: 14  GYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELSV 73
           G+A  + +L  +ALTH S+       Y+RLEFLGDR+LGL I+  LF + +SA EG L+ 
Sbjct: 15  GFAARDEALWNEALTHGSLGEG--RDYQRLEFLGDRVLGLAIAEWLFENQNSASEGTLAQ 72

Query: 74  RFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIE 133
           R N+LVS   C++VAR + +   +R+    R+D  +  ++I  DV+ESL+ A   + G E
Sbjct: 73  RLNALVSKGACAKVARSIGVPDHLRLGRQAREDGGAQSSNILGDVMESLLGAQLREDGFE 132

Query: 134 VAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVVV 193
            A   V   W+          +  K+ LQEWA       PEY +  RSGPDH  RFTV V
Sbjct: 133 SARALVRALWRDAVEGDAGRAKHPKSALQEWAAGNRRRPPEYALIDRSGPDHAARFTVRV 192

Query: 194 EISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
            +  +  A+    SK+ AE  AA   +++ G
Sbjct: 193 SVKNVGDAEATANSKQEAETAAAKAFMEQYG 223


>gi|255264048|ref|ZP_05343390.1| ribonuclease III [Thalassiobium sp. R2A62]
 gi|255106383|gb|EET49057.1| ribonuclease III [Thalassiobium sp. R2A62]
          Length = 226

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 108/186 (58%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           E R+G+ F   +LL +A+TH+S+S   ++  +RLEFLGDR+LGL+++  L      A EG
Sbjct: 11  EGRLGHRFETPALLVQAVTHASMSSPNRDDNQRLEFLGDRVLGLVMAEALLAADPMAPEG 70

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLD 129
            L+ R+N+LV  E C+ VARE+D+ + +++     K       ++  D +E++IAA+YLD
Sbjct: 71  ILAPRYNALVRKEACADVAREVDVGAVLKLGRSEMKSGGRRKLALLGDAMEAVIAAVYLD 130

Query: 130 GGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
            G E A   V + W  R        RDAKT LQEWA  +    P Y    R+GPDH P F
Sbjct: 131 AGFEAAREMVLRLWGTRIHTVKADARDAKTALQEWAQGRGEGPPNYTEVSRTGPDHAPIF 190

Query: 190 TVVVEI 195
            + V +
Sbjct: 191 EIEVRL 196


>gi|296115041|ref|ZP_06833683.1| ribonuclease III [Gluconacetobacter hansenii ATCC 23769]
 gi|295978378|gb|EFG85114.1| ribonuclease III [Gluconacetobacter hansenii ATCC 23769]
          Length = 255

 Score =  142 bits (358), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 108/208 (51%), Gaps = 16/208 (7%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQE----------------SYERLEFLGDR 49
           +  +E  +GY F N +LL +ALTH S +H                    S ERLEF+GDR
Sbjct: 22  FERIEAYVGYCFRNAALLHEALTHRSAAHQRSSAIGRRTRQSVARRGAGSNERLEFIGDR 81

Query: 50  ILGLLISTLLFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCS 109
           +LGLL++  L   F   +EG L  R   LVS    + +A ++ L S + V+    +    
Sbjct: 82  VLGLLMAEWLLERFPDEQEGALGPRHAHLVSRAVLAHIAEDMALPSALDVAEHEARAGVR 141

Query: 110 FMTSIQADVVESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKF 169
            M ++ AD VE+++ A+YLDGG+E A  FV + W    +   +  +D KT LQEW  A+ 
Sbjct: 142 QMANVLADAVEAILGAIYLDGGLEPARAFVRRAWNNAIVAQARPPKDPKTALQEWVLARG 201

Query: 170 GVTPEYKVTFRSGPDHDPRFTVVVEISG 197
              P YKV    GP H PRF + VE SG
Sbjct: 202 LPLPVYKVVSTDGPSHAPRFVISVEASG 229


>gi|317131320|ref|YP_004090634.1| ribonuclease III [Ethanoligenens harbinense YUAN-3]
 gi|315469299|gb|ADU25903.1| ribonuclease III [Ethanoligenens harbinense YUAN-3]
          Length = 226

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 88/219 (40%), Positives = 124/219 (56%), Gaps = 9/219 (4%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQE----SYERLEFLGDRILGLLISTLLFNHFD 64
           LEK +GY FA++SLLE ALTHSS ++  ++    S ERLEFLGD +LG++ +  L+ H  
Sbjct: 5   LEKNLGYTFADKSLLENALTHSSYANEMKKHSCGSNERLEFLGDAVLGIISAEYLYFHHT 64

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EGEL+    S+V   +    AR ++L  ++R+            +SI AD  E++IA
Sbjct: 65  RVPEGELTRLRASMVCERSLQGFARTVELGRWLRLGRGEENTGGRERSSILADAFEAVIA 124

Query: 125 ALYLDGGIEVAGTFVDKY---WKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           A+Y+DGG   A  FV ++   +    L++G  RRD KTELQE      G   EY +   S
Sbjct: 125 AIYIDGGFPAAKRFVTRFADSFFAAHLENG--RRDYKTELQEIVQKNHGEKLEYVLVGES 182

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
           GPDHD +F V V ++      G   SK+ AEQ+AA E L
Sbjct: 183 GPDHDKQFLVEVHLNNNCIGAGRGGSKKEAEQMAAREAL 221


>gi|332653520|ref|ZP_08419265.1| ribonuclease III [Ruminococcaceae bacterium D16]
 gi|332518666|gb|EGJ48269.1| ribonuclease III [Ruminococcaceae bacterium D16]
          Length = 226

 Score =  141 bits (355), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 83/206 (40%), Positives = 119/206 (57%), Gaps = 3/206 (1%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQ---ESYERLEFLGDRILGLLISTLLFNHF 63
           +TLE+++GY F NR LLE ALTHSS ++  +   +S ERLEFLGD ILG++++  L+   
Sbjct: 2   TTLEEKLGYQFQNRELLENALTHSSCANESRGKLQSNERLEFLGDSILGMVVADHLYRGH 61

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
               EGEL+    +LV  E+  +VA+ LDL S++ +             SIQAD VE+++
Sbjct: 62  PDLPEGELTRVRAALVCEESLVEVAQALDLGSYLLLGKGEEAGGGRTRPSIQADAVEAVL 121

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           AA+YLDGGI  A   + KY   R ++     RD KT LQE    + G   +Y++    GP
Sbjct: 122 AAVYLDGGIGSARKIIQKYILCREIEGITSPRDYKTALQELVQRESGQVLKYRLVGSQGP 181

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKR 209
           DH  RF V V+++G     G   SK+
Sbjct: 182 DHAKRFFVDVDLNGEPVGSGEGHSKK 207


>gi|224582877|ref|YP_002636675.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|224467404|gb|ACN45234.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
          Length = 245

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 82/225 (36%), Positives = 125/225 (55%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F ++ LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 20  MNPIVINRLQRKLGYTFNHQELLQQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 76

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE DL   +R+     K       SI AD VE
Sbjct: 77  HRFPRVDEGDMSRMRATLVRGNTLAELAREFDLGECLRLGPGELKSGGFRRESILADTVE 136

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  ++K R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 137 ALIGGVFLDSNIQTVEQLILNWYKTRLDEISPGDKQKDPKTRLQEYLQGRHLPLPSYLVV 196

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SGL+ P  G   S+R AEQ AA +VLK+
Sbjct: 197 QVRGEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAAAEQVLKK 241


>gi|327399771|ref|YP_004340640.1| Ribonuclease 3 [Hippea maritima DSM 10411]
 gi|327182400|gb|AEA34581.1| Ribonuclease 3 [Hippea maritima DSM 10411]
          Length = 234

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 81/216 (37%), Positives = 124/216 (57%), Gaps = 2/216 (0%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
            E+R+GY F N+ LL++ALTH S      +S ERLEFLGD +L L+++  L N++ +  E
Sbjct: 13  FEERLGYTFKNKELLKRALTHRSYVKDKAKSNERLEFLGDAVLELVVTEFLINNYKNIDE 72

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    + V+ +T S++AR+L+L+  I V    +K+  +   SI  D  E+++ A+YL
Sbjct: 73  GKLSKIRAASVNTKTLSKLARKLELSDQILVGRSEKKEGITNNDSILEDAFEAIVGAIYL 132

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           DGG++ A  FV+   K    A+       D KT LQE    +FG  PEY +    G +H+
Sbjct: 133 DGGLDKARRFVEHMLKDTIIAIVENGIIFDYKTHLQEITQKQFGCLPEYVIVKEDGQEHN 192

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
             F   V I G+    G+  SK+ AE+ AA E +K+
Sbjct: 193 KTFYCDVMIKGVKYGFGIGKSKKDAEKNAAKEAVKK 228


>gi|90101642|sp|Q57LD0|RNC_SALCH RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
          Length = 226

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 125/225 (55%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F ++ LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPIVINRLQRKLGYTFNHQELLQQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE DL   +R+     K       SI AD +E
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAELAREFDLGECLRLGPGELKSGGFRRESILADTME 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  ++K R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGVFLDSNIQTVEQLILNWYKTRLDEISPGDKQKDPKTRLQEYLQGRHLPLPSYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SGL+ P  G   S+R AEQ AA +VLK+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAAAEQVLKK 222


>gi|62181146|ref|YP_217563.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|62128779|gb|AAX66482.1| RNase III, ds RNA [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|322715636|gb|EFZ07207.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 245

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 125/225 (55%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F ++ LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 20  MNPIVINRLQRKLGYTFNHQELLQQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 76

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE DL   +R+     K       SI AD +E
Sbjct: 77  HRFPRVDEGDMSRMRATLVRGNTLAELAREFDLGECLRLGPGELKSGGFRRESILADTME 136

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  ++K R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 137 ALIGGVFLDSNIQTVEQLILNWYKTRLDEISPGDKQKDPKTRLQEYLQGRHLPLPSYLVV 196

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SGL+ P  G   S+R AEQ AA +VLK+
Sbjct: 197 QVRGEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAAAEQVLKK 241


>gi|260771275|ref|ZP_05880202.1| ribonuclease III [Vibrio furnissii CIP 102972]
 gi|260613872|gb|EEX39064.1| ribonuclease III [Vibrio furnissii CIP 102972]
          Length = 225

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 85/219 (38%), Positives = 122/219 (55%), Gaps = 6/219 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           S LE ++GY F N  L+  ALTH S +  + E   RLEFLGD IL  +I+  L++ F   
Sbjct: 6   SRLETKLGYQFNNAELISLALTHRSANGKHNE---RLEFLGDSILSFVIADDLYHRFPKV 62

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG++S    +LV   T +++ RE DL  ++++     K       SI AD VE++I A+
Sbjct: 63  NEGDMSRMRATLVRGNTLAELGREFDLGDYLKLGPGELKSGGFRRDSILADAVEAIIGAI 122

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLD  IEVA   V  +++ R  A+K G  ++D KT LQE+   +    P Y VT   G  
Sbjct: 123 YLDSDIEVARATVLSWYQSRLEAIKPGVSQKDPKTRLQEFLQGRRKPLPVYTVTNIKGEA 182

Query: 185 HDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
           H+  FTV  +I+G+ AP  G   S+R AEQ AA   L++
Sbjct: 183 HNQEFTVACDIAGIGAPVIGKGTSRRKAEQAAAETALEQ 221


>gi|326203626|ref|ZP_08193490.1| ribonuclease III [Clostridium papyrosolvens DSM 2782]
 gi|325986446|gb|EGD47278.1| ribonuclease III [Clostridium papyrosolvens DSM 2782]
          Length = 236

 Score =  138 bits (348), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 86/224 (38%), Positives = 119/224 (53%), Gaps = 6/224 (2%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLISTLLF 60
           R S LE  IG+ F N+ ++  A+THSS ++  +    +  ERLEFLGD +LGL+IS  LF
Sbjct: 9   RISELENIIGHNFNNKDIIFAAITHSSYANEKKAKKLKYNERLEFLGDSVLGLVISEYLF 68

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
               +  EGELSV    +V   + SQ A ++ L  ++ +             S+ +D  E
Sbjct: 69  QKKPNLPEGELSVTRAKIVCENSLSQCATDISLGKYLLLGKGEELSGGREKISLLSDAFE 128

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI ALY+DGG E A  FV KY  +  R+   GK   D KT+LQE           Y VT
Sbjct: 129 ALIGALYIDGGFETAKGFVHKYMDKIIRSCIEGKLFYDYKTQLQELVQQNGEQQISYSVT 188

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
            + GPDH+  F   V+I+G+   QG   SK+ AEQ AA + L  
Sbjct: 189 DQFGPDHNKTFVTEVKINGVTQGQGKGHSKKEAEQNAAKDALNN 232


>gi|119774017|ref|YP_926757.1| ribonuclease III [Shewanella amazonensis SB2B]
 gi|189043345|sp|A1S3Y1|RNC_SHEAM RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|119766517|gb|ABL99087.1| RNAse III [Shewanella amazonensis SB2B]
          Length = 226

 Score =  138 bits (348), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 127/216 (58%), Gaps = 6/216 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L + +GY F++  LLE+ALTH S S+ + E   RLEFLGD IL ++IS  LF+ F  A E
Sbjct: 10  LCRTLGYEFSDIRLLEQALTHRSASNQHNE---RLEFLGDSILSIVISDALFHQFPKATE 66

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV  +T + +A+E  L  ++ +     K       SI AD VE++I A+YL
Sbjct: 67  GDLSRMRATLVRGDTLAVIAKEFKLGDYLNLGPGELKSGGFRRESILADAVEAIIGAVYL 126

Query: 129 DGGIEVAGTFVDKYWKQRA--LKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  +E   + +  +++ R   +K G  ++DAKT LQE+        PEY+VT   G  HD
Sbjct: 127 DADLETCRSLLLGWYETRLADIKPGVGQKDAKTLLQEYLQGMKKPLPEYQVTQVEGEAHD 186

Query: 187 PRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLK 221
             FTV   ++ LA A  G+  S+R AEQ+AAA+VL+
Sbjct: 187 QTFTVECRVTDLADAVVGVGSSRRKAEQMAAAQVLE 222


>gi|326794405|ref|YP_004312225.1| ribonuclease 3 [Marinomonas mediterranea MMB-1]
 gi|326545169|gb|ADZ90389.1| Ribonuclease 3 [Marinomonas mediterranea MMB-1]
          Length = 227

 Score =  138 bits (348), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 94/225 (41%), Positives = 126/225 (56%), Gaps = 7/225 (3%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           MS+L Y  L +RIGY FA+  LLE ALTH S      ++ ERLEFLGD IL  +I+  LF
Sbjct: 1   MSSL-YQKLCRRIGYFFADLGLLELALTHRSYG---GKNNERLEFLGDSILNYVIAEDLF 56

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F  AKEGELS    SLV  +T +++ARE  L  F+++ +   K       SI AD VE
Sbjct: 57  HRFPKAKEGELSRLRASLVKGDTLAELAREFQLGDFLKLGAGELKSGGFRRDSILADTVE 116

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
            +I A+YLD G++     + +++K R  A       +DAKT LQE+  A+    P+Y+V 
Sbjct: 117 GIIGAMYLDAGMDTCKNQILEWYKTRLDATSLNVVTKDAKTRLQEYLQARKHGLPQYEVV 176

Query: 179 FRSGPDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLKR 222
              G  HD  F V   I     A +G   S+R AEQ AAAE L +
Sbjct: 177 NIDGEPHDQTFFVHCHIEIFDQAVEGKGNSRRIAEQNAAAEALSQ 221


>gi|254452330|ref|ZP_05065767.1| ribonuclease III [Octadecabacter antarcticus 238]
 gi|198266736|gb|EDY91006.1| ribonuclease III [Octadecabacter antarcticus 238]
          Length = 197

 Score =  138 bits (348), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 78/191 (40%), Positives = 108/191 (56%)

Query: 32  ISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELSVRFNSLVSAETCSQVAREL 91
           +S   ++  +RLEFLGDR+LGL++S  L     +A EG L+ RFN+LV  ETC+ VAR++
Sbjct: 1   MSTPNRDDNQRLEFLGDRVLGLVMSEALLQADVNAPEGLLAPRFNALVRKETCADVARQI 60

Query: 92  DLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIEVAGTFVDKYWKQRALKSG 151
           DL + +++             ++ AD +E++IAA+Y+D G +VA   V   W  R     
Sbjct: 61  DLGAVLKLGRSEMLTGGRRKEALLADAMEAVIAAVYIDAGFDVARERVVALWGDRISNVE 120

Query: 152 KFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAA 211
           +  RD KT LQEWA  +    P Y  T RSGPDH P FT+ V +   A       SKR A
Sbjct: 121 EDARDPKTALQEWAQGQGEPPPSYIETARSGPDHAPIFTIEVRLHSGATDTATAPSKRQA 180

Query: 212 EQVAAAEVLKR 222
           EQ AA  +L R
Sbjct: 181 EQAAAKSLLDR 191


>gi|78223520|ref|YP_385267.1| ribonuclease III:double-stranded RNA binding [Geobacter
           metallireducens GS-15]
 gi|90101627|sp|Q39T82|RNC_GEOMG RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|78194775|gb|ABB32542.1| RNAse III [Geobacter metallireducens GS-15]
          Length = 246

 Score =  138 bits (347), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 119/223 (53%), Gaps = 7/223 (3%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSS-ISHSYQES----YERLEFLGDRILGLLISTLLFN 61
           + LE  IGY F NR  L +ALTH S ++    E      ERLEFLGD +LGLL+  +LF 
Sbjct: 17  TELEAGIGYRFVNRQFLAEALTHRSWVNERRGEEGIRDNERLEFLGDAVLGLLVGKMLFA 76

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVES 121
            F  ++EG L+    SLV  ET + +A    L   + +     +       S+ A+  E+
Sbjct: 77  RFPQSREGVLARMKASLVGEETLAALASARGLGRHLLLGRGEERSGGRERRSLLANTYEA 136

Query: 122 LIAALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTF 179
           L+AA+YLDGG+      V++ +      + SG   RD KTE QE    +FG  P Y++  
Sbjct: 137 LLAAVYLDGGLGPVERIVEQDFSPLLAGIASGATGRDFKTEFQEMVQTRFGTAPTYELIA 196

Query: 180 RSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
             GP HD RFTV+  ++G    +G   SK+ AEQ AA +VL R
Sbjct: 197 TDGPPHDRRFTVIAMVAGKRMGEGAGRSKKEAEQAAARQVLAR 239


>gi|89094542|ref|ZP_01167480.1| ribonuclease III [Oceanospirillum sp. MED92]
 gi|89081141|gb|EAR60375.1| ribonuclease III [Oceanospirillum sp. MED92]
          Length = 226

 Score =  138 bits (347), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 88/217 (40%), Positives = 126/217 (58%), Gaps = 6/217 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L +RIG+ F++ SL E ALTH S     +++ ERLEFLGD IL  +I+  L+  F  A
Sbjct: 6   NELARRIGHDFSDLSLFELALTHRSCG---KKNNERLEFLGDSILNFVIADDLYARFPKA 62

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           KEGELS     +V   T S+VAREL L  ++R+ S   K       SI AD VE++I A+
Sbjct: 63  KEGELSRLRARMVKGVTLSEVARELGLGDYLRLGSGELKSGGFRRDSILADAVEAIIGAI 122

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLD  ++ A  ++ K+++QR   L   +  +D+KT LQE+  ++    PEY++T   G  
Sbjct: 123 YLDSDMDTARAYILKWFEQRLSTLDLNESLKDSKTRLQEFLQSRRLALPEYELTNVEGEA 182

Query: 185 HDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVL 220
           H   F +   +SGL  PA+G   S+R AEQ AA   L
Sbjct: 183 HAQTFYIDCRVSGLNNPAKGTGSSRRQAEQEAAKNAL 219


>gi|291288904|ref|YP_003505720.1| ribonuclease III [Denitrovibrio acetiphilus DSM 12809]
 gi|290886064|gb|ADD69764.1| ribonuclease III [Denitrovibrio acetiphilus DSM 12809]
          Length = 235

 Score =  138 bits (347), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 81/229 (35%), Positives = 132/229 (57%), Gaps = 6/229 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISH--SYQESYERLEFLGDRILGLLISTL 58
           +S++   +LE R+GY F+++S++ +ALTH S +H    +++YERLEFLGD +L L+++  
Sbjct: 5   VSSVDIDSLEGRLGYHFSDKSIVLEALTHRSYAHEKKNKQNYERLEFLGDAVLQLIVTEY 64

Query: 59  LFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADV 118
           L + +    EG LS      VS    S++A EL L   I +    +     +  S+  D+
Sbjct: 65  LLDRYKDYDEGLLSKLRGYFVSEGFLSRIAIELKLGEHILLGKGEKASGGKYKESLLCDI 124

Query: 119 VESLIAALYLDGGIEVAGTFVDKYWKQRA---LKSGKFRRDAKTELQEWAHAKFGVTPEY 175
            ES++AA+YLDGG   A   + +++  R    + +  F  DAK+ELQ+ +  KFG  P+Y
Sbjct: 125 FESVVAAIYLDGGYGFARDIIIRHFGSRIDEDISNSSF-VDAKSELQKISQRKFGTLPDY 183

Query: 176 KVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
            V    GP+HD  F V V++  L   QG+  +K++AE+ AA   L++ G
Sbjct: 184 TVLDEKGPEHDKIFVVRVDVETLVSEQGIGKTKKSAEKDAAKNALRKLG 232


>gi|167645701|ref|YP_001683364.1| ribonuclease III [Caulobacter sp. K31]
 gi|189043302|sp|B0T3I0|RNC_CAUSK RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|167348131|gb|ABZ70866.1| Ribonuclease III [Caulobacter sp. K31]
          Length = 232

 Score =  137 bits (346), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 123/197 (62%), Gaps = 3/197 (1%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQES--YERLEFLGDRILGLLISTLLFNHFD 64
           + LE+RIG+ FA+R LLE ALTH+S+    +++   E LEF+GDR+LGLL +  L   F 
Sbjct: 9   ADLERRIGHTFADRKLLELALTHASVGDGAKKAGDNEVLEFIGDRVLGLLAAEALAERFP 68

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
            AKEGEL+ R N+LVS ETC++VAR  ++   +R+S+   K       SI A   E+L+A
Sbjct: 69  KAKEGELAPRLNALVSRETCARVARGAEMGPALRLSASSSKIGGRETDSILAGAAEALMA 128

Query: 125 ALYLDGGIEVA-GTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           ALY DGG+E+A   F+D +  +  L +    RD KT LQEWA ++    P Y V  R GP
Sbjct: 129 ALYRDGGLELARRVFLDLWAGEFDLANQGKPRDPKTALQEWAQSQGKPLPTYAVKDRKGP 188

Query: 184 DHDPRFTVVVEISGLAP 200
           DH P FTV V + GL P
Sbjct: 189 DHAPMFTVQVTVVGLDP 205


>gi|294084100|ref|YP_003550858.1| Ribonuclease III [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292663673|gb|ADE38774.1| Ribonuclease III [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 230

 Score =  137 bits (346), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 119/217 (54%), Gaps = 4/217 (1%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M ++    L +R+ + F ++S+L +ALTH+S +   + S ERLEFLGDR+LGL+++   +
Sbjct: 1   MKSVDLKPLAERLAHKFNDQSVLVRALTHASFAGPTK-SNERLEFLGDRVLGLVLADFFY 59

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
                  EG+LS+R ++        +V REL+LA FI V + +     +   S+ AD VE
Sbjct: 60  GQCPDEDEGKLSLRLHADARQSKLVEVGRELELARFISVQNGM---ALAENESVIADAVE 116

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           SLIAA YLDGG EVA  F+  YW           +DAK+ LQE    +    P Y++  +
Sbjct: 117 SLIAAHYLDGGFEVARRFILAYWALDTAAPAGTDKDAKSRLQELVMKQGLALPHYRLISK 176

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAA 217
           SGPDH P     V + G         +++ AEQ AAA
Sbjct: 177 SGPDHAPEMIYEVSVEGYDSIVASASNRKLAEQQAAA 213


>gi|222475478|ref|YP_002563895.1| ribonuclease III (rnc) [Anaplasma marginale str. Florida]
 gi|254995287|ref|ZP_05277477.1| ribonuclease III [Anaplasma marginale str. Mississippi]
 gi|255003466|ref|ZP_05278430.1| ribonuclease III [Anaplasma marginale str. Puerto Rico]
 gi|254807234|sp|B9KGT5|RNC_ANAMF RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|222419616|gb|ACM49639.1| ribonuclease III (rnc) [Anaplasma marginale str. Florida]
          Length = 232

 Score =  137 bits (346), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 113/210 (53%), Gaps = 1/210 (0%)

Query: 14  GYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELSV 73
           GY F +  LL +ALTH S+S+    +YERLEFLGD +L + +S +L+  F    EG L+ 
Sbjct: 18  GYQFRDLDLLLEALTHPSLSYKSAANYERLEFLGDAVLSMTVSEMLYRLFPDDDEGCLTR 77

Query: 74  RFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIE 133
           +  +LV      ++AR + L   I +S   R    S       + +E+LI A+Y+DGG E
Sbjct: 78  KRTALVRGSEVVEIARSIGLGELILMSGGERTCGGSDNPGTLENALEALIGAMYMDGGPE 137

Query: 134 VAGTFVDKYWKQRALK-SGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVV 192
              +F+ K+W  RA   S    +D KT LQEW   +    P YK+  +SGP+H P F V 
Sbjct: 138 AYRSFIHKHWLARAQHMSYTPPQDPKTALQEWVQGRGWAMPLYKLVSKSGPEHKPVFAVE 197

Query: 193 VEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           V I       G   SK+ AEQ AA  +LK+
Sbjct: 198 VSIQEHGNVLGTGSSKKLAEQEAAKLMLKK 227


>gi|114327656|ref|YP_744813.1| ribonuclease III [Granulibacter bethesdensis CGDNIH1]
 gi|114315830|gb|ABI61890.1| ribonuclease III [Granulibacter bethesdensis CGDNIH1]
          Length = 258

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 84/224 (37%), Positives = 120/224 (53%), Gaps = 12/224 (5%)

Query: 10  EKRIGYAFANRSLLEKALTHSS---ISHSYQE--------SYERLEFLGDRILGLLISTL 58
           E  + + FA R LL +ALTH S   I H            S ERLEF+GDR+LGL+++  
Sbjct: 23  EALLSHRFARRDLLAEALTHRSAVKIMHGQTGQSLPRGAGSNERLEFVGDRVLGLVVAEW 82

Query: 59  LFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADV 118
           L   F   +EGEL  R   LVS    + +A +  L   + V+    K     + ++ +D 
Sbjct: 83  LVERFPLEQEGELGRRLAHLVSQPVLAGIAEQSGLPQILSVAPGEAKAGVRKLATVLSDA 142

Query: 119 VESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +E+LI ALYLD G++    F+ ++W+    +  +  +DAKT LQEWA       P Y++ 
Sbjct: 143 MEALIGALYLDAGLDPVRQFIRRHWEPVMQRQTEPPKDAKTALQEWAQGLGLHLPTYRLA 202

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
            R GP H+P F V V + G    QG   SKRAAEQ+AA ++L R
Sbjct: 203 RREGPPHNPVFWVEV-LVGDHVGQGQAGSKRAAEQLAAQDLLGR 245


>gi|291542641|emb|CBL15751.1| RNAse III [Ruminococcus bromii L2-63]
          Length = 225

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 127/222 (57%), Gaps = 7/222 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESY----ERLEFLGDRILGLLISTLLFNHFD 64
           L+KRIGY F N  LL +ALTHSS ++ ++  +    ERLEFLGD +L +++S  +F H  
Sbjct: 4   LQKRIGYTFKNTDLLTEALTHSSYANEHKAKHIKYNERLEFLGDAVLSIVVSDYIFKHCP 63

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EGEL+    SLV  +T  + A++++L  ++ +S   R +  +   SI +D  E+LIA
Sbjct: 64  ELPEGELTKLRASLVCEKTLFEFAKQIELGKYLVLSKGERNNGGAERPSILSDAFEALIA 123

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKVTFRSG 182
           A+Y+DGGI+ A   +  +    A+K+ K ++  D KT LQE      G   EY +   SG
Sbjct: 124 AIYIDGGIDPASKHILNFVIP-AIKNSKKKKLNDYKTALQEIIQKNPGEQLEYVLVGESG 182

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           PDH+  F V V ++     +G   SK+ AEQ AA E L+  G
Sbjct: 183 PDHNKHFVVEVHLNSNVIGKGGGRSKKEAEQQAAREALELMG 224


>gi|262277162|ref|ZP_06054955.1| ribonuclease III [alpha proteobacterium HIMB114]
 gi|262224265|gb|EEY74724.1| ribonuclease III [alpha proteobacterium HIMB114]
          Length = 225

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 119/212 (56%), Gaps = 1/212 (0%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           +EK +   F N+SL+E+A TH S S +   + ERLEFLGDR+LGL+I++ L +++    E
Sbjct: 9   VEKILEIKFNNKSLIEQAFTHKSKSVNINNNNERLEFLGDRVLGLVIASYLNDNYPKDSE 68

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G L  +  SLV+ ETCS++   L++  F+ + S+ +K   +    I  D+ ES+I A+++
Sbjct: 69  GVLDKKLASLVNKETCSKIISSLEIDRFLSL-SEAQKQNKAGNKKILGDLCESIIGAVFM 127

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           D G E    F+ K WK+    + +   D KT+LQE++   +   P YK    SGP H P 
Sbjct: 128 DKGFEQTKKFILKIWKENLKNTTQVFIDPKTKLQEYSLKLYKKLPVYKYISNSGPSHKPN 187

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
           F V V I           SK+ AE  AA +++
Sbjct: 188 FRVSVSIEQSKSFVATGTSKKNAETNAAKKLI 219


>gi|255004592|ref|ZP_05279393.1| ribonuclease III [Anaplasma marginale str. Virginia]
          Length = 232

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 113/210 (53%), Gaps = 1/210 (0%)

Query: 14  GYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELSV 73
           GY F +  LL +ALTH S+S+    +YERLEFLGD +L + IS +L+  F    EG L+ 
Sbjct: 18  GYQFRDLDLLLEALTHPSLSYKSAANYERLEFLGDAVLSMTISEMLYRLFPDDDEGCLTR 77

Query: 74  RFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIE 133
           +  +LV      ++AR + L   I +S   R    S       + +E+LI A+Y+DGG E
Sbjct: 78  KRTALVRGSEVVEIARSIGLGELILMSGGERTCGGSDNPGTLENALEALIGAMYMDGGPE 137

Query: 134 VAGTFVDKYWKQRALK-SGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVV 192
              +F+ K+W  RA   S    +D KT LQEW   +    P YK+  +SGP+H P F V 
Sbjct: 138 AYRSFIHKHWLARAQHMSYTPPQDPKTALQEWVQGRGWAMPLYKLVSKSGPEHKPVFAVE 197

Query: 193 VEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           V I       G   SK+ AEQ AA  +L++
Sbjct: 198 VSIQEHGNVLGTGSSKKLAEQEAAKLMLQK 227


>gi|317050765|ref|YP_004111881.1| ribonuclease III [Desulfurispirillum indicum S5]
 gi|316945849|gb|ADU65325.1| ribonuclease III [Desulfurispirillum indicum S5]
          Length = 247

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 85/225 (37%), Positives = 125/225 (55%), Gaps = 8/225 (3%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ---ESYERLEFLGDRILGLLISTLLFN 61
           R + LE+R+GY F  + LL  ALTH S  HS +   E+ ERLEFLGD +LGL+IS  L  
Sbjct: 10  RIAPLEERLGYVFMRKELLHTALTHRSFFHSNRKSAENNERLEFLGDSVLGLIISHYLLE 69

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARE-LDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
            F +  EG+LS   + +V+ +T S+VARE + L  ++ +             SI AD +E
Sbjct: 70  SFPAQSEGKLSKIRSFIVNEKTLSRVAREKIQLGRYLFIGKGEENTGGRNKASILADAME 129

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKF---RRDAKTELQEWAHAKFGVTPEYKV 177
           +++AA+YLDGG+  A   + +   +  ++S  F    RD KTELQE +     + PEY+V
Sbjct: 130 AVVAAIYLDGGLNAARNIILELMSEE-IESTVFSNRHRDYKTELQELSQGSLSLAPEYRV 188

Query: 178 TFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
               GPDH   F V + +       G   SK++AEQ AA   +++
Sbjct: 189 EREWGPDHQKHFAVSLYLHDQVYGHGEGTSKKSAEQKAARAAMEK 233


>gi|326387678|ref|ZP_08209284.1| ribonuclease III [Novosphingobium nitrogenifigens DSM 19370]
 gi|326207724|gb|EGD58535.1| ribonuclease III [Novosphingobium nitrogenifigens DSM 19370]
          Length = 233

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 85/210 (40%), Positives = 113/210 (53%), Gaps = 5/210 (2%)

Query: 13  IGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS-AKEGEL 71
            G+    + L  +ALTH S+  +    Y+RLEFLGDR+LGL ++  L  H DS A EG+L
Sbjct: 25  FGHEPIRQDLWHEALTHGSLGEA--RDYQRLEFLGDRVLGLAVAEWL--HGDSSAAEGKL 80

Query: 72  SVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGG 131
           S R N+LVS ETC+ VAR L +A  +R+    R D  +   +I  DV+E+LI AL+L+ G
Sbjct: 81  SQRLNALVSRETCADVARTLGIAPHMRLGKQARDDGGADSDNILGDVMEALIGALFLERG 140

Query: 132 IEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTV 191
              A  FV + W          R+  K  LQEWA       P Y +  R GPDH   FTV
Sbjct: 141 FPAARDFVRRAWAAPMAAGAGQRKHPKAALQEWAAGNKRKPPIYTLVAREGPDHAATFTV 200

Query: 192 VVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
            V + G+        SK+ AE  AA E +K
Sbjct: 201 SVTVKGVGEMTARGSSKQEAETSAAREFMK 230


>gi|56417113|ref|YP_154187.1| ribonuclease III [Anaplasma marginale str. St. Maries]
 gi|81358903|sp|Q5P9U8|RNC_ANAMM RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|56388345|gb|AAV86932.1| ribonuclease III [Anaplasma marginale str. St. Maries]
          Length = 232

 Score =  135 bits (341), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 79/210 (37%), Positives = 112/210 (53%), Gaps = 1/210 (0%)

Query: 14  GYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELSV 73
           GY F +  LL +ALTH  +S+    +YERLEFLGD +L + +S +L+  F    EG L+ 
Sbjct: 18  GYQFRDLDLLLEALTHPRLSYKSAANYERLEFLGDAVLSMTVSEMLYRLFPDDDEGCLTR 77

Query: 74  RFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIE 133
           +  +LV      ++AR + L   I +S   R    S       + +E+LI A+Y+DGG E
Sbjct: 78  KRTALVRGSEVVEIARSIGLGELILMSGGERTCGGSDNPGTLENALEALIGAMYMDGGPE 137

Query: 134 VAGTFVDKYWKQRALK-SGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVV 192
              +F+ K+W  RA   S    +D KT LQEW   +    P YK+  +SGP+H P F V 
Sbjct: 138 AYRSFIHKHWLARAQHMSYTPPQDPKTALQEWVQGRGWAMPLYKLVSKSGPEHKPVFAVE 197

Query: 193 VEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           V I       G   SK+ AEQ AA  +LK+
Sbjct: 198 VSIQEHGNVLGTGSSKKLAEQEAAKLMLKK 227


>gi|114797101|ref|YP_759604.1| ribonuclease III [Hyphomonas neptunium ATCC 15444]
 gi|114737275|gb|ABI75400.1| ribonuclease III [Hyphomonas neptunium ATCC 15444]
          Length = 234

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 119/214 (55%), Gaps = 7/214 (3%)

Query: 13  IGYAFANRSLLEKALTHSSI----SHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           IG+ F + ++LE+ALTH S       + + S +RLEFLGDR+L L+I+  L     S  E
Sbjct: 17  IGFKFKDAAILERALTHPSAIPPSGDTVKLSNQRLEFLGDRVLNLIIAERLIERRQSDSE 76

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+L+ R N LV    C++  R L L  FI +S            S   D  E++IAA+Y 
Sbjct: 77  GDLAPRLNRLVKKGACAEAMRFLGLQRFILLSESEVAAGGHDRESTLGDACEAVIAAIYQ 136

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           +GG+  A  F+++ W  +        +D KT LQEWA  +    P+Y VT RSGPDH P+
Sbjct: 137 EGGLAAARKFIERAWAPQFENVPAETKDPKTLLQEWAQGQGHPLPDYVVTGRSGPDHAPQ 196

Query: 189 FTVVVEIS-GLAPAQGMDCSKRAAEQVAAAEVLK 221
           + V V ++ G A A G   SKR AE+ AAA +L+
Sbjct: 197 YEVEVRLAVGKATATG--PSKREAERHAAALMLR 228


>gi|154500966|ref|ZP_02039004.1| hypothetical protein BACCAP_04652 [Bacteroides capillosus ATCC
           29799]
 gi|150269990|gb|EDM97509.1| hypothetical protein BACCAP_04652 [Bacteroides capillosus ATCC
           29799]
          Length = 223

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 82/211 (38%), Positives = 122/211 (57%), Gaps = 7/211 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSIS----HSYQESYERLEFLGDRILGLLISTLLFNHFD 64
           LE+++GY F NR+LLE ALTHSS +    H+  +S ERLEFLGD +LG++ +  L+    
Sbjct: 4   LEEKLGYTFQNRALLENALTHSSYANENKHTGAQSNERLEFLGDSVLGMVTADYLYRVHP 63

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EG+L+    +LV   +  +VA++L+L +++++             SI AD VE+++A
Sbjct: 64  DLPEGDLTRTRAALVCEGSLVEVAQQLELGTYLKLGKGEDAGGGRERPSIVADAVEAVLA 123

Query: 125 ALYLDGGIEVAGTFVDKYWKQRAL-KSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           A+YLDGGI  A   + ++   R   KSG   RD KT LQE    + G    Y++   +GP
Sbjct: 124 AVYLDGGIGSARKIIQRFILDREEEKSGS--RDYKTALQELVQRESGQVLAYRLVGSTGP 181

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQV 214
           DH  RF V VE++G     G   SK+ AEQ+
Sbjct: 182 DHAKRFQVEVELNGTPVGAGEGRSKKEAEQM 212


>gi|257784655|ref|YP_003179872.1| ribonuclease III [Atopobium parvulum DSM 20469]
 gi|257473162|gb|ACV51281.1| ribonuclease III [Atopobium parvulum DSM 20469]
          Length = 243

 Score =  135 bits (340), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 88/224 (39%), Positives = 115/224 (51%), Gaps = 3/224 (1%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSI--SHSYQESYERLEFLGDRILGLLISTLLFNH 62
           R +  E   G+ F N+ L+E ALTH S         SYERLEFLGD ILG +I+T LF  
Sbjct: 6   RVAAAEAICGHTFINKDLIEAALTHPSAVEGKPVSASYERLEFLGDSILGAIIATELFER 65

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           +    EG+L+    SLVS  T S V+  L ++  I +    +      M S   +V ES+
Sbjct: 66  YPDMDEGQLTRLKISLVSGHTLSIVSDTLGVSPLIVMGISEKGTGKRGMKSALENVYESI 125

Query: 123 IAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR-DAKTELQEWAHAKFGVTPEYKVTFRS 181
           + ALYLD G E    FV +        +   R    K+ LQE   A+   TPEYK+   S
Sbjct: 126 VGALYLDAGFEPTRDFVIRTLGPHISPTLAVRSVSPKSRLQEAVQAQGKATPEYKLIGES 185

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           GP H P FT VV + GL   +G   SK+AAE  AA + L R G+
Sbjct: 186 GPAHTPTFTAVVFVDGLKVGRGQGPSKKAAESEAAQDALVRLGV 229


>gi|88608789|ref|YP_506782.1| ribonuclease III [Neorickettsia sennetsu str. Miyayama]
 gi|88600958|gb|ABD46426.1| ribonuclease III [Neorickettsia sennetsu str. Miyayama]
          Length = 222

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 120/213 (56%), Gaps = 3/213 (1%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L+  +G  F N+ LL +ALTH S+      SYERLEFLGD +L L+I+++L++ F    E
Sbjct: 6   LQSLLGVYFKNKDLLVEALTHPSVEKC--PSYERLEFLGDAVLNLVIASMLYDLFPGDPE 63

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G LS R ++L+   T + +AR+++L  +IR+SS          TS   +V+E+L+ A++L
Sbjct: 64  GRLSHRQSALICKNTLAMLARQMNLGDYIRLSSSEEAGGGRDKTSNLENVLEALVGAIFL 123

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           D G+E    F+ K W   A++S     + K+ LQE   AK    P Y V  RSGP H P 
Sbjct: 124 DAGLETVTCFIKKRWYGLAVQSDSIEPNPKSTLQELLQAKGMKPPIYNVINRSGPAHLPI 183

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           F + + + G    +    SK+  E+ AA  +L+
Sbjct: 184 FEIEIRVDG-KKRRATGKSKKLGEENAARMMLE 215


>gi|260437031|ref|ZP_05790847.1| ribonuclease III [Butyrivibrio crossotus DSM 2876]
 gi|292810340|gb|EFF69545.1| ribonuclease III [Butyrivibrio crossotus DSM 2876]
          Length = 227

 Score =  134 bits (338), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 86/217 (39%), Positives = 120/217 (55%), Gaps = 5/217 (2%)

Query: 4   LRYSTLEKRIGYAFANRSLLEKALTHSSISHS-YQE---SYERLEFLGDRILGLLISTLL 59
           +     EK+IGYA+ N  LL+ ALTHSS  +  Y++   + ERLEFLGD +L L +S  L
Sbjct: 1   MNIKEFEKKIGYAYNNVDLLKLALTHSSYGNEVYKDKLHNNERLEFLGDAVLELTVSDYL 60

Query: 60  FNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVV 119
           FN   +  EG LS +  S+V   T +  ARE++L   + +          F  SI +D +
Sbjct: 61  FNEECNMPEGSLSRKRASIVCEPTLAMCAREINLPEVLFMGKGEELTGGRFRDSIVSDAM 120

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTF 179
           E++I ++YLDGGIE A  F++K+     +K  +   D+KT LQE   A +   PEY +T 
Sbjct: 121 EAVIGSIYLDGGIECAREFINKFILAD-IKDKQLFVDSKTILQERIQAGYKEGPEYIITG 179

Query: 180 RSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
            SGPDH   F   V I G     G   +K+AAEQ AA
Sbjct: 180 ESGPDHCKVFEAEVRIEGRLIGSGKGRTKKAAEQQAA 216


>gi|269958484|ref|YP_003328271.1| ribonuclease 3 [Anaplasma centrale str. Israel]
 gi|269848313|gb|ACZ48957.1| ribonuclease 3 [Anaplasma centrale str. Israel]
          Length = 249

 Score =  134 bits (338), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 79/210 (37%), Positives = 113/210 (53%), Gaps = 1/210 (0%)

Query: 14  GYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELSV 73
           GY F +  LL ++LTH S+S     +YERLEFLGD +L + +S +L+  F    EG L+ 
Sbjct: 22  GYRFRDLDLLLESLTHPSLSRESAANYERLEFLGDAVLSMAVSEMLYRLFPDDDEGCLTQ 81

Query: 74  RFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIE 133
           +  +LV      ++AR + L   I +SS       S       + +E+LI A+Y+DG  E
Sbjct: 82  KRTALVRGSEVVEIARSIGLGGLILMSSGEMSCGGSDNPGTLENALEALIGAMYIDGSSE 141

Query: 134 VAGTFVDKYWKQRALK-SGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVV 192
               F+ ++W  RA + S    +D KT LQEW  ++    P YK+  +SGP+H P F V 
Sbjct: 142 DYKNFIREHWFSRAQRMSSAPPQDPKTALQEWVQSRGWTVPLYKLVSKSGPEHKPVFAVE 201

Query: 193 VEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           V I G     G   SK+ AEQ AA  +LKR
Sbjct: 202 VSIQGHGSILGTGSSKKLAEQEAAKLMLKR 231


>gi|262375526|ref|ZP_06068759.1| ribonuclease III [Acinetobacter lwoffii SH145]
 gi|262309780|gb|EEY90910.1| ribonuclease III [Acinetobacter lwoffii SH145]
          Length = 232

 Score =  134 bits (338), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 124/223 (55%), Gaps = 5/223 (2%)

Query: 2   SALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFN 61
           S L    L KRIGY F    LL+ ALTH S+SH +  +YERLEFLGD +LG++I+  LFN
Sbjct: 6   SKLNDERLAKRIGYQFKQADLLKLALTHRSVSHKH--NYERLEFLGDSLLGMIIANYLFN 63

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVES 121
            + S  EG L+    +LV  E   ++A +L L+  + +S+   K       SI AD VE+
Sbjct: 64  AYPSENEGRLTRMRATLVRQEALGKIANDLKLSQNLILSTGELKSGGHHRESILADTVEA 123

Query: 122 LIAALYLD-GGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +I A+Y+D G + V    V K+++     ++     +D K+ LQE+  A+    P Y+V 
Sbjct: 124 IIGAIYVDCGDLTVLEPIVLKWYEPYLDHIEPTDQLKDPKSRLQEYLQARKKPLPVYEVV 183

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
              G   +  F V  +I+GL   QG   S+R AEQ  AA++LK
Sbjct: 184 DIQGDAPNQHFKVECQIAGLPTMQGEGASRRFAEQAVAADILK 226


>gi|302342152|ref|YP_003806681.1| ribonuclease III [Desulfarculus baarsii DSM 2075]
 gi|301638765|gb|ADK84087.1| ribonuclease III [Desulfarculus baarsii DSM 2075]
          Length = 237

 Score =  134 bits (338), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 86/218 (39%), Positives = 122/218 (55%), Gaps = 15/218 (6%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQE---SYERLEFLGDRILGLLISTLLFNHFDS 65
           L  ++G+ F++ + L++AL HSS  H   +   S ERLEFLGD +L L+++  LF  FD 
Sbjct: 12  LADQVGHGFSDWTALDEALRHSSFVHENPQRGPSNERLEFLGDAVLELVVTQELFLRFDQ 71

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
           A EG+LS   +S+V+    ++ AR++DL   I +    +       TSI AD +E+++AA
Sbjct: 72  ASEGQLSRARSSVVNEARLAEAARQIDLGPCILLGKGEQGQGGQEKTSILADALEAVLAA 131

Query: 126 LYLDGGIEVAGTFV-------DKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +YLDGG+E A   V       D+    RA      RRD KT LQE       +TP Y+  
Sbjct: 132 VYLDGGLEAARDCVLALLGPLDERVIDRAP-----RRDYKTMLQERVQEDLRLTPRYRTI 186

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
             SGPDHD  F+V +EI+    A G   SK+ AEQ AA
Sbjct: 187 DESGPDHDKTFSVSIEINDRQLAMGAGKSKKEAEQNAA 224


>gi|162147937|ref|YP_001602398.1| ribonuclease III [Gluconacetobacter diazotrophicus PAl 5]
 gi|209542555|ref|YP_002274784.1| Ribonuclease III [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786514|emb|CAP56096.1| putative ribonuclease III [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530232|gb|ACI50169.1| Ribonuclease III [Gluconacetobacter diazotrophicus PAl 5]
          Length = 249

 Score =  134 bits (337), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 84/231 (36%), Positives = 125/231 (54%), Gaps = 17/231 (7%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISH---------SYQE-------SYERLEFLGDRI 50
           +++E R+GY F    LL +ALTH S +H         S Q        S ERLEF+GDR+
Sbjct: 14  ASVEARVGYRFRRPDLLREALTHRSAAHQRNGGGARRSRQPAARRGAGSNERLEFIGDRV 73

Query: 51  LGLLISTLLFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSF 110
           LGL+++  L   F   +EG L  R   LVS    + +A  ++L   + V+    +     
Sbjct: 74  LGLVMAEWLLERFPDEQEGALGPRHAHLVSRPVLAAIAGTMNLQQALDVAEHEARAGVRQ 133

Query: 111 MTSIQADVVESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFG 170
           + ++ AD VE+++ A+YLDGG+E A  FV   W +  +   +  +D KT LQEW  A+  
Sbjct: 134 VANVLADAVEAILGAIYLDGGLEPARRFVRAAWNEAIVAQAQPPKDPKTALQEWVLARGL 193

Query: 171 VTPEYKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
             P Y+     GP H PRF + V  +G + A+G+  SKRAAE  AAA++L+
Sbjct: 194 PLPAYRTVQMDGPSHAPRFVIAVTAAGQS-AEGIAGSKRAAESAAAADLLR 243


>gi|319789592|ref|YP_004151225.1| ribonuclease III [Thermovibrio ammonificans HB-1]
 gi|317114094|gb|ADU96584.1| ribonuclease III [Thermovibrio ammonificans HB-1]
          Length = 236

 Score =  134 bits (337), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 85/224 (37%), Positives = 126/224 (56%), Gaps = 10/224 (4%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHFDSA 66
           LE+ +GY+F ++ LL++AL H S +      E+YE LEFLGD ++GL++S  L   F   
Sbjct: 10  LERLLGYSFKDKELLKRALIHRSFAFEKDTGENYEVLEFLGDAVIGLIVSEELIKRFPEK 69

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EGELS     LVS  + S++AR ++L  F+ +    ++       SI  DV ES+  AL
Sbjct: 70  SEGELSQIRAFLVSEPSLSKLARTINLGQFLYLGKGEKRTGGREKDSILCDVFESVFGAL 129

Query: 127 YLDGGIEVA-----GTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           YLD G E A       F+ K W+   L++    +D K+ LQE    ++ V P+Y+V    
Sbjct: 130 YLDAGFEKAKEIFKNKFLKKLWE--ILENAVTYKDFKSYLQEITQREYKVLPKYRVVKAE 187

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           GP+HD  FTV  +++ +    G   SK+AAEQ AA E+LK  G+
Sbjct: 188 GPEHDKTFTVECQVNDIT-TYGKGKSKKAAEQDAAREMLKALGV 230


>gi|197119571|ref|YP_002139998.1| ribonuclease III [Geobacter bemidjiensis Bem]
 gi|197088931|gb|ACH40202.1| ribonuclease III [Geobacter bemidjiensis Bem]
          Length = 232

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 89/224 (39%), Positives = 127/224 (56%), Gaps = 11/224 (4%)

Query: 9   LEKRIGYAFANRSLLEKALTHSS-ISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAK 67
           +E R+GY F++R LL +ALTH + ++ +     +RLEF GD +L  L+S +L   F  ++
Sbjct: 12  IEGRLGYRFSDRGLLVEALTHRTYVNEAGGRDNQRLEFFGDAVLDFLLSDMLLVRFPDSR 71

Query: 68  EGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALY 127
           EGEL+    +LV   +  ++A ELDL   +R+     K       S+ AD  E+L+AALY
Sbjct: 72  EGELTRIRAALVDEASLGKIASELDLGQALRLGRGEEKGGGRQKRSLLADAFEALLAALY 131

Query: 128 LDGGIEVAGTFVDKYW----KQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           LDGG++ A   V+  +      R L SG   RDAKTELQE A    G  P Y++   +GP
Sbjct: 132 LDGGLDPARRVVEALFAPLLSSRDLLSG---RDAKTELQETARLFKGELPRYQLKQVTGP 188

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAE---VLKREG 224
           DHD RFTV V +      +G+  +K+ AEQ AA     +LK EG
Sbjct: 189 DHDKRFTVEVYLGEELMGEGVGRTKKEAEQDAARAAFLLLKGEG 232


>gi|308048449|ref|YP_003912015.1| RNAse III [Ferrimonas balearica DSM 9799]
 gi|307630639|gb|ADN74941.1| RNAse III [Ferrimonas balearica DSM 9799]
          Length = 224

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 83/225 (36%), Positives = 126/225 (56%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+  + + L+  +GY F + +LL +ALTH S +  + E   RLE+LGD +L  +I+  L+
Sbjct: 1   MNNQKLTRLQDALGYQFKDIALLNQALTHRSAASQHNE---RLEYLGDAVLSFVIAEALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F    EG+++    SLV   T +++ REL L   I++     K       SI AD VE
Sbjct: 58  LRFPKVAEGDMTRMRASLVKGVTLAELGRELALGDVIKLGPGELKSGGFRRESILADAVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +++ A+YLDGGIEV    + + ++ R   ++ G  ++D KT LQE   A+    PEY+V 
Sbjct: 118 AILGAVYLDGGIEVCKPLILRLYQARLDIIEPGIRQKDPKTRLQEHLQARKQPLPEYEVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
              G  H+ RFTV   +S LA P  G   S+R AEQ AA+ VL++
Sbjct: 178 SVEGDAHNQRFTVRCSVSALAEPMIGNGSSRRKAEQDAASRVLEQ 222


>gi|319957798|ref|YP_004169061.1| rnase iii [Nitratifractor salsuginis DSM 16511]
 gi|319420202|gb|ADV47312.1| RNAse III [Nitratifractor salsuginis DSM 16511]
          Length = 226

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 83/221 (37%), Positives = 122/221 (55%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y  LE+R+GY F N  L+ +ALTH S    Y    ERLEFLGD +L L++   LF+ F  
Sbjct: 4   YHELERRLGYEFKNPQLIVEALTHKSYKKPYNN--ERLEFLGDAVLDLIVGEFLFHKFPQ 61

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
           + EG LS    SLV+    + +AR +DL  +I +S     +      S+ ++  E++I A
Sbjct: 62  SDEGVLSKIRASLVNESGFATLARAIDLGRYIYLSPAEENNQGRSKPSLLSNAFEAVIGA 121

Query: 126 LYLDGGIEVAGTFV----DKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+E A + V    D+ + +  L +    +D KT LQE   A  GVTP+Y++   S
Sbjct: 122 IYLEAGLENARSIVVRLLDETYPRIDLDT--LCKDYKTALQELTQATHGVTPDYEMIGSS 179

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F V V++ G   A     SK+AA+Q AA   L++
Sbjct: 180 GPDHRKEFEVAVKLDGETIASAKGRSKKAAQQKAAEIALQK 220


>gi|237752001|ref|ZP_04582481.1| ribonuclease III [Helicobacter winghamensis ATCC BAA-430]
 gi|229376568|gb|EEO26659.1| ribonuclease III [Helicobacter winghamensis ATCC BAA-430]
          Length = 223

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 120/210 (57%), Gaps = 4/210 (1%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
            EK +GY F  ++LL++ALTH S         ERLEFLGD +L L+I   L+N F +++E
Sbjct: 7   FEKTLGYHFKAQNLLKEALTHKSAKKGTHN--ERLEFLGDAVLDLIIGEFLYNKFPNSRE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS    S+V+ +  +++AR L++  ++ +S+   ++      SI ++  E++I A+YL
Sbjct: 65  GELSKMRASMVNEKAFAKIARYLNIGEYLFISNSEEQNNGRKKDSILSNAFEAVIGAIYL 124

Query: 129 DGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           + G+++A   +         ++       D KT LQE   AKFG TPEY +   SGPDH+
Sbjct: 125 ESGLDIARNLMHNLLSAVYPSIDLNSLFYDHKTALQELTQAKFGETPEYVLLDSSGPDHN 184

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
             F + V+I G   A+    SK+ A+Q+ A
Sbjct: 185 KNFLIGVKIQGKEFAKASGKSKKEAQQICA 214


>gi|197303071|ref|ZP_03168119.1| hypothetical protein RUMLAC_01798 [Ruminococcus lactaris ATCC
           29176]
 gi|197297926|gb|EDY32478.1| hypothetical protein RUMLAC_01798 [Ruminococcus lactaris ATCC
           29176]
          Length = 229

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 116/220 (52%), Gaps = 5/220 (2%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISH-SYQESY---ERLEFLGDRILGLLISTLLF 60
           R   LEK+IGY F N  LLE+A+ HSS ++  + E Y   ERLEFLGD +L L+ S  LF
Sbjct: 4   RLKELEKKIGYTFENHKLLERAMMHSSYTNEKHLEKYRCNERLEFLGDAVLELISSEYLF 63

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
                  EGEL+    S+V   + +  AR++DL S++ +             SI +D +E
Sbjct: 64  GELPRVSEGELTKTRASMVCEPSLAMCARDIDLGSYLLLGKGEEATGGRMRDSITSDAME 123

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           +LI A+YLDGG   A  F+ ++     L+  K   D+KT LQE   A       Y++   
Sbjct: 124 ALIGAIYLDGGFTSAKEFIHRFI-LTDLEDKKLFYDSKTILQEIVQANKAGNITYELVGE 182

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
            GPDH+  F V V I G     G   SK+AAEQ AA + +
Sbjct: 183 EGPDHNKTFEVRVRIGGQPYGSGKGRSKKAAEQKAAYQAI 222


>gi|91227852|ref|ZP_01262025.1| ribonuclease III [Vibrio alginolyticus 12G01]
 gi|269965785|ref|ZP_06179882.1| Ribonuclease 3 [Vibrio alginolyticus 40B]
 gi|91188362|gb|EAS74658.1| ribonuclease III [Vibrio alginolyticus 12G01]
 gi|269829653|gb|EEZ83890.1| Ribonuclease 3 [Vibrio alginolyticus 40B]
          Length = 225

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 80/217 (36%), Positives = 120/217 (55%), Gaps = 6/217 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE+++GY F +  L+  ALTH S +  + E   RLEFLGD IL  +I+  L++ F    E
Sbjct: 8   LERKLGYQFQDAGLINLALTHRSANSKHNE---RLEFLGDSILSFVIADDLYHRFPKVNE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G++S    +LV   T +++ RE DL  ++++     K       SI AD VE++I A+YL
Sbjct: 65  GDMSRMRATLVRGHTLAELGREFDLGDYLKLGPGELKSGGFRRDSILADAVEAIIGAIYL 124

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  +EV    V  +++ R  A+K G  ++D KT LQE+   +    P Y VT   G  H+
Sbjct: 125 DSDLEVVRGIVLSWYQSRLEAIKPGVSQKDPKTRLQEFLQGRRKPLPVYTVTNIKGEAHN 184

Query: 187 PRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
             FTV  E++G+  P  G   S+R AEQ AA   L++
Sbjct: 185 QEFTVECEVAGVDKPVIGKGTSRRKAEQAAAETALEQ 221


>gi|42523419|ref|NP_968799.1| ribonuclease III [Bdellovibrio bacteriovorus HD100]
 gi|81617308|sp|Q6MLR5|RNC_BDEBA RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|39575625|emb|CAE79792.1| ribonuclease III [Bdellovibrio bacteriovorus HD100]
          Length = 234

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 81/220 (36%), Positives = 120/220 (54%), Gaps = 6/220 (2%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSISHSYQ---ESYERLEFLGDRILGLLISTLLFNHFD 64
           +LE+R+G+ F N +LLE+ALTH S ++  +   E  E+LEFLGD +L L++   L+  F 
Sbjct: 8   SLEERVGHQFKNPALLERALTHKSFANELRNTVEHNEKLEFLGDAVLDLVVGEFLYEKFP 67

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
           +  EG LS +  S+V+ E  S++A E+ L   +++         +    + A   E+++ 
Sbjct: 68  TDTEGGLSKKRASIVNEEVLSELALEMGLNKLMQLGKGEALTGGAQKPRLIASSFEAIVG 127

Query: 125 ALYLDGGIEVAGTFVDKYW---KQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           ALYLDGG EVA +F+ + +     R      F RD KT LQE        TP Y+V    
Sbjct: 128 ALYLDGGFEVARSFIRQEFVPLADRVCGHEDFERDYKTRLQELVQKSSKETPRYEVLAEE 187

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           GP HD  F V V++     AQG   SK+ AEQ+AA   L+
Sbjct: 188 GPPHDREFLVCVKVKEDVWAQGRGRSKKNAEQMAAKNALE 227


>gi|258541744|ref|YP_003187177.1| ribonuclease III [Acetobacter pasteurianus IFO 3283-01]
 gi|256632822|dbj|BAH98797.1| ribonuclease III [Acetobacter pasteurianus IFO 3283-01]
 gi|256635879|dbj|BAI01848.1| ribonuclease III [Acetobacter pasteurianus IFO 3283-03]
 gi|256638934|dbj|BAI04896.1| ribonuclease III [Acetobacter pasteurianus IFO 3283-07]
 gi|256641988|dbj|BAI07943.1| ribonuclease III [Acetobacter pasteurianus IFO 3283-22]
 gi|256645043|dbj|BAI10991.1| ribonuclease III [Acetobacter pasteurianus IFO 3283-26]
 gi|256648098|dbj|BAI14039.1| ribonuclease III [Acetobacter pasteurianus IFO 3283-32]
 gi|256651151|dbj|BAI17085.1| ribonuclease III [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654142|dbj|BAI20069.1| ribonuclease III [Acetobacter pasteurianus IFO 3283-12]
          Length = 238

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 121/229 (52%), Gaps = 12/229 (5%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSYQE-----------SYERLEFLGDRILGL 53
           R   LE R+GY F N  LL++ALTH S +H               S ERLEF+GDR+LGL
Sbjct: 8   RLEELEVRLGYRFVNPDLLQEALTHRSAAHQKAGGRKRQKAKGAGSNERLEFIGDRVLGL 67

Query: 54  LISTLLFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTS 113
           L++  L   F + +EG L  R   LVS  + +++A  LDL   + V++   +       +
Sbjct: 68  LMAEWLLERFPNEQEGALGSRLAHLVSRVSLAEIADRLDLPQSLTVAAHEARAGVQTAAN 127

Query: 114 IQADVVESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTP 173
           + AD +E+++ A++LDGG+E A   V  +WK          +D KT LQEW   +    P
Sbjct: 128 VVADALEAVLGAVFLDGGLEPARQMVRDWWKSALDAQAHPPKDPKTALQEWVLGRGQSLP 187

Query: 174 EYKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
            Y+     GP H P F V V   GL   +G   SKRAAE  AAA++L++
Sbjct: 188 VYETIGADGPSHAPLFVVRVTAGGLF-GEGRAGSKRAAESAAAADLLEK 235


>gi|282892110|ref|ZP_06300585.1| hypothetical protein pah_c207o041 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281498005|gb|EFB40349.1| hypothetical protein pah_c207o041 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 236

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 120/225 (53%), Gaps = 8/225 (3%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSI---SHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           S +E R+GY F +R LL  A  H S    +    E  ERLEFLGD +LGLLI+  L+ + 
Sbjct: 12  SNIELRLGYKFQDRDLLALAFVHRSFINENREIHEHNERLEFLGDSVLGLLIADYLYRYL 71

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
            S  EGELS   + LV A +C     +LDL  F+ +    R +      SI AD++E++I
Sbjct: 72  PSTPEGELSYLKSRLVEASSCVTYIHKLDLEQFLLLGRGERMNDGRGRESILADLLEAII 131

Query: 124 AALYLDGGIEVAGTFVDKYWK---QRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
            A+YLDGG+E A  F+ K +    +  LK+    R+ K  LQ++   K+  TP Y V   
Sbjct: 132 GAVYLDGGLESAKAFLFKNFSTEIEAILKTPV--RNWKALLQDYCQKKYQTTPSYHVIDE 189

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
            GPDH   F + V ++     +G   SK+ A+Q AA + L +  I
Sbjct: 190 KGPDHSKTFKISVFLNDEEVGKGEGGSKKEAQQKAAEDALSKMDI 234


>gi|254230524|ref|ZP_04923895.1| ribonuclease III [Vibrio sp. Ex25]
 gi|262393270|ref|YP_003285124.1| ribonuclease III [Vibrio sp. Ex25]
 gi|151936949|gb|EDN55836.1| ribonuclease III [Vibrio sp. Ex25]
 gi|262336864|gb|ACY50659.1| ribonuclease III [Vibrio sp. Ex25]
          Length = 225

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 80/217 (36%), Positives = 119/217 (54%), Gaps = 6/217 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE+++GY F +  L+  ALTH S +  + E   RLEFLGD IL  +I+  L++ F    E
Sbjct: 8   LERKLGYQFQDAGLINLALTHRSANSKHNE---RLEFLGDSILSFVIADDLYHRFPKVNE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G++S    +LV   T +++ RE DL  ++++     K       SI AD VE++I A+YL
Sbjct: 65  GDMSRMRATLVRGHTLAELGREFDLGDYLKLGPGELKSGGFRRDSILADAVEAIIGAIYL 124

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  +EV    V  ++  R  A+K G  ++D KT LQE+   +    P Y VT   G  H+
Sbjct: 125 DSDLEVVRGIVLSWYNSRLEAIKPGVSQKDPKTRLQEFLQGRRKPLPVYTVTNIKGEAHN 184

Query: 187 PRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
             FTV  E++G+  P  G   S+R AEQ AA   L++
Sbjct: 185 QEFTVECEVAGVDKPVIGKGTSRRKAEQAAAETALEQ 221


>gi|1228146|gb|AAA92440.1| RNase III [Salmonella enterica subsp. enterica serovar Typhimurium]
          Length = 224

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 82/226 (36%), Positives = 122/226 (53%), Gaps = 7/226 (3%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F ++ LL++ALTH S S  + E   RLEFLGD IL  +I+  L 
Sbjct: 1   MNPIVINRLQRKLGYTFNHQELLQQALTHRSASSKHNE---RLEFLGDSILSFVIANAL- 56

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S   + LV   T +++ARE DL   +R+     K       SI AD VE
Sbjct: 57  SRFPRVDEGDMSRMRDPLVRGNTLAELAREFDLGECLRLGPGELKSGGFRRESILADTVE 116

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  ++K R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 117 ALIGGVFLDSNIQTVEQLILNWYKTRLDEISPGDKQKDPKTRLQEYLQGRHLPLPSYLVV 176

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKRE 223
              G  HD  FT+  ++SGL+ P  G   S+R AEQ AA  V K E
Sbjct: 177 QVRGEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAAANSVKKLE 222


>gi|239993708|ref|ZP_04714232.1| ribonuclease III [Alteromonas macleodii ATCC 27126]
          Length = 228

 Score =  132 bits (332), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 79/221 (35%), Positives = 120/221 (54%), Gaps = 6/221 (2%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFD 64
           +Y  L K IGY F N +LLE+ALTH S +  + E   RLEFLGD ILG+++   LF  F 
Sbjct: 6   KYRRLYKAIGYTFTNEALLEQALTHRSAAKQHNE---RLEFLGDAILGMIVGETLFKRFP 62

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
           +  EG+L+   ++LV  +T +++A+E  +   + +     K      +SI AD VE+++ 
Sbjct: 63  TVPEGKLTRMRSTLVKGDTLAELAKEASVGELLNLGPGELKSGGHRRSSILADAVEAILG 122

Query: 125 ALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           A+YLD G++     +D+ W+ R   L      +D+KT LQE+   +    P Y+V   SG
Sbjct: 123 AIYLDSGMDEVRGVIDRLWETRINKLDPNAHPKDSKTRLQEFLQGRKQALPTYEVLSISG 182

Query: 183 PDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLKR 222
            DH   F V  ++  L  A      S+R AEQ AA   L++
Sbjct: 183 KDHAQTFEVSCQVESLPEAVVASGNSRRKAEQEAARLTLEK 223


>gi|28899346|ref|NP_798951.1| ribonuclease III [Vibrio parahaemolyticus RIMD 2210633]
 gi|153839958|ref|ZP_01992625.1| ribonuclease III [Vibrio parahaemolyticus AQ3810]
 gi|260365941|ref|ZP_05778431.1| ribonuclease III [Vibrio parahaemolyticus K5030]
 gi|260878963|ref|ZP_05891318.1| ribonuclease III [Vibrio parahaemolyticus AN-5034]
 gi|260898320|ref|ZP_05906816.1| ribonuclease III [Vibrio parahaemolyticus Peru-466]
 gi|31076860|sp|Q87LN9|RNC_VIBPA RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|28807582|dbj|BAC60835.1| ribonuclease III [Vibrio parahaemolyticus RIMD 2210633]
 gi|149746517|gb|EDM57506.1| ribonuclease III [Vibrio parahaemolyticus AQ3810]
 gi|308085245|gb|EFO34940.1| ribonuclease III [Vibrio parahaemolyticus Peru-466]
 gi|308090440|gb|EFO40135.1| ribonuclease III [Vibrio parahaemolyticus AN-5034]
 gi|308113210|gb|EFO50750.1| ribonuclease III [Vibrio parahaemolyticus K5030]
 gi|328474121|gb|EGF44926.1| ribonuclease III [Vibrio parahaemolyticus 10329]
          Length = 225

 Score =  132 bits (332), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 80/217 (36%), Positives = 119/217 (54%), Gaps = 6/217 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE+++GY F +  L+  ALTH S +  + E   RLEFLGD IL  +I+  L++ F    E
Sbjct: 8   LERKLGYQFKDAGLINLALTHRSANSKHNE---RLEFLGDSILSFVIADDLYHRFPKVNE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G++S    +LV   T +++ RE DL  ++++     K       SI AD VE++I A+YL
Sbjct: 65  GDMSRMRATLVRGHTLAELGREFDLGDYLKLGPGELKSGGFRRDSILADAVEAIIGAIYL 124

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  IE   + V  ++  R  A+K G  ++D KT LQE+   +    P Y VT   G  H+
Sbjct: 125 DSDIEKVRSIVLSWYNSRLEAIKPGVSQKDPKTRLQEFLQGRRKPLPVYTVTNIKGEAHN 184

Query: 187 PRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
             FTV  E++G+  P  G   S+R AEQ AA   L++
Sbjct: 185 QEFTVECEVAGVDKPVIGKGTSRRKAEQAAAETALEQ 221


>gi|220928138|ref|YP_002505047.1| ribonuclease III [Clostridium cellulolyticum H10]
 gi|219998466|gb|ACL75067.1| ribonuclease III [Clostridium cellulolyticum H10]
          Length = 236

 Score =  132 bits (332), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 85/232 (36%), Positives = 121/232 (52%), Gaps = 10/232 (4%)

Query: 1   MSALRY----STLEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILG 52
           M+ +RY    S LE  IGY F N+ ++  A+THSS ++  +    +  ERLEFLGD +LG
Sbjct: 1   MAEIRYDNRISELEDIIGYTFKNKDIIFAAVTHSSYANEKKSRKLKYNERLEFLGDSVLG 60

Query: 53  LLISTLLFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMT 112
           L IS  LF    +  EGELSV    +V   + SQ A ++ L  ++ +             
Sbjct: 61  LTISEYLFQKKPNLPEGELSVTRAKIVCENSLSQCATDIGLGKYLLLGKGEELSGGREKI 120

Query: 113 SIQADVVESLIAALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFG 170
           S+ +D  E+LI ALY+DGG E A +F+ +Y  +  ++   GK   D KT+LQE       
Sbjct: 121 SLLSDAFEALIGALYIDGGFETAKSFIYRYMDKIIKSCIEGKLFYDYKTQLQELVQQNGE 180

Query: 171 VTPEYKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
               Y VT + GPDH+  F   V+I+G    +G   SK+ AEQ AA   L  
Sbjct: 181 QQITYSVTDQFGPDHNKTFITEVKINGAIQGRGKGHSKKEAEQNAAKNALNN 232


>gi|34558193|ref|NP_908008.1| ribonuclease III [Wolinella succinogenes DSM 1740]
 gi|81653364|sp|Q7M840|RNC_WOLSU RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|34483912|emb|CAE10908.1| RIBONUCLEASE III [Wolinella succinogenes]
          Length = 238

 Score =  132 bits (332), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 84/212 (39%), Positives = 116/212 (54%), Gaps = 8/212 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
            EKR+GY F N++LL +ALTH S    Y    ERLEFLGD +L L+I   LF  F  A E
Sbjct: 7   FEKRLGYRFQNKNLLIEALTHKSYKKPYNN--ERLEFLGDAVLDLVIGEFLFLKFPKADE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS    SLV+ +  +++A  + L   I +S+    +      S+ ++  E+ + A+YL
Sbjct: 65  GELSKMRASLVNEKGFAKLAERVSLGRHIFISNAEENNKGREKPSLLSNAFEATMGAIYL 124

Query: 129 DGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           + G+    EV    +D+ + +  L  G   RD KT LQE   AKFG TPEY +   SGPD
Sbjct: 125 ETGLSVVREVVHRLLDEVYPKIDL--GSLFRDYKTALQELTQAKFGETPEYVILGSSGPD 182

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           H   F V V + G   A+    SK+ A+Q AA
Sbjct: 183 HKKEFEVAVCVLGSEYARACGSSKKEAQQEAA 214


>gi|332141899|ref|YP_004427637.1| ribonuclease III [Alteromonas macleodii str. 'Deep ecotype']
 gi|327551921|gb|AEA98639.1| ribonuclease III [Alteromonas macleodii str. 'Deep ecotype']
          Length = 228

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 121/225 (53%), Gaps = 14/225 (6%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFD 64
           +Y  L K IGY F N +LLE+ALTH S +  + E   RLEFLGD ILG++I   LF  F 
Sbjct: 6   KYLRLYKAIGYTFNNEALLEQALTHRSAAKQHNE---RLEFLGDAILGMIIGETLFKRFP 62

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
           +  EG+L+   ++LV  +T +++A+E  +   + +     K      +SI AD VE+++ 
Sbjct: 63  TVPEGKLTRMRSTLVKGDTLAELAKEASVGELLNLGPGELKSGGHRRSSILADAVEAILG 122

Query: 125 ALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           A+YLD G++     +D+ W+ R   L      +D+KT LQE+   +    P Y+V   SG
Sbjct: 123 AIYLDSGMDEVRGVIDRLWESRINQLDPNAHPKDSKTRLQEFLQGRKQALPTYEVLSISG 182

Query: 183 PDHDPRFTVVVEISGL-----APAQGMDCSKRAAEQVAAAEVLKR 222
            DH   F V  ++  L     AP      S+R AEQ AA   L++
Sbjct: 183 KDHAQTFEVCCKVESLPDAVVAPGN----SRRKAEQEAARLTLEK 223


>gi|332140432|ref|YP_004426170.1| ribonuclease III [Alteromonas macleodii str. 'Deep ecotype']
 gi|327550454|gb|AEA97172.1| ribonuclease III [Alteromonas macleodii str. 'Deep ecotype']
          Length = 228

 Score =  132 bits (331), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 120/221 (54%), Gaps = 6/221 (2%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFD 64
           +Y  L K IGY F N +LLE+ALTH S +  + E   RLEFLGD ILG++I   LF  F 
Sbjct: 6   KYLRLYKAIGYTFNNEALLEQALTHRSAAKQHNE---RLEFLGDAILGMIIGETLFKRFP 62

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
           +  EG+L+   ++LV  +T +++A+E  +   + +     K      +SI AD VE+++ 
Sbjct: 63  TVPEGKLTRMRSTLVKGDTLAELAKEASVGELLNLGPGELKSGGHRRSSILADAVEAILG 122

Query: 125 ALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           A+YLD G++     +D+ W+ R   L      +D+KT LQE+   +    P Y+V   SG
Sbjct: 123 AIYLDSGMDEVRGVIDRLWESRINQLDPNAHPKDSKTRLQEFLQGRKQALPTYEVLSISG 182

Query: 183 PDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLKR 222
            DH   F V  ++  L  A      S+R AEQ AA   L++
Sbjct: 183 KDHAQTFEVCCKVESLPDAVVASGNSRRKAEQEAARLTLEK 223


>gi|83644632|ref|YP_433067.1| ribonuclease III [Hahella chejuensis KCTC 2396]
 gi|123534042|sp|Q2SL32|RNC_HAHCH RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|83632675|gb|ABC28642.1| ribonuclease III [Hahella chejuensis KCTC 2396]
          Length = 226

 Score =  132 bits (331), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 85/220 (38%), Positives = 120/220 (54%), Gaps = 6/220 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L++ +GY F   +LL  ALTH S       + ERLEFLGD +L  +I+  LF  F+ A+E
Sbjct: 8   LQRALGYTFKEPALLTLALTHRSFGG---RNNERLEFLGDSVLNFIIADYLFGRFEEARE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS     +V   T +++ARE DL  ++R+ S   K       SI AD +ES+I A+YL
Sbjct: 65  GQLSRLRARMVKGVTLAEIAREFDLGEYLRLGSGEMKSGGFRRESILADALESIIGAIYL 124

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D G EV    V  +++ R   L     ++D+KT LQE+  A+    P Y+V    G  H 
Sbjct: 125 DAGFEVCADRVLNWFEARLQKLNLKDTQKDSKTRLQEYLQARQLNLPRYEVISVQGEAHA 184

Query: 187 PRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLKREGI 225
             F V  EI GL+ A +G   S+R AEQ AA + L   G+
Sbjct: 185 QTFHVRCEIDGLSDATEGTGSSRRVAEQKAAKQALLALGV 224


>gi|153005020|ref|YP_001379345.1| ribonuclease III [Anaeromyxobacter sp. Fw109-5]
 gi|152028593|gb|ABS26361.1| Ribonuclease III [Anaeromyxobacter sp. Fw109-5]
          Length = 377

 Score =  132 bits (331), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 81/218 (37%), Positives = 118/218 (54%), Gaps = 9/218 (4%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQE-----SYERLEFLGDRILGLLISTLLFN 61
           +TLE R+G    +RS    ALTH S  + +++       ERLEFLGD ++ L +S  L  
Sbjct: 18  ATLEARLGLCLGDRSTALAALTHKSYVNEHRDEPGLGDNERLEFLGDAVIDLAVSHRLME 77

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVES 121
            F +A+EG+LS    ++V  +  S++AR LDL S +R+             S+ AD +E+
Sbjct: 78  RFPAAREGDLSKMRAAVVDEQGLSEMARALDLGSLLRLGRGEELTGGRRKASLLADAMEA 137

Query: 122 LIAALYLDGGIEVAGTFVDKYWKQ---RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           ++AALYLD G+      +D++      RA  +G   RD KT+LQE A ++   TP Y+V 
Sbjct: 138 VVAALYLDAGLAPVLVLIDRFLGDAFARA-AAGTLDRDFKTQLQELAQSRVRATPRYRVV 196

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
              GPDH   F V  E+ G    +G   SK+ AEQ AA
Sbjct: 197 GEHGPDHSKTFEVETELRGEVVGRGTGRSKKDAEQAAA 234


>gi|329114470|ref|ZP_08243232.1| Ribonuclease 3 [Acetobacter pomorum DM001]
 gi|326696546|gb|EGE48225.1| Ribonuclease 3 [Acetobacter pomorum DM001]
          Length = 253

 Score =  132 bits (331), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 84/229 (36%), Positives = 121/229 (52%), Gaps = 12/229 (5%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSYQE-----------SYERLEFLGDRILGL 53
           R   LE R+GY F N  LL++ALTH S +H               S ERLEF+GDR+LGL
Sbjct: 23  RLEELEVRLGYRFVNPDLLQEALTHRSAAHQKAGGRKRQKAKGAGSNERLEFIGDRVLGL 82

Query: 54  LISTLLFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTS 113
           L++  L   F + +EG L  R   LVS  + +++A  LDL   + V++   +       +
Sbjct: 83  LMAEWLLERFPNEQEGALGSRLAHLVSRVSLAEIADRLDLPQSLTVAAHEARAGVQTAAN 142

Query: 114 IQADVVESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTP 173
           + AD +E+++ A++LDGG+E A   V  +W+          +D KT LQEW   +    P
Sbjct: 143 VVADALEAVLGAVFLDGGLEPARQMVRDWWRSALDAQAHPPKDPKTALQEWVLGRGQSLP 202

Query: 174 EYKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
            Y+     GP H P F V V   GL   +G   SKRAAE  AAA++L++
Sbjct: 203 VYETIGADGPSHAPLFVVRVTAGGLF-GEGRAGSKRAAESAAAADLLEK 250


>gi|91794117|ref|YP_563768.1| ribonuclease III [Shewanella denitrificans OS217]
 gi|123165871|sp|Q12KI1|RNC_SHEDO RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|91716119|gb|ABE56045.1| RNAse III [Shewanella denitrificans OS217]
          Length = 226

 Score =  131 bits (330), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 82/216 (37%), Positives = 121/216 (56%), Gaps = 6/216 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L + +GY F N+ LL +ALTH S ++ + E   RLEFLGD IL ++IS  L++ F  A E
Sbjct: 10  LSRTLGYEFTNQELLVQALTHRSAANKHNE---RLEFLGDSILSIVISDALYHQFPKATE 66

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV  ET + +A+E  L  ++ +     K       SI AD VE++I A+YL
Sbjct: 67  GDLSRMRATLVKGETLTLIAKEFKLGDYLFLGPGELKSGGFRRESILADAVEAIIGAVYL 126

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  ++   T +  ++K R   +K G  ++D KT LQE+        P+Y+V    G  HD
Sbjct: 127 DANMQACETLLLSWYKVRLDEIKPGINQKDPKTILQEYLQGYKKPLPDYQVVQVDGEAHD 186

Query: 187 PRFTVVVEISGLAP-AQGMDCSKRAAEQVAAAEVLK 221
             FTV   I  L     G+  S+R AEQ+AAA++L+
Sbjct: 187 QTFTVECRIQDLDEVVTGVGSSRRKAEQLAAAQILE 222


>gi|332992353|gb|AEF02408.1| ribonuclease III [Alteromonas sp. SN2]
          Length = 229

 Score =  131 bits (330), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 115/215 (53%), Gaps = 6/215 (2%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFD 64
           +Y  L K +GY F N +LLE+ALTH S +  + E   RLEFLGD ILG++I   LF  F 
Sbjct: 6   KYIRLSKALGYTFNNVALLEQALTHRSAAKQHNE---RLEFLGDAILGMVIGETLFKRFP 62

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EG+L+   ++LV  +T +++ARE  +   + +     K      +SI AD VE+++ 
Sbjct: 63  DVPEGKLTRMRSTLVKGDTLAELAREASMGELLHLGPGELKSGGHRRSSILADAVEAVLG 122

Query: 125 ALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           A+YLD G+E     +   W+ R  AL      +D+KT LQE+   +    P Y+V   SG
Sbjct: 123 AIYLDSGMEEVCNVIYHLWESRIEALNPNAHPKDSKTRLQEYLQGRKLPLPSYEVISISG 182

Query: 183 PDHDPRFTVVVEISGL-APAQGMDCSKRAAEQVAA 216
            DH   F V   ++ L  P      S+R AEQ AA
Sbjct: 183 KDHAQVFEVSCTVTTLDKPVSASGNSRRKAEQEAA 217


>gi|149910155|ref|ZP_01898801.1| ribonuclease III [Moritella sp. PE36]
 gi|149806741|gb|EDM66705.1| ribonuclease III [Moritella sp. PE36]
          Length = 223

 Score =  131 bits (330), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 83/217 (38%), Positives = 120/217 (55%), Gaps = 6/217 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L+  +GY + +  LL++ALTH S   +Y +  ERLEFLGD +LG +IS  LF  F    E
Sbjct: 8   LQTVLGYQYQDAGLLQQALTHRS---AYYKHNERLEFLGDSVLGFIISDALFRQFPEVPE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV   T +++ARE +L+  + +     K       SI AD VE+LI A+YL
Sbjct: 65  GDLSRMRATLVKGLTLAEIAREFELSECLILGPGELKSGGFRRESILADTVEALIGAMYL 124

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  IE     V  ++  R   ++ G  ++DAKT+LQEW   +    P Y+V    G  H+
Sbjct: 125 DSDIEKTRERVLAWYASRLATIEPGIGQKDAKTQLQEWLQGRKQPLPLYQVVEVRGEAHN 184

Query: 187 PRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
             FT+   I GL  P +G   S+R AEQ AA + L++
Sbjct: 185 QEFTIHCVIEGLDHPVEGKGTSRRKAEQEAAQKALEQ 221


>gi|222055246|ref|YP_002537608.1| Ribonuclease III [Geobacter sp. FRC-32]
 gi|221564535|gb|ACM20507.1| Ribonuclease III [Geobacter sp. FRC-32]
          Length = 238

 Score =  131 bits (330), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 82/220 (37%), Positives = 126/220 (57%), Gaps = 10/220 (4%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISH----SYQESYERLEFLGDRILGLLISTLLFNH 62
           + LEK I Y F ++SLL +ALTH S  +      ++  +RLEFLGD ++GL++S  LF+ 
Sbjct: 10  AALEKLINYDFTDKSLLVEALTHPSFVNESGGKVRQDNQRLEFLGDAVVGLVLSHDLFSR 69

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           F  ++EGEL+    SLV   + + +AR +DL + +++     +       S+ AD  E+L
Sbjct: 70  FPDSREGELTKLRASLVDEASLAILARAIDLGAHLKLGRGEERSGGRTKPSLLADAYEAL 129

Query: 123 IAALYLDGGIEVAGTFVDKYW----KQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +AA+YLDGGIE A   +  ++    ++R +++    RD KTE QE AH    + P Y + 
Sbjct: 130 LAAVYLDGGIEPAAAIIKSHFASFMEKRNIRTSG--RDFKTEFQELAHRLRSLAPRYLLQ 187

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAE 218
             SGPDH   F+V V I      +G+  SK+ AEQ AA +
Sbjct: 188 GVSGPDHQRIFSVAVFIGEEFMGEGLAKSKKEAEQAAAEQ 227


>gi|257093153|ref|YP_003166794.1| Ribonuclease III [Candidatus Accumulibacter phosphatis clade IIA
           str. UW-1]
 gi|257045677|gb|ACV34865.1| Ribonuclease III [Candidatus Accumulibacter phosphatis clade IIA
           str. UW-1]
          Length = 223

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 84/217 (38%), Positives = 117/217 (53%), Gaps = 6/217 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           S LE+ +GY F +R+LL+ ALTH S S  + E   RLEFLGD IL  +I+  LF  F + 
Sbjct: 4   SRLERGLGYTFRDRALLQTALTHRSYSSPHNE---RLEFLGDAILNAVIARSLFERFPTL 60

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG+LS     LV  +   Q A  L L  F+R+    +K       SI AD +E+L  AL
Sbjct: 61  PEGDLSRLRAQLVRQDGLHQQALALSLGDFLRLGEGEQKSGGQQRPSILADGLEALFGAL 120

Query: 127 YLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           +LD G E AG  +++ ++   + L  G+  +DAKT LQE+   +    P+Y +T   G  
Sbjct: 121 WLDAGFEAAGEVINRLYESMLKQLIPGQGTKDAKTRLQEYLQGRRLALPQYALTGAEGEA 180

Query: 185 HDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVL 220
           H   FTV   I  L    +G   ++RAAEQ+AA   L
Sbjct: 181 HAQHFTVTCVIDALRIRTEGSGSNRRAAEQIAAERAL 217


>gi|118474451|ref|YP_892860.1| ribonuclease III [Campylobacter fetus subsp. fetus 82-40]
 gi|261885507|ref|ZP_06009546.1| ribonuclease III [Campylobacter fetus subsp. venerealis str.
           Azul-94]
 gi|189043299|sp|A0RRM7|RNC_CAMFF RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|118413677|gb|ABK82097.1| ribonuclease III [Campylobacter fetus subsp. fetus 82-40]
          Length = 223

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 79/223 (35%), Positives = 127/223 (56%), Gaps = 4/223 (1%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFD 64
           + + LE+ +GY F N++LL++ALTH S+  S     ERLEFLGD +L L++   LF  F 
Sbjct: 3   KLNRLEEHLGYKFKNKTLLKEALTHKSMKSSVNN--ERLEFLGDAVLDLIVGEYLFFKFK 60

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EG LS    +LV+ ++ + ++ ++ L  F+ +S+    +      S+ +D +E+L+ 
Sbjct: 61  DTDEGNLSKLRAALVNEKSFASISSQIRLGDFLYLSAAEDNNNGRNKPSLVSDALEALMG 120

Query: 125 ALYLDGGIE-VAGTFVDKYWKQ-RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           A+YL+ G+E V   F++    Q   +      +D KT LQE   A+FGVTP Y++   SG
Sbjct: 121 AIYLESGLEAVKKIFINLLESQYNNIDLQSLGKDYKTTLQEITQARFGVTPRYELVSSSG 180

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           PDH   F + V ++    A+ +  SK+ AEQ AA +VL+   I
Sbjct: 181 PDHKKSFEMAVFLNDKELARAIGNSKKEAEQSAAWKVLQGMNI 223


>gi|268680594|ref|YP_003305025.1| ribonuclease III [Sulfurospirillum deleyianum DSM 6946]
 gi|268618625|gb|ACZ12990.1| ribonuclease III [Sulfurospirillum deleyianum DSM 6946]
          Length = 227

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 83/224 (37%), Positives = 121/224 (54%), Gaps = 7/224 (3%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFD 64
           +   L+KR+GY F N++L+ +ALTH S    Y  + ERLEFLGD +L L++   L+  F 
Sbjct: 4   KLEALQKRLGYQFKNQNLIIEALTHKSSKQPY--NNERLEFLGDAVLDLIVGEYLYKEFL 61

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EGELS    SLV+ ++  ++AR L L   I +S     +      S+ ++  E++I 
Sbjct: 62  GVAEGELSKLRASLVNEKSFEKLARLLHLGESIYISLAEENNNGREKPSLLSNAFEAIIG 121

Query: 125 ALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           ALYL+ G+E A T      ++    +      RD KT LQE   A FGVTPEY++    G
Sbjct: 122 ALYLEAGLEKARTLAISLLEEAYPKIDMDAIFRDHKTTLQELTQAHFGVTPEYRLVRSFG 181

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVA---AAEVLKRE 223
           PDH   F + V + G   +     SK+ A+Q A   A E+LK+E
Sbjct: 182 PDHQKEFEIAVSVRGSDLSLASGKSKKEAQQKAALLALEILKKE 225


>gi|160934422|ref|ZP_02081809.1| hypothetical protein CLOLEP_03295 [Clostridium leptum DSM 753]
 gi|156867095|gb|EDO60467.1| hypothetical protein CLOLEP_03295 [Clostridium leptum DSM 753]
          Length = 237

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 86/227 (37%), Positives = 127/227 (55%), Gaps = 12/227 (5%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSIS---HSYQESYERLEFLGDRILGLLISTLLFNH 62
           +  LE+ +GYAF N  LL+ ALTHSS +   H+   S ERLEFLGD +L +++S  +F +
Sbjct: 14  FRRLEENLGYAFQNPKLLKTALTHSSYANEAHNGTRSNERLEFLGDAVLSIVVSDYIFRN 73

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
                EGEL+    SLV  ++  + +R L++ SF+R+S   +    +  +SI AD  E++
Sbjct: 74  CPHLPEGELTKMRASLVCEKSLQRFSRVLEIGSFLRLSRGEQNSGGAERSSILADAFEAV 133

Query: 123 IAALYLDGGIEVAGTFVDKYW-KQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTF-- 179
           +AA+YLDGG+E A  FV ++   +      K  +D KT LQE         PE K+ +  
Sbjct: 134 LAAIYLDGGMEKAREFVLRFTVPEMENPKPKAFKDYKTALQEIVQQ----NPEEKLNYVL 189

Query: 180 --RSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
              SGPDH+  F V V ++     +G   SK+ AEQ AA E L+  G
Sbjct: 190 VGESGPDHNKHFVVEVHLNSNVIGKGGGRSKKEAEQQAAREALELMG 236


>gi|71907657|ref|YP_285244.1| ribonuclease III [Dechloromonas aromatica RCB]
 gi|90101622|sp|Q47EF7|RNC_DECAR RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|71847278|gb|AAZ46774.1| RNAse III [Dechloromonas aromatica RCB]
          Length = 222

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 80/219 (36%), Positives = 123/219 (56%), Gaps = 10/219 (4%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAK 67
           ++ K++ + F++++L   ALTH S       + ERLEFLGD +L  +I+  L++ F    
Sbjct: 5   SVAKKLNHCFSDQALFRTALTHRSFG---TPNNERLEFLGDGVLDFVIAASLYHRFPDLP 61

Query: 68  EGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALY 127
           EG+LS    +LV  ET  ++A EL++ +F+R+     K   +   SI AD +E+L  A+Y
Sbjct: 62  EGDLSRLRANLVRQETLHRLALELNIGAFLRLGEGELKSGGAQRPSILADALEALFGAIY 121

Query: 128 LDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           LD G E +   ++K +      LK G+F++DAKT LQEW   +    P Y +   +G  H
Sbjct: 122 LDAGFEASRAVIEKLFAPLLDDLKPGQFQKDAKTRLQEWLQGRKKALPRYHLLEATGAAH 181

Query: 186 DPRFTVVVEISGLAPAQ---GMDCSKRAAEQVAAAEVLK 221
           + RF +  EI   +PA    G   S+R AEQVAA + LK
Sbjct: 182 EQRFEIACEIE--SPALRTVGHGSSRRIAEQVAAEKALK 218


>gi|224368198|ref|YP_002602361.1| two domain fusion protein Includes: metal-dependent phosphoesterase
           / ribonuclease III [Desulfobacterium autotrophicum HRM2]
 gi|223690914|gb|ACN14197.1| two domain fusion protein Includes: metal-dependent phosphoesterase
           / ribonuclease III [Desulfobacterium autotrophicum HRM2]
          Length = 520

 Score =  131 bits (329), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 118/223 (52%), Gaps = 7/223 (3%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESY----ERLEFLGDRILGLLISTLLF 60
           R   LEK +G+ FANR LLE AL HSS  +  Q +     +RLEF+GD +LGL I  +L 
Sbjct: 292 RLEILEKNLGHTFANRELLENALRHSSYVNELQANQVPDNQRLEFMGDAVLGLTIGQILM 351

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
                  EG LS    +LVS    + +AR++DL  FIR+    R    S   SI AD  E
Sbjct: 352 EEHPGMNEGSLSKARAALVSEPALASMARQIDLGRFIRLGKGERLSRGSEKNSILADAFE 411

Query: 121 SLIAALYLDGGIEVAGTFV-DKYWKQ-RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +++AA+YLD G +     V +++  Q + + S     D K+ LQE+   K    P Y + 
Sbjct: 412 AVMAAIYLDCGFKQTCALVKEQFISQIKLINSAPEIEDFKSMLQEFVQEKGNTPPCYTIH 471

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
              GPDHD  F++ V+   +  + G   SK+AAEQ AA   LK
Sbjct: 472 REFGPDHDKTFSICVKACDIE-SMGSGKSKKAAEQHAAQNALK 513


>gi|302391792|ref|YP_003827612.1| RNAse III [Acetohalobium arabaticum DSM 5501]
 gi|302203869|gb|ADL12547.1| RNAse III [Acetohalobium arabaticum DSM 5501]
          Length = 234

 Score =  131 bits (329), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 79/220 (35%), Positives = 122/220 (55%), Gaps = 6/220 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQE----SYERLEFLGDRILGLLISTLLFNHFD 64
           L+ +I   FA+  LL++ALTH S ++  ++      ERLEFLGD +L +++S  +FN + 
Sbjct: 13  LQSKIDIYFADLDLLQRALTHKSYANENRDLNLKDNERLEFLGDSVLDIVVSEYMFNRYP 72

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EG+L+    S+VSA T +  ARELDL  ++ +            +SI AD  E+L+ 
Sbjct: 73  DYPEGKLAKMRASVVSAPTLAAKARELDLGRYLLLGHGEEMTGGRKRSSILADAFEALVG 132

Query: 125 ALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           ++YLD  +++A  F+ K  K    + ++G+  RD KT LQE    +    PEY V    G
Sbjct: 133 SIYLDQDLDIAEDFIMKLMKVDIESAEAGEHIRDYKTTLQEMIQKRSNARPEYYVIEEKG 192

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           PDH   FTV V+ +  +  +G   SK+ A+Q AA   LK+
Sbjct: 193 PDHSKEFTVEVKFNDRSLGEGTGSSKKEAQQQAAKNALKK 232


>gi|88606764|ref|YP_505691.1| ribonuclease III [Anaplasma phagocytophilum HZ]
 gi|123494405|sp|Q2GIW0|RNC_ANAPZ RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|88597827|gb|ABD43297.1| ribonuclease III [Anaplasma phagocytophilum HZ]
          Length = 236

 Score =  131 bits (329), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 122/211 (57%), Gaps = 4/211 (1%)

Query: 14  GYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELSV 73
           GY F +  LL+ A+TH SI+     SYERLEFLGD +LGL++S +L+  F    EG L+ 
Sbjct: 21  GYRFQDHELLKTAVTHPSIAAERYASYERLEFLGDAVLGLVVSEMLYTLFPDDSEGLLTK 80

Query: 74  RFNSLVSAETCSQVARELDLASFIRVS-SDLRKDVCSFMTSIQADVVESLIAALYLDGGI 132
           +  +LV      ++A+ L+L + + +S  +L     S  ++++ + +E+LI A+Y+DGG+
Sbjct: 81  KRIALVRGSKVVEIAQSLNLGNILLMSKGELTSGGISNNSNLE-NALEALIGAIYVDGGL 139

Query: 133 EVAGTFVDKYWKQRALK-SGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTV 191
           E    F+ ++WK  A   +    +DAKT LQEWA       P Y++  +SG +H P FTV
Sbjct: 140 ESVRHFILQHWKPLATNLADTPLQDAKTALQEWAQGHNFAIPSYRLINKSGLEHAPVFTV 199

Query: 192 VVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
            V ++G        C K+ AE  AA  +L++
Sbjct: 200 EVTVNG-QRVHATGCKKKYAEIAAAKLMLEK 229


>gi|323144165|ref|ZP_08078801.1| ribonuclease III [Succinatimonas hippei YIT 12066]
 gi|322416073|gb|EFY06771.1| ribonuclease III [Succinatimonas hippei YIT 12066]
          Length = 233

 Score =  131 bits (329), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 89/217 (41%), Positives = 122/217 (56%), Gaps = 8/217 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE  IGYAF N SLLE+ALTH S    + E   RLEFLGD ILG++I+  L+  F    E
Sbjct: 13  LEITIGYAFQNLSLLEQALTHRSFGPVHNE---RLEFLGDSILGMVIAKKLYAMFPHNPE 69

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+L+   +SLV   T +++ARE  L + +R+     K   +   S+ AD VES+IAA+YL
Sbjct: 70  GDLTRMRSSLVRETTLAELAREFGLGNCLRLGPGELKTGGARRDSLLADAVESVIAAMYL 129

Query: 129 DGGIE--VAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           D G E       V  ++  R   +     ++D K+ LQE   ++    P+YKV   SG D
Sbjct: 130 DSGEEFDTVRQIVLSWFHSRLKTINPKVNQKDPKSSLQELLQSQHKPLPQYKVVNISGTD 189

Query: 185 HDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVL 220
           +D  FTV V + G++    G   SKR AEQVAA  +L
Sbjct: 190 NDQVFTVEVCVEGVSEKFSGKGSSKRRAEQVAAQHLL 226


>gi|260899641|ref|ZP_05908036.1| ribonuclease III [Vibrio parahaemolyticus AQ4037]
 gi|308110559|gb|EFO48099.1| ribonuclease III [Vibrio parahaemolyticus AQ4037]
          Length = 225

 Score =  131 bits (329), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 80/217 (36%), Positives = 119/217 (54%), Gaps = 6/217 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE+++GY F +  L+  ALTH S +  + E   RLEFLGD IL  +I+  L++ F    E
Sbjct: 8   LERKLGYQFKDAGLINLALTHRSANSKHNE---RLEFLGDSILSFVIADDLYHRFPKVNE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G++S    +LV   T +++ RE DL  ++++     K       SI AD VE++I A+YL
Sbjct: 65  GDMSRMRATLVRGHTLAELGREFDLGDYLKLGPGELKSGGFRRDSILADAVEAIIGAIYL 124

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  IE   + V  ++  R  A+K G  ++D KT LQE+   +    P Y VT   G  H+
Sbjct: 125 DSDIEKVRSIVLSWYYSRLEAIKPGVSQKDPKTRLQEFLQGRRKPLPVYTVTNIKGEAHN 184

Query: 187 PRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
             FTV  E++G+  P  G   S+R AEQ AA   L++
Sbjct: 185 QEFTVECEVAGVDKPVIGKGTSRRKAEQAAAETALEQ 221


>gi|85373795|ref|YP_457857.1| ribonuclease III [Erythrobacter litoralis HTCC2594]
 gi|84786878|gb|ABC63060.1| ribonuclease III [Erythrobacter litoralis HTCC2594]
          Length = 223

 Score =  131 bits (329), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 82/226 (36%), Positives = 118/226 (52%), Gaps = 5/226 (2%)

Query: 1   MSALRYSTLE--KRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTL 58
           M+ L   TL+     G+A  +  L  +ALTH S     +  Y+RLEFLGDR+LGL IS  
Sbjct: 1   MTILAPETLQWLADTGFAVEDDELWLEALTHGSTG--AERDYQRLEFLGDRVLGLAISDH 58

Query: 59  LFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADV 118
           LF       EG L+ R N+LVS   C+++ R + L+  + +    R+D  +  T+I  DV
Sbjct: 59  LFRKV-GGSEGALAQRLNALVSKGACAKIGRRIGLSDHLVLGKQAREDGAAQSTNILGDV 117

Query: 119 VESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           VE+L+ A YLD G       V   W +         +  K+ LQEWA       P+Y++ 
Sbjct: 118 VEALLGANYLDAGFGPTCALVHLLWDEDLNGMAGRSKHPKSALQEWAAGNQRRPPQYELV 177

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
            RSGPDH   FTV VE+  +  A+    SK+ AE  AA + +++ G
Sbjct: 178 DRSGPDHAAIFTVRVEVHKVGAAEATASSKQEAETEAAKKFMEQFG 223


>gi|253699690|ref|YP_003020879.1| ribonuclease III [Geobacter sp. M21]
 gi|251774540|gb|ACT17121.1| ribonuclease III [Geobacter sp. M21]
          Length = 232

 Score =  131 bits (329), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 90/224 (40%), Positives = 127/224 (56%), Gaps = 11/224 (4%)

Query: 9   LEKRIGYAFANRSLLEKALTHSS-ISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAK 67
           +E R+GY F +R LL +ALTH + ++ +     +RLEF GD +L  L+S +L   F  ++
Sbjct: 12  IEGRLGYRFRDRGLLAEALTHRTYVNEAGGRDNQRLEFFGDAVLDFLLSDMLLVRFPDSR 71

Query: 68  EGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALY 127
           EGEL+    +LV   + +++A ELDL   +R+     +       S+ AD  E+L+AALY
Sbjct: 72  EGELTRIRAALVDEASLAKIAIELDLGQALRLGRGEERGGGRQKRSLLADAFEALLAALY 131

Query: 128 LDGGIEVAGTFVDKYW----KQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           LDGG++ A   V+  +      R L SG   RDAKTELQE A    G  P Y++   SGP
Sbjct: 132 LDGGLDPARRVVEALFAPLLSSRDLLSG---RDAKTELQEKARLVKGELPRYQLKEVSGP 188

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAE---VLKREG 224
           DHD RFTV V +      +G+  SK+ AEQ AA     +LK EG
Sbjct: 189 DHDKRFTVEVYLGEELMGEGVGKSKKEAEQDAARAAFLLLKGEG 232


>gi|148265180|ref|YP_001231886.1| ribonuclease III [Geobacter uraniireducens Rf4]
 gi|146398680|gb|ABQ27313.1| RNAse III [Geobacter uraniireducens Rf4]
          Length = 240

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 84/222 (37%), Positives = 122/222 (54%), Gaps = 10/222 (4%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISH----SYQESYERLEFLGDRILGLLISTLLFNHFD 64
           LE  I Y FA+RSLL +ALTH S  +     + +  +RLEF GD ++  L+S +L   F 
Sbjct: 12  LESAINYHFADRSLLTEALTHRSFVNESGGKWTKDNQRLEFFGDAVIDFLLSRMLLERFP 71

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
            ++EG L+    SLV   + + +A E+ L +F+++     +       S+ AD  E+L+A
Sbjct: 72  DSREGALTKIRASLVDEGSLASLAEEIGLGAFLKLGRGEERSGGRRKRSLLADAYEALMA 131

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGK----FRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           A+YLDGGIE     V+ ++ +  L +G+      RD KTE QE AHA  G  P Y +   
Sbjct: 132 AVYLDGGIEPVQRLVEAHFAR--LMAGREVLSAGRDYKTEFQELAHALRGSMPRYVLRGI 189

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           SGPDH+  FTV + I      +G   SK+ AEQ AA E + R
Sbjct: 190 SGPDHERSFTVALFIGDERMGEGAGRSKKEAEQAAAREGIAR 231


>gi|224438391|ref|ZP_03659318.1| ribonuclease III [Helicobacter cinaedi CCUG 18818]
 gi|313144833|ref|ZP_07807026.1| ribonuclease 3 [Helicobacter cinaedi CCUG 18818]
 gi|313129864|gb|EFR47481.1| ribonuclease 3 [Helicobacter cinaedi CCUG 18818]
          Length = 242

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 115/210 (54%), Gaps = 4/210 (1%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LEK++GY F ++ LL +ALTH S  ++Y    ERLEFLGD +L LL+   LF  F SAKE
Sbjct: 13  LEKKLGYTFKDKKLLLEALTHKSCKNAYNN--ERLEFLGDAVLDLLVGEFLFRKFPSAKE 70

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS     +V+ +   ++A+ LDL +F+ +S     +      SI ++  E+L+ A+YL
Sbjct: 71  GELSKLRACIVNEKGFMKLAKSLDLGAFLHISQSEEHNKGREKASILSNAFEALMGAIYL 130

Query: 129 DGGIEVAGTFVDKYWKQRALKSG--KFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           +  +      V K  +Q   K        D KT LQE   A FG  P Y +   SGPDH 
Sbjct: 131 ESELTFLKDIVLKLLEQNYAKIDLRSLFTDYKTALQELTQAIFGEIPTYTLVSESGPDHQ 190

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
             F + + ++G+  A+    SK+ A+Q +A
Sbjct: 191 KSFEIALSVNGVEYARAKGSSKKDAQQKSA 220


>gi|254797243|ref|YP_003082085.1| ribonuclease III [Neorickettsia risticii str. Illinois]
 gi|254590493|gb|ACT69855.1| ribonuclease III [Neorickettsia risticii str. Illinois]
          Length = 222

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 108/194 (55%), Gaps = 2/194 (1%)

Query: 4   LRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           +    L+  +G  F N+ LL +ALTH S+      SYERLEFLGD +L L+++++L++ F
Sbjct: 1   MELEELQSLLGVHFKNKELLVEALTHPSVEKC--PSYERLEFLGDAVLNLVVASMLYDLF 58

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
               EG LS R + LV     + +AR+++L   IR+SS          T+   +V+E+LI
Sbjct: 59  PGDPEGRLSQRQSVLVCKTALAMLARQMNLGDCIRLSSSEEASGGRDKTNNLENVLEALI 118

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
            A++LD G E    F+ K+W + A++S     + K+ LQE   AK    P Y V  RSGP
Sbjct: 119 GAIFLDAGFETVTCFIQKHWYELAVQSDSIEPNPKSALQELLQAKGMKPPVYNVIDRSGP 178

Query: 184 DHDPRFTVVVEISG 197
            H P F V + + G
Sbjct: 179 AHLPIFEVEICVDG 192


>gi|152995275|ref|YP_001340110.1| ribonuclease III [Marinomonas sp. MWYL1]
 gi|189043327|sp|A6VUP6|RNC_MARMS RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|150836199|gb|ABR70175.1| Ribonuclease III [Marinomonas sp. MWYL1]
          Length = 227

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 88/216 (40%), Positives = 120/216 (55%), Gaps = 7/216 (3%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           MS+L Y  L +RIGY FA+  LLE ALTH S      ++ ERLEFLGD IL  +I+  LF
Sbjct: 1   MSSL-YQKLSRRIGYFFADLGLLELALTHRSFG---GKNNERLEFLGDSILNYVIAEDLF 56

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F  AKEGELS    SLV  +T +++ARE +L  ++++ +   K       SI AD VE
Sbjct: 57  HRFPKAKEGELSRLRASLVKGDTLAELAREFELGDYLKLGAGELKSGGFRRDSILADTVE 116

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
            +I A+YLD G++V    +  ++K+R  A       +DAKT LQE+  A+    P+Y V 
Sbjct: 117 GIIGAMYLDAGMDVCRQHILAWYKERLDATSLKIVTKDAKTRLQEFLQARKHALPQYDVV 176

Query: 179 FRSGPDHDPRFTVVVEISGLAP-AQGMDCSKRAAEQ 213
              G  HD  F V   I       +G   S+R AEQ
Sbjct: 177 NIVGEPHDQTFYVHCHIELCEEFIEGKGNSRRIAEQ 212


>gi|15642457|ref|NP_232090.1| ribonuclease III [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121590982|ref|ZP_01678301.1| ribonuclease III [Vibrio cholerae 2740-80]
 gi|153820073|ref|ZP_01972740.1| ribonuclease III [Vibrio cholerae NCTC 8457]
 gi|153823692|ref|ZP_01976359.1| ribonuclease III [Vibrio cholerae B33]
 gi|227082582|ref|YP_002811133.1| ribonuclease III [Vibrio cholerae M66-2]
 gi|229507479|ref|ZP_04396984.1| ribonuclease III [Vibrio cholerae BX 330286]
 gi|229512326|ref|ZP_04401805.1| ribonuclease III [Vibrio cholerae B33]
 gi|229519462|ref|ZP_04408905.1| ribonuclease III [Vibrio cholerae RC9]
 gi|229606984|ref|YP_002877632.1| ribonuclease III [Vibrio cholerae MJ-1236]
 gi|254849586|ref|ZP_05238936.1| ribonuclease III [Vibrio cholerae MO10]
 gi|298500182|ref|ZP_07009987.1| ribonuclease III [Vibrio cholerae MAK 757]
 gi|18203192|sp|Q9KPB2|RNC_VIBCH RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|254807908|sp|C3LR04|RNC_VIBCM RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|9657039|gb|AAF95603.1| ribonuclease III [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121547159|gb|EAX57288.1| ribonuclease III [Vibrio cholerae 2740-80]
 gi|126509385|gb|EAZ71979.1| ribonuclease III [Vibrio cholerae NCTC 8457]
 gi|126518780|gb|EAZ76003.1| ribonuclease III [Vibrio cholerae B33]
 gi|227010470|gb|ACP06682.1| ribonuclease III [Vibrio cholerae M66-2]
 gi|229344151|gb|EEO09126.1| ribonuclease III [Vibrio cholerae RC9]
 gi|229352291|gb|EEO17232.1| ribonuclease III [Vibrio cholerae B33]
 gi|229354984|gb|EEO19905.1| ribonuclease III [Vibrio cholerae BX 330286]
 gi|229369639|gb|ACQ60062.1| ribonuclease III [Vibrio cholerae MJ-1236]
 gi|254845291|gb|EET23705.1| ribonuclease III [Vibrio cholerae MO10]
 gi|297540875|gb|EFH76929.1| ribonuclease III [Vibrio cholerae MAK 757]
          Length = 225

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 79/219 (36%), Positives = 117/219 (53%), Gaps = 6/219 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L  ++GY F    LL  ALTH S +  + E   RLEFLGD IL  +I+  L+  F   
Sbjct: 6   NKLTSKLGYTFKETELLNLALTHRSANGKHNE---RLEFLGDSILSFVIADELYRRFPKV 62

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG++S    +LV   T +++ RE DL  ++++     K       SI AD VE++I A+
Sbjct: 63  NEGDMSRMRATLVRGNTLAELGREFDLGDYLKLGPGELKSGGFRRDSILADAVEAIIGAI 122

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLD  +E A + V +++  R   +K G  ++D KT LQE+   +    P Y VT   G  
Sbjct: 123 YLDSDLETARSIVLEWYHGRLEEIKPGASQKDPKTRLQEFLQGRRKPLPVYTVTNIKGEA 182

Query: 185 HDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
           H+  FTV  E++G+  P  G   S+R AEQ AA   L++
Sbjct: 183 HNQEFTVACEVAGMDTPVIGKGTSRRKAEQAAAETALEQ 221


>gi|189184858|ref|YP_001938643.1| ribonuclease III [Orientia tsutsugamushi str. Ikeda]
 gi|189181629|dbj|BAG41409.1| ribonuclease III [Orientia tsutsugamushi str. Ikeda]
          Length = 246

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 82/223 (36%), Positives = 132/223 (59%), Gaps = 12/223 (5%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSIS-HSYQESYERLEFLGDRILGLLISTLLFNHF 63
           +  TL+  IGY F +  LL +ALTH SI+ + Y ++Y+RLEFLGD IL L+IS  LF +F
Sbjct: 18  KLDTLQSEIGYNFNSIDLLIEALTHPSINQYGYTKNYQRLEFLGDVILNLVISETLFKNF 77

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVC---SFMTSIQADVVE 120
               EG+L+     LV  E+   +A++++L  +I ++++  K  C   S   +I+ + +E
Sbjct: 78  SHYNEGKLAKSRAFLVCNESICLIAQKINLHKYIIMTANEEK--CGGRSNKNNIE-NTME 134

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFR--RDAKTELQEWAHAK-FGVTPEYKV 177
           ++I A+YLDGGI V    V+  WK   +K  +     D K+ LQEW+ +K FG+ P Y +
Sbjct: 135 AVIGAVYLDGGIHVIKDIVNSLWK-VLIKDHELYLIADPKSALQEWSQSKNFGI-PTYTL 192

Query: 178 TFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
           + ++G  H P F V+V++  L P  G   + + A++ AA  +L
Sbjct: 193 SSKTGQSHSPLFEVMVKVGRLEPQYGKGTTIKTAQKNAAQLML 235


>gi|156975792|ref|YP_001446699.1| ribonuclease III [Vibrio harveyi ATCC BAA-1116]
 gi|269960405|ref|ZP_06174778.1| Ribonuclease 3 [Vibrio harveyi 1DA3]
 gi|189043375|sp|A7MZA8|RNC_VIBHB RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|156527386|gb|ABU72472.1| hypothetical protein VIBHAR_03536 [Vibrio harveyi ATCC BAA-1116]
 gi|269834832|gb|EEZ88918.1| Ribonuclease 3 [Vibrio harveyi 1DA3]
          Length = 225

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 118/217 (54%), Gaps = 6/217 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE+++GY F +  L+  ALTH S +  + E   RLEFLGD IL  +I+  L++ F    E
Sbjct: 8   LERKLGYQFKDAGLINLALTHRSANSKHNE---RLEFLGDSILSFVIADDLYHRFPKVNE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G++S    +LV   T +++ RE DL  ++++     K       SI AD VE++I A+YL
Sbjct: 65  GDMSRMRATLVRGHTLAELGREFDLGDYLKLGPGELKSGGFRRDSILADAVEAIIGAIYL 124

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  IE     V  ++  R  A+K G  ++D KT LQE+   +    P Y VT   G  H+
Sbjct: 125 DSDIEAVRGIVLSWYNSRLEAIKPGVSQKDPKTRLQEFLQGRRKPLPVYTVTNIKGEAHN 184

Query: 187 PRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
             FTV  +++G+  P  G   S+R AEQ AA   L++
Sbjct: 185 QEFTVECDVAGVDKPVIGKGTSRRKAEQAAAETALEQ 221


>gi|255746868|ref|ZP_05420813.1| ribonuclease III [Vibrio cholera CIRS 101]
 gi|262162033|ref|ZP_06031049.1| ribonuclease III [Vibrio cholerae INDRE 91/1]
 gi|255735270|gb|EET90670.1| ribonuclease III [Vibrio cholera CIRS 101]
 gi|262028282|gb|EEY46939.1| ribonuclease III [Vibrio cholerae INDRE 91/1]
          Length = 221

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 79/219 (36%), Positives = 117/219 (53%), Gaps = 6/219 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L  ++GY F    LL  ALTH S +  + E   RLEFLGD IL  +I+  L+  F   
Sbjct: 2   NKLTSKLGYTFKETELLNLALTHRSANGKHNE---RLEFLGDSILSFVIADELYRRFPKV 58

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG++S    +LV   T +++ RE DL  ++++     K       SI AD VE++I A+
Sbjct: 59  NEGDMSRMRATLVRGNTLAELGREFDLGDYLKLGPGELKSGGFRRDSILADAVEAIIGAI 118

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLD  +E A + V +++  R   +K G  ++D KT LQE+   +    P Y VT   G  
Sbjct: 119 YLDSDLETARSIVLEWYHGRLEEIKPGASQKDPKTRLQEFLQGRRKPLPVYTVTNIKGEA 178

Query: 185 HDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
           H+  FTV  E++G+  P  G   S+R AEQ AA   L++
Sbjct: 179 HNQEFTVACEVAGMDTPVIGKGTSRRKAEQAAAETALEQ 217


>gi|158320491|ref|YP_001512998.1| ribonuclease III [Alkaliphilus oremlandii OhILAs]
 gi|158140690|gb|ABW19002.1| Ribonuclease III [Alkaliphilus oremlandii OhILAs]
          Length = 241

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 81/219 (36%), Positives = 119/219 (54%), Gaps = 6/219 (2%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLISTLLFNHFDS 65
           +K IGY F N S++ +ALTHSS ++ Y+    ++ ERLEFLGD +LG+++S  ++  +  
Sbjct: 15  QKIIGYQFKNLSIINEALTHSSYTNEYRKKQVQNNERLEFLGDSVLGIVVSEYIYLKYKD 74

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EGEL+    ++V   +    A+E+ L  ++ +             SI AD  E++I A
Sbjct: 75  LPEGELTKIRANVVCEPSLGNQAKEIKLGQYLLLGKGEEATGGRDRVSILADAFEAVIGA 134

Query: 126 LYLDGGIEVAGTFV-DKYWKQRALK-SGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           LYLDGGI VAG F+ D   +   L   G   RD KT+LQE   +K+     YKV    GP
Sbjct: 135 LYLDGGIAVAGKFILDMLTRSIELAIEGNLFRDYKTDLQEILQSKYDEKISYKVVSEVGP 194

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           DH+  F V + +   +   G   SK+ AEQ AA   LK+
Sbjct: 195 DHNKTFEVEILLGEKSLGMGEGKSKKEAEQRAAKSALKK 233


>gi|315638039|ref|ZP_07893224.1| ribonuclease III [Campylobacter upsaliensis JV21]
 gi|315481887|gb|EFU72506.1| ribonuclease III [Campylobacter upsaliensis JV21]
          Length = 224

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 126/224 (56%), Gaps = 8/224 (3%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFD 64
           +   LE ++ Y F ++ LL  ALTH S   +Y    ERLEFLGD +L L++   LF+ F 
Sbjct: 3   KLELLEAKLNYKFKDQKLLIYALTHKSAKKNYNN--ERLEFLGDAVLDLVVGEFLFHKFK 60

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
           +  EG+LS    +LV+ ++ +++A  L+L +FI +S   + +      SI +D  E+LI 
Sbjct: 61  NEAEGDLSKLRAALVNEKSFAKIATSLNLGAFIFMSIAEQNNGGKTKPSILSDAFEALIG 120

Query: 125 ALYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           AL+L+ G     E+A   +++ +     KS    +D KT+LQE   AK G+TPEY+    
Sbjct: 121 ALHLEAGFIKAKEIALRLIEENFPNIDAKS--LFKDYKTKLQEITQAKMGLTPEYETLRA 178

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
            GPDH   F + + + G   A+ +  SK+ A+Q+AA   L++ G
Sbjct: 179 FGPDHQKSFEIALNLEGKEMARAIASSKKEAQQMAAKLTLEKLG 222


>gi|163802958|ref|ZP_02196845.1| ribonuclease III [Vibrio sp. AND4]
 gi|159173248|gb|EDP58076.1| ribonuclease III [Vibrio sp. AND4]
          Length = 226

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 118/217 (54%), Gaps = 6/217 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE+++GY F +  L+  ALTH S +  + E   RLEFLGD IL  +I+  L++ F    E
Sbjct: 8   LERKLGYQFKDAGLINLALTHRSANSKHNE---RLEFLGDSILSFVIADELYHRFPKVNE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G++S    +LV   T +++ RE DL  ++++     K       SI AD VE++I A+YL
Sbjct: 65  GDMSRMRATLVRGHTLAELGREFDLGDYLKLGPGELKSGGFRRDSILADAVEAIIGAIYL 124

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  IE     V  ++  R  A+K G  ++D KT LQE+   +    P Y VT   G  H+
Sbjct: 125 DSDIEAVRGIVLSWYHSRLEAIKPGVSQKDPKTRLQEFLQGRRKPLPVYTVTNIKGEAHN 184

Query: 187 PRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
             FTV  +++G+  P  G   S+R AEQ AA   L++
Sbjct: 185 QEFTVECDVAGVDKPVIGKGTSRRKAEQAAAETALEQ 221


>gi|187933552|ref|YP_001885438.1| ribonuclease III [Clostridium botulinum B str. Eklund 17B]
 gi|238691613|sp|B2TJ22|RNC_CLOBB RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|187721705|gb|ACD22926.1| ribonuclease III [Clostridium botulinum B str. Eklund 17B]
          Length = 232

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 82/226 (36%), Positives = 125/226 (55%), Gaps = 4/226 (1%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQES--YERLEFLGDRILGLLISTL 58
           M+  +++ +E R+G  F N SL++ ALTHSS  + ++++   ERLEFLGD +L L I+  
Sbjct: 1   MNRYKFNDIENRLGVYFNNPSLIKTALTHSSFGNQFKDAKYNERLEFLGDSVLQLCITEY 60

Query: 59  LFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADV 118
           LFN F    EGEL+   + +V   +  ++A++L L  +IR+S            SIQAD 
Sbjct: 61  LFNKFKDKSEGELTKIRSLIVCENSLYEIAKKLSLGEYIRMSKGEELTGGRERMSIQADA 120

Query: 119 VESLIAALYLDGGIEVAGTFVDKYWKQRALK--SGKFRRDAKTELQEWAHAKFGVTPEYK 176
           VE++IAA+YLD GI     F+  ++++   K  + +   D KT+LQE       +  +Y+
Sbjct: 121 VEAVIAAVYLDKGIGFVNDFILLHFEEMINKAINNEIVLDFKTKLQELLQKDGEILIQYE 180

Query: 177 VTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           +    GP H  +F   V I+      G   SK+ AEQ AA E LKR
Sbjct: 181 LVKYEGPPHRRKFFTNVIINEKVMGIGEGYSKKEAEQNAAKEALKR 226


>gi|171057289|ref|YP_001789638.1| ribonuclease III [Leptothrix cholodnii SP-6]
 gi|170774734|gb|ACB32873.1| Ribonuclease III [Leptothrix cholodnii SP-6]
          Length = 228

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 82/225 (36%), Positives = 127/225 (56%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           MS     TL+ R+G+ F ++SLL +A++H S    + E   RLEFLGD +L + +S LLF
Sbjct: 1   MSTYPLDTLQARLGHVFRDQSLLLRAVSHRSHGADHNE---RLEFLGDAVLNMTVSDLLF 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + FD + EG+L+     LV  +   ++A  L L + +R+S    +   +   SI AD +E
Sbjct: 58  DQFDDSPEGDLTRVRAHLVRQDMLHRLALSLQLPAVLRLSDGEARAGGAQRPSILADAME 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALK--SGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           ++I A+Y D G E A   V + ++    +  +  + +DAKT+LQEW  A+    PEY++ 
Sbjct: 118 AVIGAVYRDAGYEAAQALVRRLFEPLVSETVTQAWAKDAKTQLQEWLQARRQSVPEYRIE 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  F VV  ++G    A+G   S+RAAEQ AA  VL++
Sbjct: 178 TTRGRAHDQTFVVVCSVAGPGIEARGEGRSRRAAEQEAARLVLEQ 222


>gi|262404774|ref|ZP_06081329.1| ribonuclease III [Vibrio sp. RC586]
 gi|262349806|gb|EEY98944.1| ribonuclease III [Vibrio sp. RC586]
          Length = 225

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 79/219 (36%), Positives = 117/219 (53%), Gaps = 6/219 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L  ++GY F    LL  ALTH S +  + E   RLEFLGD IL  +I+  L+  F   
Sbjct: 6   NKLTSKLGYTFKEIELLNLALTHRSANGKHNE---RLEFLGDSILSFVIADELYRRFPKV 62

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG++S    +LV   T +++ RE DL  ++++     K       SI AD VE++I A+
Sbjct: 63  NEGDMSRMRATLVRGNTLAELGREFDLGDYLKLGPGELKSGGFRRDSILADAVEAIIGAI 122

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLD  +E A + V +++  R   +K G  ++D KT LQE+   +    P Y VT   G  
Sbjct: 123 YLDSDLETARSIVLEWYHGRLEEIKPGASQKDPKTRLQEFLQGRRKPLPVYTVTNIKGEA 182

Query: 185 HDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
           H+  FTV  E++G+  P  G   S+R AEQ AA   L++
Sbjct: 183 HNQEFTVACEVAGMDTPVIGKGTSRRKAEQAAAETALEQ 221


>gi|121728984|ref|ZP_01681988.1| ribonuclease III [Vibrio cholerae V52]
 gi|147674970|ref|YP_001217963.1| ribonuclease III [Vibrio cholerae O395]
 gi|153214513|ref|ZP_01949422.1| ribonuclease III [Vibrio cholerae 1587]
 gi|153803086|ref|ZP_01957672.1| ribonuclease III [Vibrio cholerae MZO-3]
 gi|153826905|ref|ZP_01979572.1| ribonuclease III [Vibrio cholerae MZO-2]
 gi|153830879|ref|ZP_01983546.1| ribonuclease III [Vibrio cholerae 623-39]
 gi|229514087|ref|ZP_04403549.1| ribonuclease III [Vibrio cholerae TMA 21]
 gi|229521288|ref|ZP_04410708.1| ribonuclease III [Vibrio cholerae TM 11079-80]
 gi|229524448|ref|ZP_04413853.1| ribonuclease III [Vibrio cholerae bv. albensis VL426]
 gi|229527069|ref|ZP_04416464.1| ribonuclease III [Vibrio cholerae 12129(1)]
 gi|254226246|ref|ZP_04919839.1| ribonuclease III [Vibrio cholerae V51]
 gi|254291661|ref|ZP_04962449.1| ribonuclease III [Vibrio cholerae AM-19226]
 gi|297581085|ref|ZP_06943010.1| ribonuclease III [Vibrio cholerae RC385]
 gi|189043374|sp|A5F5H8|RNC_VIBC3 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|121628750|gb|EAX61217.1| ribonuclease III [Vibrio cholerae V52]
 gi|124115315|gb|EAY34135.1| ribonuclease III [Vibrio cholerae 1587]
 gi|124121368|gb|EAY40111.1| ribonuclease III [Vibrio cholerae MZO-3]
 gi|125621219|gb|EAZ49560.1| ribonuclease III [Vibrio cholerae V51]
 gi|146316853|gb|ABQ21392.1| ribonuclease III [Vibrio cholerae O395]
 gi|148873648|gb|EDL71783.1| ribonuclease III [Vibrio cholerae 623-39]
 gi|149739268|gb|EDM53530.1| ribonuclease III [Vibrio cholerae MZO-2]
 gi|150422433|gb|EDN14392.1| ribonuclease III [Vibrio cholerae AM-19226]
 gi|227014353|gb|ACP10563.1| ribonuclease III [Vibrio cholerae O395]
 gi|229335466|gb|EEO00948.1| ribonuclease III [Vibrio cholerae 12129(1)]
 gi|229338029|gb|EEO03046.1| ribonuclease III [Vibrio cholerae bv. albensis VL426]
 gi|229341820|gb|EEO06822.1| ribonuclease III [Vibrio cholerae TM 11079-80]
 gi|229349268|gb|EEO14225.1| ribonuclease III [Vibrio cholerae TMA 21]
 gi|297534911|gb|EFH73747.1| ribonuclease III [Vibrio cholerae RC385]
          Length = 225

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 79/219 (36%), Positives = 117/219 (53%), Gaps = 6/219 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L  ++GY F    LL  ALTH S +  + E   RLEFLGD IL  +I+  L+  F   
Sbjct: 6   NKLTSKLGYTFKETELLNLALTHRSANGKHNE---RLEFLGDSILSFVIADELYRRFPKV 62

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG++S    +LV   T +++ RE DL  ++++     K       SI AD VE++I A+
Sbjct: 63  NEGDMSRMRATLVRGNTLAELGREFDLGDYLKLGPGELKSGGFRRDSILADAVEAIIGAI 122

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLD  +E A   V ++++ R   +K G  ++D KT LQE+   +    P Y VT   G  
Sbjct: 123 YLDSDLETARRIVLEWYQCRLEEIKPGASQKDPKTRLQEFLQGRRKPLPVYTVTNIKGEA 182

Query: 185 HDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
           H+  FTV  E++G+  P  G   S+R AEQ AA   L++
Sbjct: 183 HNQEFTVACEVAGMDTPVIGKGTSRRKAEQAAAETALEQ 221


>gi|262167292|ref|ZP_06035002.1| ribonuclease III [Vibrio cholerae RC27]
 gi|262190709|ref|ZP_06048940.1| ribonuclease III [Vibrio cholerae CT 5369-93]
 gi|262024267|gb|EEY42958.1| ribonuclease III [Vibrio cholerae RC27]
 gi|262033421|gb|EEY51928.1| ribonuclease III [Vibrio cholerae CT 5369-93]
 gi|327484953|gb|AEA79360.1| Ribonuclease III [Vibrio cholerae LMA3894-4]
          Length = 221

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 79/219 (36%), Positives = 117/219 (53%), Gaps = 6/219 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L  ++GY F    LL  ALTH S +  + E   RLEFLGD IL  +I+  L+  F   
Sbjct: 2   NKLTSKLGYTFKETELLNLALTHRSANGKHNE---RLEFLGDSILSFVIADELYRRFPKV 58

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG++S    +LV   T +++ RE DL  ++++     K       SI AD VE++I A+
Sbjct: 59  NEGDMSRMRATLVRGNTLAELGREFDLGDYLKLGPGELKSGGFRRDSILADAVEAIIGAI 118

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLD  +E A   V ++++ R   +K G  ++D KT LQE+   +    P Y VT   G  
Sbjct: 119 YLDSDLETARRIVLEWYQCRLEEIKPGASQKDPKTRLQEFLQGRRKPLPVYTVTNIKGEA 178

Query: 185 HDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
           H+  FTV  E++G+  P  G   S+R AEQ AA   L++
Sbjct: 179 HNQEFTVACEVAGMDTPVIGKGTSRRKAEQAAAETALEQ 217


>gi|24217145|ref|NP_714628.1| ribonuclease III [Leptospira interrogans serovar Lai str. 56601]
 gi|45655649|ref|YP_003458.1| dsRNase III [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
 gi|59798574|sp|Q75FW5|RNC_LEPIC RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|59798588|sp|Q8EXX3|RNC_LEPIN RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|24202183|gb|AAN51643.1| ribonuclease 3 [Leptospira interrogans serovar Lai str. 56601]
 gi|45602620|gb|AAS72095.1| dsRNase III [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
          Length = 247

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 78/219 (35%), Positives = 116/219 (52%), Gaps = 5/219 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQE---SYERLEFLGDRILGLLISTLLFNHFDS 65
           L K+IG  F+       A  HSS  +  QE     ERLEFLGD +LGL+ +  LF  +  
Sbjct: 24  LSKKIGIKFSKVEYYNTAFIHSSYKNENQEILEDNERLEFLGDSVLGLVAARSLFRKYPK 83

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
           A EGELS   + +VS    + ++ +L+L+ ++ +    +  +      + A++ ESL+ A
Sbjct: 84  ANEGELSRIKSRIVSTPILNSISEKLELSEYLLLGKGEKNSLGKGRRKLSANLFESLVGA 143

Query: 126 LYLDGGIEVAGTFVDKYWKQRALKSGKFR--RDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           +YLD G E+A  F+ ++  +      K    RD KT+LQE++   F + P Y+    SGP
Sbjct: 144 IYLDQGFEIAEKFILRHLSEFVENPEKEESVRDYKTQLQEYSQKHFKILPIYRTKSESGP 203

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           DH   F VVV I     A G   SK++AEQ AA E+  R
Sbjct: 204 DHAKTFQVVVRIRDQWEASGSGVSKKSAEQNAAKELYNR 242


>gi|109947401|ref|YP_664629.1| ribonuclease III [Helicobacter acinonychis str. Sheeba]
 gi|122973320|sp|Q17XJ6|RNC_HELAH RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|109714622|emb|CAJ99630.1| ribonuclease III (RNase III) [Helicobacter acinonychis str. Sheeba]
          Length = 234

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 83/225 (36%), Positives = 126/225 (56%), Gaps = 9/225 (4%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 13  YITLEKALGYSFKDKHLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 70

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VSA+  +++AR + L  ++RVSS           SI +   E+L+A 
Sbjct: 71  YDEGKLSKLRASIVSAQGFTKLARAISLQDYLRVSSSEETSKGREKPSILSSAFEALMAG 130

Query: 126 LYLDGGIE----VAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G++    +    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 131 VYLEAGLDKVRKIMQNLLNRAYKRLDLEH--LSVDYKTALQELTQAQFCVIPTYQLLKEK 188

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR-EGI 225
           GP H   F +V+ I     A     SK+ AEQ  A + L++ +GI
Sbjct: 189 GPAHHKEFEMVLYIQNQMYATAKGKSKKEAEQQCAYQALQKLKGI 233


>gi|188589361|ref|YP_001920585.1| ribonuclease III [Clostridium botulinum E3 str. Alaska E43]
 gi|251778911|ref|ZP_04821831.1| ribonuclease III [Clostridium botulinum E1 str. 'BoNT E Beluga']
 gi|238689672|sp|B2V4D6|RNC_CLOBA RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|188499642|gb|ACD52778.1| ribonuclease III [Clostridium botulinum E3 str. Alaska E43]
 gi|243083226|gb|EES49116.1| ribonuclease III [Clostridium botulinum E1 str. 'BoNT E Beluga']
          Length = 232

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 82/226 (36%), Positives = 125/226 (55%), Gaps = 4/226 (1%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQES--YERLEFLGDRILGLLISTL 58
           M+  +++ +E R+G  F N SL++ ALTHSS  + ++++   ERLEFLGD +L L I+  
Sbjct: 1   MNRYKFNDIENRLGVYFNNPSLIKTALTHSSFGNQFKDAKYNERLEFLGDSVLQLCITEY 60

Query: 59  LFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADV 118
           LFN F    EGEL+   + +V   +  ++A++L L  +IR+S            SIQAD 
Sbjct: 61  LFNKFKDKSEGELTKIRSLIVCENSLYEIAKKLSLGEYIRMSKGEELTGGRERMSIQADA 120

Query: 119 VESLIAALYLDGGIEVAGTFVDKYWKQRALK--SGKFRRDAKTELQEWAHAKFGVTPEYK 176
           VE++IAA+YLD GI     F+  ++++   K  + +   D KT+LQE       +  +Y+
Sbjct: 121 VEAVIAAVYLDKGIGFVNDFILLHFEEMINKAINNEIVLDFKTKLQELLQKDGEILIQYE 180

Query: 177 VTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           +    GP H  +F   V I+      G   SK+ AEQ AA E LKR
Sbjct: 181 LLKYEGPPHRRKFFTNVIINEKVMGIGEGYSKKEAEQNAAKEALKR 226


>gi|304316939|ref|YP_003852084.1| ribonuclease III [Thermoanaerobacterium thermosaccharolyticum DSM
           571]
 gi|302778441|gb|ADL69000.1| ribonuclease III [Thermoanaerobacterium thermosaccharolyticum DSM
           571]
          Length = 232

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 82/226 (36%), Positives = 122/226 (53%), Gaps = 5/226 (2%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSYQE---SYERLEFLGDRILGLLISTLLFN 61
           +Y  LEK IGY F N+ LL+ AL HSS ++  +    S ERLEFLGD +L ++IS  L+ 
Sbjct: 6   KYENLEKNIGYVFNNKKLLKNALAHSSWANESKNIGISNERLEFLGDSVLSIIISEYLYK 65

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVES 121
                +EG LS   + +V   + ++ ARE++L  ++ +             SI AD +E+
Sbjct: 66  SRSDLEEGYLSKYRSEIVCEPSLARCAREIELGKYLLMGKGEEMTGGRNRESILADAMEA 125

Query: 122 LIAALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTF 179
           LIAA+YLD  ++ A   V + + +  + + SG   RD KT+LQE           YK+T 
Sbjct: 126 LIAAIYLDSDLKTASDIVLRLFDEIIKEVLSGLIYRDYKTKLQEVTQKMGSEKIIYKLTD 185

Query: 180 RSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
             GPDH+  F + V +      +GM  SK+ AEQ AA E L + G+
Sbjct: 186 EYGPDHNKMFVIEVYVGENRLGRGMGRSKKEAEQYAAMEALSKMGL 231


>gi|254779351|ref|YP_003057456.1| ribonuclease III [Helicobacter pylori B38]
 gi|254001262|emb|CAX29239.1| Ribonuclease III (RNase III) [Helicobacter pylori B38]
          Length = 232

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 81/221 (36%), Positives = 124/221 (56%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y+TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 11  YTTLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 68

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VSA   +++A+ + L  ++RVSS           SI +   E+L+A 
Sbjct: 69  YDEGKLSKLRASIVSAHGFTKLAKAIALQDYLRVSSSEEISNGREKPSILSSAFEALMAG 128

Query: 126 LYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+    ++    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 129 VYLEAGLAKVRKIMQNLLNRAYKRLDLEH--LFMDYKTALQELTQAQFCVIPTYQLLQEK 186

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F + + I     A     SK+ AEQ  A +VL++
Sbjct: 187 GPDHHKEFEMALYIQDKMYATAKGKSKKEAEQQCAYQVLQK 227


>gi|85712960|ref|ZP_01043999.1| Rnase III, dsRNA-specific ribonuclease [Idiomarina baltica OS145]
 gi|85693198|gb|EAQ31157.1| Rnase III, dsRNA-specific ribonuclease [Idiomarina baltica OS145]
          Length = 228

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 78/219 (35%), Positives = 122/219 (55%), Gaps = 6/219 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + LE+ IGY F  +SLL++ALTH S   ++    ERLEFLGD ILG++I+  LF+ F   
Sbjct: 9   TQLEQIIGYRFERQSLLKQALTHRS---AHANHNERLEFLGDSILGVVIAEALFSRFPKV 65

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG+LS    ++V   + +++ ++  L  ++ +     K       SI AD +E++I A+
Sbjct: 66  AEGDLSRMRAAIVCGRSLARLGKKKGLGDYLSLGQGELKSGGYRRESILADAMEAIIGAI 125

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           +LD  ++     V  +++++   +K G  ++D KT LQEW  A+    PEY V    G  
Sbjct: 126 FLDSDMDTVKQVVLGWFEEQLETIKPGASQKDPKTRLQEWLQARQRPLPEYDVVATQGQA 185

Query: 185 HDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
           H+ +FTV   I GL  P  G   S+R AEQ AA   L++
Sbjct: 186 HNQQFTVTCTIEGLPEPLLGTGTSRRKAEQAAATSALEQ 224


>gi|291165574|gb|EFE27623.1| ribonuclease III [Filifactor alocis ATCC 35896]
          Length = 229

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 87/220 (39%), Positives = 123/220 (55%), Gaps = 8/220 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSS-ISHSYQESY---ERLEFLGDRILGLLISTLLFNHFD 64
            +K+IGY F +  LL +ALTH+S I+ +  ++    ERLEFLGD ILG+++ST LF    
Sbjct: 7   FQKKIGYTFQDEKLLREALTHTSYINENRNKNLRPNERLEFLGDSILGVVVSTYLFEKRK 66

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EGELS    S+V  ++   VA+ LD  S+I +             SI AD+VE+LIA
Sbjct: 67  DLPEGELSKIRASIVCEDSLQLVAKRLDAGSYIYMGKGEEMTGGRTRHSILADMVEALIA 126

Query: 125 ALYLDGGIEVAGTFVDKYWK---QRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           A+YLDGG++ A  F+  + +   +RA K G   +D KT LQE    K   + EY+V    
Sbjct: 127 AIYLDGGMKAASKFIFLFMEDVMKRATK-GDMDKDYKTRLQEIVQQKPDRSIEYRVIGEK 185

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           GPDH   F V + +     A G   SK+ AE+ AA + L+
Sbjct: 186 GPDHRKIFVVELLVDKKQVAVGEGYSKKEAEKQAAKKALQ 225


>gi|78778218|ref|YP_394533.1| ribonuclease III [Sulfurimonas denitrificans DSM 1251]
 gi|78498758|gb|ABB45298.1| RNAse III [Sulfurimonas denitrificans DSM 1251]
          Length = 226

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 80/217 (36%), Positives = 123/217 (56%), Gaps = 8/217 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE+ +GY F N+ L+ +ALTH S    Y    ERLEFLGD +L L++   LF  F S+ E
Sbjct: 8   LEEILGYKFKNQKLIIEALTHKSHKQPYDN--ERLEFLGDAVLDLIVGEYLFFKFASSDE 65

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G LS    +LV+ +   ++AR ++L  +I +S+    +      S+ ++  E++I A+YL
Sbjct: 66  GTLSKIRAALVNEDGFERLARSINLGEYIYLSNAEENNGGREKASLLSNAFEAMIGAIYL 125

Query: 129 DGGIE----VAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           + G++    +A   +++ +++ +L S    RD KT LQE   A+FG TPEY V    GPD
Sbjct: 126 ESGLDIVKPIAIGIIERNYQEISLDS--LFRDYKTTLQELTQARFGETPEYIVVASRGPD 183

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           H   F V V I G   A+ +  SK+ A+Q AA   +K
Sbjct: 184 HKKEFEVAVIIEGKEYARAIGKSKKIAQQEAAEMAVK 220


>gi|57506125|ref|ZP_00372047.1| ribonuclease III (rnc) [Campylobacter upsaliensis RM3195]
 gi|57015609|gb|EAL52401.1| ribonuclease III (rnc) [Campylobacter upsaliensis RM3195]
          Length = 224

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 124/224 (55%), Gaps = 8/224 (3%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFD 64
           +   LE ++ Y F  + LL  ALTH S   +Y    ERLEFLGD +L L++   LF+ F 
Sbjct: 3   KLELLEAKLNYKFKEQKLLIYALTHKSAKKNYNN--ERLEFLGDAVLDLVVGEFLFHKFK 60

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
           +  EG+LS    +LV+ ++ +++A  L+L  FI +S   + +      SI +D  E+LI 
Sbjct: 61  NEAEGDLSKLRAALVNEKSFAKIATSLNLGDFIFMSIAEQNNGGKTKPSILSDTFEALIG 120

Query: 125 ALYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           AL+L+ G     E+A   +++ +     KS    +D KT+LQE   AK G+TPEY+    
Sbjct: 121 ALHLEAGFIKAKEIALRLIEENFPNIDAKS--LFKDYKTKLQEITQAKMGLTPEYETQRA 178

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
            GPDH   F + + + G   A+ +  SK+ A+Q+AA   L++ G
Sbjct: 179 FGPDHQKSFEIALNLEGKEMARAIASSKKEAQQMAAKLTLEKLG 222


>gi|307722018|ref|YP_003893158.1| RNAse III [Sulfurimonas autotrophica DSM 16294]
 gi|306980111|gb|ADN10146.1| RNAse III [Sulfurimonas autotrophica DSM 16294]
          Length = 227

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 83/223 (37%), Positives = 126/223 (56%), Gaps = 11/223 (4%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAK 67
           TLE+++GY F ++ L+ +ALTH S    Y    ERLEFLGD +L L++   LF  F ++ 
Sbjct: 7   TLEEKLGYEFKDKKLIIEALTHKSYKQPYDN--ERLEFLGDAVLDLVVGEYLFRKFRTSD 64

Query: 68  EGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALY 127
           EG+LS    SLV+     ++AR L L  +I +S+    +     +S+ ++  E+++ A+Y
Sbjct: 65  EGKLSKIRASLVNETGFDKLARALHLGDYILLSNAEDNNGGREKSSLLSNAFEAIMGAVY 124

Query: 128 LDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           L+ G+     +A   ++K  ++ +L S    RD KT LQE   A+FG+TPEYKV    GP
Sbjct: 125 LEAGLGEVQRIAIDLIEKNHEEISLDS--LFRDFKTTLQELTQARFGITPEYKVLASRGP 182

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVA---AAEVLKRE 223
           DH   F V V I     A+    SK+ A+Q A   A E+L +E
Sbjct: 183 DHQKEFEVGVFIEDKEYARANGKSKKIAQQEAARVAVELLNKE 225


>gi|297620496|ref|YP_003708633.1| ribonuclease III [Waddlia chondrophila WSU 86-1044]
 gi|297375797|gb|ADI37627.1| ribonuclease III [Waddlia chondrophila WSU 86-1044]
          Length = 252

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 120/222 (54%), Gaps = 8/222 (3%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSI---SHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           S +E +IG+ F ++ LL  A TH S    ++   E  ERLE+LGD ILG LI+  L+ + 
Sbjct: 21  SEIEAKIGHTFKDKQLLSLAFTHRSYINENNDAHEHNERLEYLGDSILGFLIAEYLYKYL 80

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
            +  EGELS   + LV A +C    ++LDL  ++ +    + +      SI AD+ ESLI
Sbjct: 81  PNTPEGELSYLRSRLVEASSCVIYVQKLDLEQYLLLGKGEQMNDGRGRDSILADLFESLI 140

Query: 124 AALYLDGGIEVAGTFVDKYWK---QRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
            A+YLDGG++ A  F+ K +    +  LK+     + K +LQ++   K+   P YKV   
Sbjct: 141 GAIYLDGGMDAARLFLFKNFSKEIEEILKTPIC--NWKAQLQDYCQKKYRHPPLYKVVSE 198

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           SGPDH   FT+ V I+      G   SK+ A+Q AA +   R
Sbjct: 199 SGPDHQKIFTISVLINNQEVGHGEGPSKKEAQQAAAKDAFSR 240


>gi|254448879|ref|ZP_05062335.1| ribonuclease III [gamma proteobacterium HTCC5015]
 gi|198261569|gb|EDY85858.1| ribonuclease III [gamma proteobacterium HTCC5015]
          Length = 225

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 86/225 (38%), Positives = 121/225 (53%), Gaps = 10/225 (4%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           STL+  + Y F+N  LLE A+TH S S +   + ERLEFLGD IL   ++  LF  F   
Sbjct: 3   STLQSTLNYTFSNGDLLEVAVTHRSASKT---NNERLEFLGDSILNFTVAAELFERFPER 59

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG+LS    SLV   + +  A+++DL  F+++     K       SI AD VE++I A+
Sbjct: 60  PEGDLSRLRASLVDKSSLAAHAKKMDLGPFLKLGGGELKSGGWRRDSILADAVEAIIGAI 119

Query: 127 YLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLDGGIE A  F+   +     +L +    +DAKT LQEW   +    P+Y++   SG  
Sbjct: 120 YLDGGIESAQQFIRDLYDGDFESLPTANELKDAKTRLQEWLQGRHYALPQYEMVEVSGKP 179

Query: 185 HDPRFTVVVEI-SGLAPAQGMDCSKRAAEQVAA----AEVLKREG 224
           H+ +FTV   I S          S+R AEQ AA    A++L +EG
Sbjct: 180 HEQQFTVSCYIDSHDVQVNATGRSRRKAEQAAAETALAQLLDQEG 224


>gi|301058150|ref|ZP_07199202.1| ribonuclease III [delta proteobacterium NaphS2]
 gi|300447782|gb|EFK11495.1| ribonuclease III [delta proteobacterium NaphS2]
          Length = 236

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 85/233 (36%), Positives = 126/233 (54%), Gaps = 12/233 (5%)

Query: 1   MSALR----YSTLEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILG 52
           M AL+    + +L + +GY+F + +L+ +A  HSS  +       E  ERLEFLGD +L 
Sbjct: 1   MGALQADKEFKSLCETLGYSFNDIALVIQAFRHSSYVNEQMVPGLEDNERLEFLGDAVLD 60

Query: 53  LLISTLLFNHFDSAKEGELSVRFNSLVSAET-CSQVARELDLASFIRVSSDLRKDVCSFM 111
           L +S LL      A EGELS RF S+V  E     VA  L+L  ++ +     + +    
Sbjct: 61  LAVSHLLMERNPHANEGELS-RFRSMVVDEAGLHDVATRLELGRYLLLGKGEDQSLGRQK 119

Query: 112 TSIQADVVESLIAALYLDGGIEVAGTFVDKYWKQRALKSG--KFRRDAKTELQEWAHAKF 169
            SI ADV E+L+ A+YLDGG ++    ++K +     K G     +D K+ LQE+    F
Sbjct: 120 PSILADVTEALLGAIYLDGGFDITKKVIEKLFAPLLEKVGTDDLVQDYKSLLQEFTQQAF 179

Query: 170 GVTPEYKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
              P+Y++T   GP HD  F +V+ ++G+  A+GM  SK+ AEQ AA E   R
Sbjct: 180 KCLPQYRLTEEKGPAHDKVFCIVLAVNGIVMAEGMGKSKKEAEQHAAKEAFLR 232


>gi|262170590|ref|ZP_06038268.1| ribonuclease III [Vibrio mimicus MB-451]
 gi|261891666|gb|EEY37652.1| ribonuclease III [Vibrio mimicus MB-451]
          Length = 221

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 79/219 (36%), Positives = 117/219 (53%), Gaps = 6/219 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L  ++GY F    LL  ALTH S +  + E   RLEFLGD IL  +I+  L++ F   
Sbjct: 2   NKLTSKLGYTFKEIELLNLALTHRSANGKHNE---RLEFLGDSILSFVIADELYHRFPKV 58

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG++S    +LV   T +++ RE DL  ++++     K       SI AD VE++I A+
Sbjct: 59  NEGDMSRMRATLVRGNTLAELGREFDLGDYLKLGPGELKSGGFRRDSILADAVEAIIGAI 118

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLD  +E A   V +++  R   +K G  ++D KT LQE+   +    P Y VT   G  
Sbjct: 119 YLDSDLETARRIVLEWYHCRLEEIKPGASQKDPKTRLQEFLQGRRKPLPVYTVTNIKGEA 178

Query: 185 HDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
           H+  FTV  E++G+  P  G   S+R AEQ AA   L++
Sbjct: 179 HNQEFTVACEVAGMDTPVIGKGTSRRKAEQAAAETALEQ 217


>gi|261416404|ref|YP_003250087.1| ribonuclease III [Fibrobacter succinogenes subsp. succinogenes S85]
 gi|261372860|gb|ACX75605.1| ribonuclease III [Fibrobacter succinogenes subsp. succinogenes S85]
 gi|302326232|gb|ADL25433.1| ribonuclease III [Fibrobacter succinogenes subsp. succinogenes S85]
          Length = 270

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 118/214 (55%), Gaps = 6/214 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSI----SHSYQESYERLEFLGDRILGLLISTLLFNHFD 64
           LE ++GY F +  LL  AL H S        Y  + ERLEFLGD +L +L +  L+  + 
Sbjct: 23  LEAKLGYRFRDPELLAHALVHRSFLVGKDVPYASNNERLEFLGDSVLNMLTTEFLYRTYP 82

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
           S  EGELS R +++VS   C+Q ++E DL+ ++++     K       SI AD  E+++ 
Sbjct: 83  SDPEGELSKRKSAIVSGHACAQSSKEWDLSEYVKIGKSEAKMGGRGKESILADAYEAVLG 142

Query: 125 ALYLDGGIEVAGTFVDKYWKQRA--LKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           A+YLDGG+E     ++K+   R   + S     + K+EL E+   K   +PEY +    G
Sbjct: 143 AVYLDGGLEEVRAILNKFHFPRVQEIISATDFVNYKSELLEFCQGKLRCSPEYVIVGEEG 202

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           P+H   FTV V ++G + A+G   +K+ AEQ A+
Sbjct: 203 PEHQKVFTVEVVVNGKSYARGQGPNKKKAEQEAS 236


>gi|114564093|ref|YP_751607.1| ribonuclease III [Shewanella frigidimarina NCIMB 400]
 gi|122299035|sp|Q07YZ6|RNC_SHEFN RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|114335386|gb|ABI72768.1| RNAse III [Shewanella frigidimarina NCIMB 400]
 gi|211926923|dbj|BAG82671.1| ribonuclease III [Shewanella sp. SIB1]
          Length = 226

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 84/216 (38%), Positives = 122/216 (56%), Gaps = 6/216 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L + +GY F N  LL +ALTH S ++ + E   RLEFLGD IL + IS  L++ F  A E
Sbjct: 10  LCRTLGYEFNNIELLIQALTHRSAANKHNE---RLEFLGDSILSIAISDALYHQFPKATE 66

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV  +T + +A+E  L  ++ +     K       SI AD VE++I A+YL
Sbjct: 67  GDLSRMRATLVKGDTLTIIAKEFKLGDYLYLGPGELKSGGFRRESILADAVEAIIGAVYL 126

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  IEV    +  ++++R   +K G  ++D KT LQE+        P+Y+V    G  HD
Sbjct: 127 DADIEVCRKLLLSWYQERLAEIKPGINQKDPKTILQEYLQGFKKPLPDYQVVAVEGEAHD 186

Query: 187 PRFTVVVEISGLAP-AQGMDCSKRAAEQVAAAEVLK 221
             FTV  +IS L     G+  S+R AEQ+AAA+VL+
Sbjct: 187 QTFTVECKISELDKVVTGVASSRRKAEQLAAAQVLE 222


>gi|332532635|ref|ZP_08408511.1| ribonuclease III [Pseudoalteromonas haloplanktis ANT/505]
 gi|332037851|gb|EGI74300.1| ribonuclease III [Pseudoalteromonas haloplanktis ANT/505]
          Length = 225

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 120/217 (55%), Gaps = 5/217 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L K+IGY FA++ LLE+A+TH S  H  Q + ERLEFLGD IL  +I+  L+  F  A
Sbjct: 6   TELYKKIGYEFADQGLLEQAMTHRS--HKGQHN-ERLEFLGDSILSFVIANALYAKFPKA 62

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           +EG+LS   ++LV  +T ++   E  L  ++R+     K       S  AD VE++I A 
Sbjct: 63  REGDLSRMRSTLVRGQTLAEFGLEFGLGDYLRLGPGELKSGGFRRESTLADAVEAIIGAA 122

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           +LD GI+  G  +  +++ R  A+  G  ++D KT LQE+  A+    P Y V    G  
Sbjct: 123 FLDSGIDSCGDLILSWYESRLDAISPGLNQKDPKTLLQEYLQARKLSLPGYTVVDTKGQA 182

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           H+  FTV   + G+     +  S+R AEQ AA + LK
Sbjct: 183 HNQTFTVECIVDGMDSIISVGSSRRKAEQKAAEKALK 219


>gi|315127397|ref|YP_004069400.1| RNase III, ds RNA [Pseudoalteromonas sp. SM9913]
 gi|315015911|gb|ADT69249.1| RNase III, ds RNA [Pseudoalteromonas sp. SM9913]
          Length = 225

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 121/217 (55%), Gaps = 5/217 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L KRIGY FA++ LLE+A+TH S  H  Q + ERLEFLGD IL  +I+  L+  F  A
Sbjct: 6   TELYKRIGYTFADQGLLEQAMTHRS--HKGQHN-ERLEFLGDSILSFVIANALYAKFPKA 62

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           +EG+LS   ++LV  +T ++   E +L  ++R+     K       S  AD VE++I A+
Sbjct: 63  REGDLSRMRSTLVRGQTLAEFGLEFELGDYLRLGPGELKSGGFRRESTLADAVEAIIGAV 122

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           +LD  I+  G  +  +++ R  A+  G  ++D KT LQE+  A+    P Y V    G  
Sbjct: 123 FLDSDIDRCGELILAWYESRLDAISPGLNQKDPKTLLQEYLQARKLSLPGYTVVDTKGQA 182

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           H+  FTV   + G+     +  S+R AEQ AA + LK
Sbjct: 183 HNQTFTVECIVDGMDSIISVGSSRRKAEQKAAEKALK 219


>gi|304398620|ref|ZP_07380492.1| ribonuclease III [Pantoea sp. aB]
 gi|304353831|gb|EFM18206.1| ribonuclease III [Pantoea sp. aB]
          Length = 226

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 82/228 (35%), Positives = 126/228 (55%), Gaps = 6/228 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F +  LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPILINKLQRKLGYTFTHSELLQQALTHRSASSKHNE---RLEFLGDSILSYVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE DL   +R+     K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAEMAREFDLGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD GIE     +  +++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGIFLDSGIERVEQLILDWYQSRLDEISPGDKQKDPKTRLQEYLQGRHLPLPSYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKREGI 225
              G  HD  FT+  ++SG+A P  G+  S+R AEQ AA + L + G+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGMAEPVVGVGSSRRKAEQAAAEQALIKLGL 225


>gi|148284924|ref|YP_001249014.1| ribonuclease III [Orientia tsutsugamushi str. Boryong]
 gi|146740363|emb|CAM80798.1| ribonuclease III [Orientia tsutsugamushi str. Boryong]
          Length = 251

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 81/219 (36%), Positives = 130/219 (59%), Gaps = 12/219 (5%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSIS-HSYQESYERLEFLGDRILGLLISTLLFNHFDSAK 67
           L+  IGY F +  LL +ALTH SI+ + Y ++Y+RLEFLGD IL L+IS  LF +F    
Sbjct: 27  LQSEIGYNFNSIDLLIEALTHPSINQYGYTKNYQRLEFLGDVILNLVISETLFKNFSHYN 86

Query: 68  EGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVC---SFMTSIQADVVESLIA 124
           EG+L+     LV  E+   +A++++L  +I ++++  K  C   S   +I+ + +E++I 
Sbjct: 87  EGKLAKSRAFLVCNESICLIAQKINLHKYIIMTANEEK--CGGRSNKNNIE-NTMEAVIG 143

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFR--RDAKTELQEWAHAK-FGVTPEYKVTFRS 181
           A+YLDGGI V    V+  WK   +K  +     D K+ LQEW+ +K FG+ P Y ++ ++
Sbjct: 144 AVYLDGGIHVIKDIVNSLWK-VLIKDHELYLIADPKSALQEWSQSKNFGI-PTYTLSSKT 201

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
           G  H P F V+V++  L P  G   + + A++ AA  +L
Sbjct: 202 GQSHSPLFEVMVKVGRLEPQYGKGTTIKTAQKNAAQLML 240


>gi|258622345|ref|ZP_05717370.1| Ribonuclease 3 [Vibrio mimicus VM573]
 gi|258626729|ref|ZP_05721551.1| Ribonuclease 3 [Vibrio mimicus VM603]
 gi|258580985|gb|EEW05912.1| Ribonuclease 3 [Vibrio mimicus VM603]
 gi|258585361|gb|EEW10085.1| Ribonuclease 3 [Vibrio mimicus VM573]
          Length = 225

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 79/219 (36%), Positives = 117/219 (53%), Gaps = 6/219 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L  ++GY F    LL  ALTH S +  + E   RLEFLGD IL  +I+  L++ F   
Sbjct: 6   NKLTSKLGYTFKEIELLNLALTHRSANGKHNE---RLEFLGDSILSFVIADELYHRFPKV 62

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG++S    +LV   T +++ RE DL  ++++     K       SI AD VE++I A+
Sbjct: 63  NEGDMSRMRATLVRGNTLAELGREFDLGDYLKLGPGELKSGGFRRDSILADAVEAIIGAI 122

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLD  +E A   V +++  R   +K G  ++D KT LQE+   +    P Y VT   G  
Sbjct: 123 YLDSDLETARRIVLEWYHCRLEEIKPGASQKDPKTRLQEFLQGRRKPLPVYTVTNIKGEA 182

Query: 185 HDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
           H+  FTV  E++G+  P  G   S+R AEQ AA   L++
Sbjct: 183 HNQEFTVACEVAGMDTPVIGKGTSRRKAEQAAAETALEQ 221


>gi|197285743|ref|YP_002151615.1| ribonuclease III [Proteus mirabilis HI4320]
 gi|238693201|sp|B4F047|RNC_PROMH RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|194683230|emb|CAR43912.1| RNase III, ds RNA [Proteus mirabilis HI4320]
          Length = 226

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 115/212 (54%), Gaps = 6/212 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ L  + L+K++GY F    LL +ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNTLLVNQLQKKLGYTFKQNELLLQALTHRSASSKHNE---RLEFLGDSILSYVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE +L   +R+     K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAELAREFELGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI A++LD  I+     + K+++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGAIFLDSDIQNIENIILKWYENRLAEISPGDKQKDPKTRLQEYLQGRHLPLPSYVVV 177

Query: 179 FRSGPDHDPRFTVVVEISGL-APAQGMDCSKR 209
              G  HD  FT+  +ISG+  P +GM  S+R
Sbjct: 178 QVRGEAHDQEFTIHCQISGIDQPVKGMGTSRR 209


>gi|261211555|ref|ZP_05925843.1| ribonuclease III [Vibrio sp. RC341]
 gi|260839510|gb|EEX66136.1| ribonuclease III [Vibrio sp. RC341]
          Length = 221

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 79/219 (36%), Positives = 116/219 (52%), Gaps = 6/219 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L  ++GY F    LL  ALTH S +  + E   RLEFLGD IL  +I+  L+  F   
Sbjct: 2   NKLTSKLGYTFKETELLNLALTHRSANGKHNE---RLEFLGDSILSFVIADELYRRFPKV 58

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG++S    +LV   T +++ RE DL  ++++     K       SI AD VE++I A+
Sbjct: 59  NEGDMSRMRATLVRGNTLAELGREFDLGDYLKLGPGELKSGGFRRDSILADAVEAIIGAI 118

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLD  +E A   V +++  R   +K G  ++D KT LQE+   +    P Y VT   G  
Sbjct: 119 YLDSELETARRIVLEWYHCRLEEIKPGASQKDPKTRLQEFLQGRRKPLPVYTVTNIKGEA 178

Query: 185 HDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
           H+  FTV  E++G+  P  G   S+R AEQ AA   L++
Sbjct: 179 HNQEFTVACEVAGMDTPVIGKGTSRRKAEQAAAETALEQ 217


>gi|313114998|ref|ZP_07800491.1| ribonuclease III [Faecalibacterium cf. prausnitzii KLE1255]
 gi|310622689|gb|EFQ06151.1| ribonuclease III [Faecalibacterium cf. prausnitzii KLE1255]
          Length = 224

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 88/221 (39%), Positives = 120/221 (54%), Gaps = 9/221 (4%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ---ESYERLEFLGDRILGLLISTLLFNHFDS 65
           LE  IGY F N  LLE ALTH+S ++  +   +  ERLEFLGD +L ++ +  LF+ +  
Sbjct: 5   LETIIGYKFKNPELLEIALTHTSYANESRTPVKHNERLEFLGDSVLQIVSADYLFHAYAD 64

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+L+    SLVS     Q A+E+DL  ++R+     +       S+ +D  E+LIAA
Sbjct: 65  RPEGDLTRIRASLVSEGALFQFAQEIDLGEYLRLGRGEERCGGRTRPSVVSDAFEALIAA 124

Query: 126 LYLDGGIEVAGTFVDKYWKQRALKSGKFRR-DAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           LYLDGG++VA +F+  +     +  GK    D KT LQE           Y V   SGPD
Sbjct: 125 LYLDGGMDVARSFILPF-----ITEGKHAEADYKTRLQEIVQQNPEERLSYVVESESGPD 179

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           HD  F V V  +    A+G   SK+AAEQ AA E LK  G+
Sbjct: 180 HDKHFVVAVRFNSDRVARGEGRSKKAAEQCAAKEALKLLGV 220


>gi|283781424|ref|YP_003372179.1| ribonuclease III [Pirellula staleyi DSM 6068]
 gi|283439877|gb|ADB18319.1| ribonuclease III [Pirellula staleyi DSM 6068]
          Length = 273

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 116/213 (54%), Gaps = 3/213 (1%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           E+R+GY F ++ LL  ALTH+S +     S ERLEFLGD ILG+ +  +L+  F    EG
Sbjct: 49  ERRLGYVFNSKPLLRSALTHASGAEHRLASNERLEFLGDAILGVYVCEMLYRQFPDYLEG 108

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLD 129
           +L+   + +VS +TC++V+  L L  F+ +   +     +   S+ ADV ESLIAA+YLD
Sbjct: 109 DLTKVKSVVVSRQTCAKVSEALGLQEFLILGKGMSSSP-NVPPSLLADVFESLIAAIYLD 167

Query: 130 GGIEVAGTFVDKYWKQRA--LKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDP 187
           GG + A  F++ Y         +G+   + K+ LQ++A  + G TP Y +    GPDH  
Sbjct: 168 GGEQAARQFINNYIGPEVELAAAGELGGNYKSLLQQFAQRECGNTPTYHLLDEKGPDHSK 227

Query: 188 RFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
            F +   + G         +K+ AEQ AA   L
Sbjct: 228 CFKISASVGGKKYQAAWGRNKKEAEQRAANNAL 260


>gi|88797948|ref|ZP_01113535.1| ribonuclease III [Reinekea sp. MED297]
 gi|88779145|gb|EAR10333.1| ribonuclease III [Reinekea sp. MED297]
          Length = 219

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 84/219 (38%), Positives = 124/219 (56%), Gaps = 6/219 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           + K IGY F + SLLE+ALTH S +   +++ ERLEFLGD IL   I+  L++ F +AKE
Sbjct: 1   MTKAIGYQFESESLLEQALTHRSYA---RKNNERLEFLGDAILNCTIAQALYHQFPNAKE 57

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G++S     LV  +T +++ RE +L  F+R+ S   K       SI AD VE++I A+ L
Sbjct: 58  GQMSRLRAHLVKGDTLAEIGREFELGEFLRLGSGELKSGGFRRDSILADAVEAIIGAISL 117

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  +  A   +  ++++R   L   +  +D+KT LQE+  A+    PEY+V   +G  H 
Sbjct: 118 DADLGKAQQVLLSWYEERLSNLDLKENIKDSKTRLQEFLQARRLPLPEYQVKTITGEAHQ 177

Query: 187 PRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKREG 224
             FTV  ++  L  P  G+  S+R AEQ AA   LK  G
Sbjct: 178 QEFTVHCQVESLETPMVGVGSSRRMAEQEAANAALKALG 216


>gi|160946001|ref|ZP_02093227.1| hypothetical protein FAEPRAM212_03534 [Faecalibacterium prausnitzii
           M21/2]
 gi|158443732|gb|EDP20737.1| hypothetical protein FAEPRAM212_03534 [Faecalibacterium prausnitzii
           M21/2]
 gi|295103252|emb|CBL00796.1| RNAse III [Faecalibacterium prausnitzii SL3/3]
          Length = 224

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 88/221 (39%), Positives = 119/221 (53%), Gaps = 9/221 (4%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ---ESYERLEFLGDRILGLLISTLLFNHFDS 65
           LE  IGY F N  LLE ALTH+S ++  +   +  ERLEFLGD +L ++ +  LF+ +  
Sbjct: 5   LETIIGYKFKNPELLEIALTHTSYANESRTPVKHNERLEFLGDSVLQIVSADYLFHAYAD 64

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+L+    SLVS     Q A+E+DL  ++R+     +       S+ +D  E++IAA
Sbjct: 65  RPEGDLTRIRASLVSESALFQFAQEIDLGEYLRLGRGEERCGGRTRPSVVSDAFEAVIAA 124

Query: 126 LYLDGGIEVAGTFVDKYWKQRALKSGKF-RRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           LYLDGG+EVA  F+  +     +  GK    D KT LQE           Y V   SGPD
Sbjct: 125 LYLDGGMEVARKFILPF-----ITEGKHAEADYKTRLQEIVQQNPEERLSYVVESESGPD 179

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           HD  F V V  +    A+G   SK+AAEQ AA E LK  G+
Sbjct: 180 HDKHFVVAVRFNSDRVARGEGRSKKAAEQCAAKEALKLLGV 220


>gi|320104374|ref|YP_004179965.1| RNAse III [Isosphaera pallida ATCC 43644]
 gi|319751656|gb|ADV63416.1| RNAse III [Isosphaera pallida ATCC 43644]
          Length = 238

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 78/218 (35%), Positives = 128/218 (58%), Gaps = 7/218 (3%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           ++ E+ IG++F +R LL  ALTHSS +     S ERLEFLGD +LG+++   LF+ F  A
Sbjct: 11  ASCERVIGHSFQDRGLLRAALTHSSRAVHPLASNERLEFLGDSVLGMIVCDTLFHLFPEA 70

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           KEG+L+   + +VS +TC+++AR+L L +++ +   +     +  +++ A+V ES++ A+
Sbjct: 71  KEGDLTRIKSVVVSRQTCTKIARKLGLQNYLLLGKGMGPSSQAPASTL-ANVFESVVGAI 129

Query: 127 YLDGGIEVAGTFV--DKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLD G E A  FV  +   +  + K+ + + + K++LQ++A    G TP Y +    GPD
Sbjct: 130 YLDSGFEAARRFVLNNLLPEIESSKNEESQGNYKSQLQQYAQKNHGTTPTYHLLEEKGPD 189

Query: 185 HDPRFTVVVEISG--LAPAQGMDCSKRAAEQVAAAEVL 220
           H   F ++  I      PA G   +K+ AEQ AA   L
Sbjct: 190 HRKCFKILARIGSHQFPPAWGQ--TKKDAEQRAAQNAL 225


>gi|262166502|ref|ZP_06034239.1| ribonuclease III [Vibrio mimicus VM223]
 gi|262026218|gb|EEY44886.1| ribonuclease III [Vibrio mimicus VM223]
          Length = 225

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 79/219 (36%), Positives = 117/219 (53%), Gaps = 6/219 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L  ++GY F    LL  ALTH S +  + E   RLEFLGD IL  +I+  L++ F   
Sbjct: 6   NKLTSKLGYTFKEIELLNLALTHRSANGKHNE---RLEFLGDSILSFVIADELYHRFPKV 62

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG++S    +LV   T +++ RE DL  ++++     K       SI AD VE++I A+
Sbjct: 63  NEGDMSRMRATLVRGNTLAELGREFDLGDYLKLGPGELKSGGFRRDSILADAVEAIIGAI 122

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLD  +E A   V +++  R   +K G  ++D KT LQE+   +    P Y VT   G  
Sbjct: 123 YLDSELETARRIVLEWYHCRLEEIKPGASQKDPKTRLQEFLQGRRKPLPVYTVTNIKGEA 182

Query: 185 HDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
           H+  FTV  E++G+  P  G   S+R AEQ AA   L++
Sbjct: 183 HNQEFTVACEVAGMDTPVIGKGTSRRKAEQAAAETALEQ 221


>gi|221135073|ref|ZP_03561376.1| ribonuclease III [Glaciecola sp. HTCC2999]
          Length = 241

 Score =  128 bits (322), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 79/220 (35%), Positives = 125/220 (56%), Gaps = 6/220 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           +  L++ I Y F + SLL++ALTH S   ++++  ERLEFLGD +LG+++   LF  F +
Sbjct: 21  FVKLQRLIDYQFNDVSLLKQALTHKS---AHRQHNERLEFLGDAVLGMIVGEHLFKAFPN 77

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
           + EG+L+   +++V  +T +++A E  L  FI++ +   K       SI ADVVES+I A
Sbjct: 78  SPEGKLTRMRSAIVKGDTLAEIALEKGLGEFIQLGAGELKSGGKQRYSILADVVESIIGA 137

Query: 126 LYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           +YLD G+     F+  ++  R   L      +DAKT LQE+  ++    P Y+V    G 
Sbjct: 138 IYLDAGMNQCYDFIHAWFGARIAKLDPDVHPKDAKTRLQEYLQSRGIELPVYEVVDIKGK 197

Query: 184 DHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
           DH+  FTV      L+ P Q    S++ AEQ+AA   L++
Sbjct: 198 DHNQTFTVSCNTVTLSDPIQAQGASRKRAEQIAAQLTLEK 237


>gi|203284601|ref|YP_002222341.1| ribonuclease III [Borrelia duttonii Ly]
 gi|203288135|ref|YP_002223150.1| ribonuclease III [Borrelia recurrentis A1]
 gi|201084044|gb|ACH93635.1| ribonuclease III [Borrelia duttonii Ly]
 gi|201085355|gb|ACH94929.1| ribonuclease III [Borrelia recurrentis A1]
          Length = 243

 Score =  128 bits (322), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 118/212 (55%), Gaps = 7/212 (3%)

Query: 17  FANRSLLEKALTHSSISHSYQESY---ERLEFLGDRILGLLISTLLFNHFDSAKEGELSV 73
           F +  LL  +L+HSS ++ + + Y   ERLEFLGD +L L+I+  L+  +    EGELS 
Sbjct: 27  FNDIYLLNMSLSHSSYANEFDQKYANNERLEFLGDSVLNLIITDYLYKFYPDKSEGELSK 86

Query: 74  RFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIE 133
             + +VS ++ S +AREL+L ++I +      +       I AD +E+ + ALYLDGG  
Sbjct: 87  ARSYIVSEDSLSSIARELNLGNYILLGRGEENNDGRNKKGILADAIEAFVGALYLDGGFS 146

Query: 134 VAGTFVDKYWK---QRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFT 190
            A TFV + ++   +     G F +D K+ LQE+   K+ ++P YK+    GPDH+  F 
Sbjct: 147 KASTFVVELFEVHIRLMFNRGDF-KDYKSLLQEYVQKKYKISPSYKLAKELGPDHNKIFC 205

Query: 191 VVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           V + ++    + G   SK+ AE +AA   LK 
Sbjct: 206 VELYVNDKFVSNGKGKSKKEAEMIAAEMALKN 237


>gi|213161855|ref|ZP_03347565.1| ribonuclease III [Salmonella enterica subsp. enterica serovar Typhi
           str. E00-7866]
          Length = 231

 Score =  128 bits (322), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 124/225 (55%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F ++ LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 6   MNPIVINRLQRKLGYTFNHQELLQQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 62

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE DL   +R+     K       SI AD VE
Sbjct: 63  HRFPRVDEGDMSRMRATLVRGNTLAELAREFDLGECLRLGPGELKSGGFRRESILADTVE 122

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  ++K R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 123 ALIGGVFLDSNIQTVEQLILNWYKTRLDEISPGDKQKDPKTRLQEYLQGRHLPLPSYLVV 182

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SGL+ P  G   S+R AEQ AA + LK+
Sbjct: 183 QVRGEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAAAEQALKK 227


>gi|152999778|ref|YP_001365459.1| ribonuclease III [Shewanella baltica OS185]
 gi|189043347|sp|A6WKQ7|RNC_SHEB8 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|151364396|gb|ABS07396.1| Ribonuclease III [Shewanella baltica OS185]
          Length = 226

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 83/216 (38%), Positives = 123/216 (56%), Gaps = 6/216 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L + +GY F N  LL +ALTH S ++ + E   RLEFLGD IL ++IS  L++ F  A E
Sbjct: 10  LCRTLGYEFKNIELLTQALTHRSAANKHNE---RLEFLGDSILSIVISDALYHQFPKATE 66

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV  +T + +A+E  L  ++ +     K       SI AD VE++I A+YL
Sbjct: 67  GDLSRMRATLVRGDTLTIIAQEFKLGDYLYLGPGELKSGGFRRESILADAVEAIIGAVYL 126

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  +EV    + K++ +R   ++ G  ++DAKT LQE         P+Y+V    G  HD
Sbjct: 127 DSDLEVCRALLLKWYAERLAEIQPGISQKDAKTLLQEHLQGFKKPLPDYQVINIEGDAHD 186

Query: 187 PRFTVVVEISGLAPAQ-GMDCSKRAAEQVAAAEVLK 221
             FTV   I  L+ +  G+  S+R AEQ+AAA+VL+
Sbjct: 187 QTFTVECRIEDLSQSVIGVASSRRKAEQIAAAQVLE 222


>gi|16765901|ref|NP_461516.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|29140810|ref|NP_804152.1| ribonuclease III [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
 gi|56412543|ref|YP_149618.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197361478|ref|YP_002141114.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|205353677|ref|YP_002227478.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207857988|ref|YP_002244639.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|20141650|sp|Q56056|RNC_SALTY RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|81360707|sp|Q5PIG5|RNC_SALPA RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|226741376|sp|B5QTU8|RNC_SALEP RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|226741377|sp|B5RD49|RNC_SALG2 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|238689916|sp|B5BAT0|RNC_SALPK RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|16421128|gb|AAL21475.1| RNase III, ds RNA [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|29136435|gb|AAO68001.1| ribonuclease III [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
 gi|56126800|gb|AAV76306.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197092954|emb|CAR58384.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|205273458|emb|CAR38435.1| Ribonuclease III [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|206709791|emb|CAR34143.1| Ribonuclease III [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|261247776|emb|CBG25604.1| RNase III [Salmonella enterica subsp. enterica serovar Typhimurium
           str. D23580]
 gi|267994707|gb|ACY89592.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301159129|emb|CBW18643.1| Ribonuclease III [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|332989508|gb|AEF08491.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 226

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 124/225 (55%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F ++ LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPIVINRLQRKLGYTFNHQELLQQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE DL   +R+     K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAELAREFDLGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  ++K R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGVFLDSNIQTVEQLILNWYKTRLDEISPGDKQKDPKTRLQEYLQGRHLPLPSYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SGL+ P  G   S+R AEQ AA + LK+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAAAEQALKK 222


>gi|270156955|ref|ZP_06185612.1| ribonuclease III [Legionella longbeachae D-4968]
 gi|289164621|ref|YP_003454759.1| ribonuclease III [Legionella longbeachae NSW150]
 gi|269988980|gb|EEZ95234.1| ribonuclease III [Legionella longbeachae D-4968]
 gi|288857794|emb|CBJ11638.1| putative ribonuclease III [Legionella longbeachae NSW150]
          Length = 227

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 80/218 (36%), Positives = 126/218 (57%), Gaps = 8/218 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L +R+GY F N + L++ALTH S+     E+YER EFLGD IL  +I+  LF+ F    E
Sbjct: 8   LCRRLGYHFKNSAYLKQALTHCSVG---SENYERFEFLGDSILSFVIANELFHRFPLQSE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS   + LV  E   ++A+E++L  F+ +     K       SI +D +E++ AA++L
Sbjct: 65  GQLSRLRSFLVRGEMLVELAKEIELGDFLFLGQGELKSGGFRRASILSDALEAVFAAVFL 124

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFR---RDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           DGGI+ A   + K ++ R L+S       +DAKT+LQE+  A+    PEY +T   G +H
Sbjct: 125 DGGIDCAKEVILKLYRIR-LESPNLNDCLKDAKTQLQEYLQAEKIPLPEYILTKIEGDEH 183

Query: 186 DPRFTVVVEISGLAPAQ-GMDCSKRAAEQVAAAEVLKR 222
           +  F +   ++G+     G   ++R AEQ+AA  +L+R
Sbjct: 184 NQIFYITCSVNGMKQQTFGQGSNRRKAEQLAAKAMLER 221


>gi|148981907|ref|ZP_01816565.1| ribonuclease III [Vibrionales bacterium SWAT-3]
 gi|145960708|gb|EDK26050.1| ribonuclease III [Vibrionales bacterium SWAT-3]
          Length = 225

 Score =  128 bits (321), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 118/217 (54%), Gaps = 6/217 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE++IGY F +  L+  ALTH S +  + E   RLEFLGD IL  +I+  L++ F    E
Sbjct: 8   LERKIGYQFNDADLIHLALTHRSAAGKHNE---RLEFLGDSILSFVIADDLYHRFPKVNE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G++S    +LV   T +++ RE +L  ++++     K       SI AD VE++I A+YL
Sbjct: 65  GDMSRMRATLVRGHTLAELGREFELGDYLKLGPGELKSGGFRRDSILADAVEAIIGAIYL 124

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D   E     +  +++ R  A++ G  ++D KT LQE+   +    P Y VT   G  H+
Sbjct: 125 DSDTETVRGIILSWYQSRLEAIQPGVSQKDPKTRLQEFLQGRRNPLPVYTVTNIKGEAHN 184

Query: 187 PRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
             FTV  E++G+  P  G   S+R AEQ AA   L++
Sbjct: 185 QEFTVECEVAGVDKPVIGKGTSRRKAEQAAAETALEQ 221


>gi|302335832|ref|YP_003801039.1| RNAse III [Olsenella uli DSM 7084]
 gi|301319672|gb|ADK68159.1| RNAse III [Olsenella uli DSM 7084]
          Length = 242

 Score =  128 bits (321), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 80/224 (35%), Positives = 113/224 (50%), Gaps = 3/224 (1%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSI--SHSYQESYERLEFLGDRILGLLISTLLFNH 62
           R   +E+ +G+ F+++ L+  A+TH S         SYERLEFLGD ILG +++T +F  
Sbjct: 6   RVVAVEQIVGHHFSDQRLITSAITHPSAVEGKPVSASYERLEFLGDSILGAMVATDMFER 65

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           F    EGEL+    SLVS +T S+VA  L +   I      R      M S   +V E++
Sbjct: 66  FPGMDEGELTRLKISLVSGKTLSEVAGSLGIGELIVFGESERGTGARGMHSALENVYEAI 125

Query: 123 IAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR-DAKTELQEWAHAKFGVTPEYKVTFRS 181
           + ALYLD G E    FV +      +     R    K+ LQE    +F   PEY++    
Sbjct: 126 VGALYLDAGFEATHDFVRRTLSPHMVPELAARPLSPKSRLQEVTQREFRCAPEYRLEGEE 185

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           GP H P FT VV + G    +G   SK+ +E  AA + L R G+
Sbjct: 186 GPAHSPTFTTVVLVDGRRVGRGSGPSKKESESQAALDALDRLGL 229


>gi|237807623|ref|YP_002892063.1| ribonuclease III [Tolumonas auensis DSM 9187]
 gi|237499884|gb|ACQ92477.1| ribonuclease III [Tolumonas auensis DSM 9187]
          Length = 223

 Score =  128 bits (321), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 79/221 (35%), Positives = 125/221 (56%), Gaps = 6/221 (2%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFD 64
           + S LE+++GY F N+ LL +A+TH S    + E   RLEFLGD IL L+I+ +L++ F 
Sbjct: 4   KLSRLEQKLGYPFQNKDLLVRAITHRSAGSRHNE---RLEFLGDSILSLVIAEVLYHRFP 60

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
           +  EG++S    +LV  +T +++ARE  L  ++ +     K       SI AD VE+LI 
Sbjct: 61  NVSEGDMSRMRATLVREKTLAELAREFALGDYLILGPGELKSGGYRRESILADTVEALIG 120

Query: 125 ALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           A+YLD  ++   T +  ++ +R  +++ G  ++D KT LQE+   +    P Y VT   G
Sbjct: 121 AIYLDSDLDGIRTLMLNWYNERLDSIRPGVEQKDPKTRLQEFLQGRRRPLPTYAVTDVKG 180

Query: 183 PDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLKR 222
             H+ +FTV   I  +  A  G+  S+R AEQ AA   L++
Sbjct: 181 EAHNQQFTVECAIDDIEAAFVGVGSSRRKAEQAAAERALEQ 221


>gi|296535948|ref|ZP_06898097.1| ribonuclease III [Roseomonas cervicalis ATCC 49957]
 gi|296263721|gb|EFH10197.1| ribonuclease III [Roseomonas cervicalis ATCC 49957]
          Length = 234

 Score =  128 bits (321), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 74/201 (36%), Positives = 109/201 (54%), Gaps = 4/201 (1%)

Query: 12  RIGYAFANRSLLEKALTHSSISHSYQE---SYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           R+G+ F ++ LLE+ALTH S ++  ++   S ERLEFLGDR+L L+++  L   F + +E
Sbjct: 17  RLGHEFRDKGLLEQALTHRSAANPRRDMLDSNERLEFLGDRVLALVMAEWLSERFPAERE 76

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G L  R + LV+AET ++V   + L + +RV     +       ++ AD  E+LI ALYL
Sbjct: 77  GALGKRLSVLVAAETLAKVGEAIGLPAMLRVPPAEGRTGLRGRATVIADATEALIGALYL 136

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           D G+EV   F+ + W +           AK+ LQE    +    PEY+    +GP H P 
Sbjct: 137 DAGLEVPRRFIRREWAEFVAADPTPPMSAKSRLQEHTLGRAEGLPEYRQVSVTGPSHQPV 196

Query: 189 FTVVVEISGLAPAQGMDCSKR 209
           F V V   G   A+G   SKR
Sbjct: 197 FVVAVRAGGRE-AEGQGDSKR 216


>gi|15645286|ref|NP_207456.1| ribonuclease III [Helicobacter pylori 26695]
 gi|2313785|gb|AAD07725.1| ribonuclease III (rnc) [Helicobacter pylori 26695]
          Length = 240

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 123/221 (55%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y+TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 19  YTTLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 76

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VSA   +++A+ + L  ++RVSS           SI +   E+L+A 
Sbjct: 77  YDEGKLSKLRASIVSAHGFTKLAKAIALQDYLRVSSSEEISNGREKPSILSSAFEALMAG 136

Query: 126 LYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+    ++    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 137 VYLEAGLAKVQKIMQNLLNRAYKRLDLEH--LFMDYKTALQELTQAQFCVIPTYQLLKEK 194

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F + + I     A     SK+ AEQ  A + L++
Sbjct: 195 GPDHHKEFEMALYIQDKMYATAKGKSKKEAEQQCAYQALQK 235


>gi|84390104|ref|ZP_00991366.1| ribonuclease III [Vibrio splendidus 12B01]
 gi|86146359|ref|ZP_01064683.1| ribonuclease III [Vibrio sp. MED222]
 gi|218710569|ref|YP_002418190.1| ribonuclease III [Vibrio splendidus LGP32]
 gi|254807909|sp|B7VK79|RNC_VIBSL RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|84376758|gb|EAP93633.1| ribonuclease III [Vibrio splendidus 12B01]
 gi|85835838|gb|EAQ53972.1| ribonuclease III [Vibrio sp. MED222]
 gi|218323588|emb|CAV19828.1| Ribonuclease III [Vibrio splendidus LGP32]
          Length = 225

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 119/217 (54%), Gaps = 6/217 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE++IGY F +  L+  ALTH S +  + E   RLEFLGD IL  +I+  L++ F    E
Sbjct: 8   LERKIGYQFNDADLIHLALTHRSAAGKHNE---RLEFLGDSILSFVIADDLYHRFPKVNE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G++S    +LV   T +++ RE +L  ++++     K       SI AD VE++I A+YL
Sbjct: 65  GDMSRMRATLVRGHTLAELGREFELGDYLKLGPGELKSGGFRRDSILADAVEAIIGAVYL 124

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D   EV    +  +++ R  +++ G  ++D KT LQE+   +    P Y VT   G  H+
Sbjct: 125 DSDTEVVRRIILSWYQSRLESIQPGVSQKDPKTRLQEFLQGRRNPLPVYTVTNIKGEAHN 184

Query: 187 PRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
             FTV  E++G+  P  G   S+R AEQ AA   L++
Sbjct: 185 QEFTVECEVAGVDKPVIGKGTSRRKAEQAAAETALEQ 221


>gi|7531276|sp|P56118|RNC_HELPY RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
          Length = 239

 Score =  127 bits (320), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 123/221 (55%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y+TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 18  YTTLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 75

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VSA   +++A+ + L  ++RVSS           SI +   E+L+A 
Sbjct: 76  YDEGKLSKLRASIVSAHGFTKLAKAIALQDYLRVSSSEEISNGREKPSILSSAFEALMAG 135

Query: 126 LYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+    ++    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 136 VYLEAGLAKVQKIMQNLLNRAYKRLDLEH--LFMDYKTALQELTQAQFCVIPTYQLLKEK 193

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F + + I     A     SK+ AEQ  A + L++
Sbjct: 194 GPDHHKEFEMALYIQDKMYATAKGKSKKEAEQQCAYQALQK 234


>gi|146296620|ref|YP_001180391.1| ribonuclease III [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|145410196|gb|ABP67200.1| RNAse III [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 224

 Score =  127 bits (320), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 79/223 (35%), Positives = 127/223 (56%), Gaps = 7/223 (3%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + +EK++GY F N +LL+ ALTH S +H  +  YERLEFLGD +L L++S  LF HF   
Sbjct: 2   TDIEKKLGYRFKNPNLLKLALTHKSATHDDKSCYERLEFLGDAVLELVVSKYLFEHFPQL 61

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EGEL+    ++V +ET S+VA  L+L  +I    + +K+      SI +DV+E++   +
Sbjct: 62  SEGELTNLRATIVCSETLSKVAETLNLKRYIVFGKNEKKEGFEGNKSIWSDVLEAIFGGI 121

Query: 127 YLDGGIEVAGTFV----DKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           +L+ G ++A   V    + + K+ A   GK   D KT+LQE+   +  V  +Y + + + 
Sbjct: 122 FLESGFDMAEKIVINLLEPFIKKAA--EGKLFYDYKTKLQEFIQREKNVKIKY-IDYENF 178

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
            D+  RF   + I     ++G   SK+ A+Q AA   LK+ G+
Sbjct: 179 EDNLSRFKSELYIGKNKISEGYGNSKKEAQQEAALNALKKLGV 221


>gi|283953747|ref|ZP_06371278.1| ribonuclease III [Campylobacter jejuni subsp. jejuni 414]
 gi|283794788|gb|EFC33526.1| ribonuclease III [Campylobacter jejuni subsp. jejuni 414]
          Length = 224

 Score =  127 bits (320), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 125/220 (56%), Gaps = 8/220 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE+ + Y F +++LL  ALTH S   SY    ERLEFLGD +L L++   LF+ F    E
Sbjct: 7   LEQNLTYEFKDKNLLMHALTHKSFKKSYNN--ERLEFLGDAVLDLVVGEYLFHKFAKDAE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV+ ++ +++A  L+L  FI +S     +     +SI +D +E++I A++L
Sbjct: 65  GDLSKLRAALVNEKSFAKIANSLNLGDFIFMSVAEENNGGKEKSSILSDALEAIIGAIHL 124

Query: 129 DGGIEVAGT----FVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           + G E A T     ++K + Q  + +    +D KT+LQE    K G TP+Y+     GPD
Sbjct: 125 EAGFEFAKTIALRLIEKNFPQ--IDAKILIKDYKTKLQEITQGKIGQTPQYETVRAFGPD 182

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           H  +F + + + G   A+ +  SK+ A+Q+AA   L++ G
Sbjct: 183 HLKQFEIALMLDGKEIARAIAGSKKEAQQMAAKIALEKLG 222


>gi|46201860|ref|ZP_00208277.1| COG0571: dsRNA-specific ribonuclease [Magnetospirillum
           magnetotacticum MS-1]
          Length = 230

 Score =  127 bits (320), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 79/205 (38%), Positives = 111/205 (54%), Gaps = 4/205 (1%)

Query: 13  IGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           +G+AFA   LL +ALTH S     +    + YERLEFLGDR+LGL+++ +LF  F    E
Sbjct: 12  LGHAFARPELLSQALTHPSTQQHRRSQGSDPYERLEFLGDRVLGLVVAEMLFLRFPDEAE 71

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G L+ R  +LV  E  +++A E+ L   + ++             I AD  E++I ALY 
Sbjct: 72  GALARRHAALVRREAVARIANEIGLGRHLVLAKGESDAGGRTNPGILADACEAVIGALYA 131

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           D G  VA  FV   W+    ++    +DAKT LQEWA  +    P YK+  + GP H+P 
Sbjct: 132 DAGFAVAAAFVRSRWEPMMEEALAPPKDAKTGLQEWAQGRGKPLPAYKMLGQEGPPHEPT 191

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQ 213
           F + V + G+  A G   SKR AEQ
Sbjct: 192 FLMEVSVEGVGSAVGRGASKRVAEQ 216


>gi|262196731|ref|YP_003267940.1| ribonuclease III [Haliangium ochraceum DSM 14365]
 gi|262080078|gb|ACY16047.1| ribonuclease III [Haliangium ochraceum DSM 14365]
          Length = 282

 Score =  127 bits (320), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 84/219 (38%), Positives = 120/219 (54%), Gaps = 10/219 (4%)

Query: 3   ALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ---ESYERLEFLGDRILGLLISTLL 59
           A+  S LE  +G+ F  R+LLE A+TH S ++         ERLEFLGD +L L +  +L
Sbjct: 42  AIDLSGLEDILGHRFRKRALLEAAVTHRSFANEQAVPCTDNERLEFLGDAVLDLAVGHML 101

Query: 60  FNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVV 119
            +      EG LSV    +VS +  S++A  L L +++R+    R+       SI AD +
Sbjct: 102 MDVHPDLSEGRLSVTRAQIVSEKGLSEIAYGLGLGTYLRLGKGERRSGGQNKASILADSL 161

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALK----SGKFRRDAKTELQEWAHAKFGVTPEY 175
           E++IAA+YLDGG + A   V + +  R L+    SG +  D KT LQE A A+   TP Y
Sbjct: 162 EAVIAAVYLDGGFDAAWKLVARLFA-RTLEEVEISGFY--DHKTRLQELAQARLKSTPAY 218

Query: 176 KVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQV 214
           +V   +GPDH   F VV EI G    + +  SK+ AEQ+
Sbjct: 219 RVVDETGPDHAKLFEVVAEIDGREWGRAIGSSKKRAEQM 257


>gi|224418414|ref|ZP_03656420.1| ribonuclease III [Helicobacter canadensis MIT 98-5491]
 gi|253827732|ref|ZP_04870617.1| ribonuclease III [Helicobacter canadensis MIT 98-5491]
 gi|313141944|ref|ZP_07804137.1| ribonuclease III [Helicobacter canadensis MIT 98-5491]
 gi|253511138|gb|EES89797.1| ribonuclease III [Helicobacter canadensis MIT 98-5491]
 gi|313130975|gb|EFR48592.1| ribonuclease III [Helicobacter canadensis MIT 98-5491]
          Length = 224

 Score =  127 bits (320), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 78/217 (35%), Positives = 120/217 (55%), Gaps = 8/217 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
            ++ +GY F+N++LL++ALTH S   S     ERLEFLGD +L L+I   L+  F  + E
Sbjct: 6   FQQYLGYHFSNQNLLQEALTHKSAKKSTHN--ERLEFLGDAVLDLIIGEFLYKKFPHSPE 63

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS    S+V+ +  +++AR L++  ++ +S    ++      SI ++  E+++ A+YL
Sbjct: 64  GELSKMRASMVNEKAFAKIARYLNIGEYLYISHSEEQNNGREKDSILSNAFEAIVGAIYL 123

Query: 129 DGGIEVAGTFV----DKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           + G+E   T V    D  + +  L++     D KT LQE   A FG+TPEY V    GPD
Sbjct: 124 ESGLEKVQTIVLKILDILYPKIDLEN--LFYDYKTSLQELTQALFGITPEYVVLDSKGPD 181

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           H+  F + V I     AQ    SK+ A+Q  A   LK
Sbjct: 182 HNKEFLMGVFIQNKEYAQAKGKSKKEAQQNCAKIALK 218


>gi|39997326|ref|NP_953277.1| ribonuclease III [Geobacter sulfurreducens PCA]
 gi|81701827|sp|Q74AX1|RNC_GEOSL RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|39984217|gb|AAR35604.1| ribonuclease III [Geobacter sulfurreducens PCA]
 gi|298506263|gb|ADI84986.1| ribonuclease III [Geobacter sulfurreducens KN400]
          Length = 248

 Score =  127 bits (320), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 83/220 (37%), Positives = 121/220 (55%), Gaps = 6/220 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSS----ISHSYQESYERLEFLGDRILGLLISTLLFNHFD 64
           LE  IGY F +R  L++ALTH S    +        ERLEF GD ILG  I  +L  H+ 
Sbjct: 19  LETSIGYRFTDRRFLDEALTHRSWLNEVRSPTVPDNERLEFFGDAILGFCIGKMLLRHYP 78

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
            ++EG L+   ++LV  ET + +A  ++L S++R+     +       S+ A+ +E+L+A
Sbjct: 79  ESREGALARMKSALVGEETLADLAAAVELGSYLRLGRGEERSGGRHRRSLLANALEALLA 138

Query: 125 ALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           A+YLDGG+      VD ++  R   + +G   RD KT+ QE A A++G  P Y +   SG
Sbjct: 139 AMYLDGGMAPVERLVDAWFGPRLAGVAAGIKGRDFKTDFQELAQAQYGGLPRYVLVDTSG 198

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           P HD RFTV   +      QG   SK+ AEQ AA + L+R
Sbjct: 199 PAHDLRFTVAAYVGERLLGQGTGRSKKEAEQAAARQCLER 238


>gi|167549387|ref|ZP_02343146.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|167992712|ref|ZP_02573808.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168232159|ref|ZP_02657217.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|168238326|ref|ZP_02663384.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168245106|ref|ZP_02670038.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|168261368|ref|ZP_02683341.1| ribonuclease III [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|168466658|ref|ZP_02700512.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|168821429|ref|ZP_02833429.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|194443007|ref|YP_002041844.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194450415|ref|YP_002046643.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194472117|ref|ZP_03078101.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194733998|ref|YP_002115644.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197247832|ref|YP_002147539.1| ribonuclease III [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|197262390|ref|ZP_03162464.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|198245284|ref|YP_002216648.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|200387478|ref|ZP_03214090.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|204929592|ref|ZP_03220666.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|213425276|ref|ZP_03358026.1| ribonuclease III [Salmonella enterica subsp. enterica serovar Typhi
           str. E02-1180]
 gi|213585348|ref|ZP_03367174.1| ribonuclease III [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-0664]
 gi|213613049|ref|ZP_03370875.1| ribonuclease III [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-2068]
 gi|213646353|ref|ZP_03376406.1| ribonuclease III [Salmonella enterica subsp. enterica serovar Typhi
           str. J185]
 gi|213859103|ref|ZP_03385074.1| ribonuclease III [Salmonella enterica subsp. enterica serovar Typhi
           str. M223]
 gi|238912699|ref|ZP_04656536.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
 gi|289825501|ref|ZP_06544708.1| ribonuclease III [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-3139]
 gi|194401670|gb|ACF61892.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194408719|gb|ACF68938.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194458481|gb|EDX47320.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194709500|gb|ACF88721.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195630694|gb|EDX49286.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197211535|gb|ACH48932.1| ribonuclease III [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|197240645|gb|EDY23265.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197288832|gb|EDY28205.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197939800|gb|ACH77133.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|199604576|gb|EDZ03121.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|204321311|gb|EDZ06511.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205325334|gb|EDZ13173.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|205329152|gb|EDZ15916.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205333647|gb|EDZ20411.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|205336135|gb|EDZ22899.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|205341915|gb|EDZ28679.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205349444|gb|EDZ36075.1| ribonuclease III [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|312913570|dbj|BAJ37544.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|320087082|emb|CBY96851.1| RNase III, ds RNA [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|321222714|gb|EFX47785.1| Ribonuclease III [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|322613351|gb|EFY10293.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322620445|gb|EFY17310.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322625087|gb|EFY21916.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322629469|gb|EFY26245.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322633856|gb|EFY30595.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322635462|gb|EFY32173.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322639862|gb|EFY36541.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322644252|gb|EFY40796.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322649944|gb|EFY46364.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322654873|gb|EFY51190.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322658199|gb|EFY54465.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322661729|gb|EFY57947.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322669710|gb|EFY65856.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322673283|gb|EFY69388.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322674928|gb|EFY71015.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322682951|gb|EFY78969.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322685612|gb|EFY81607.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323130912|gb|ADX18342.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|323191960|gb|EFZ77198.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323200407|gb|EFZ85488.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323201307|gb|EFZ86374.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323208377|gb|EFZ93317.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323211547|gb|EFZ96385.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323215979|gb|EGA00711.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323221760|gb|EGA06168.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323225632|gb|EGA09859.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323229350|gb|EGA13474.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323235335|gb|EGA19419.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323237479|gb|EGA21542.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323245234|gb|EGA29235.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323248808|gb|EGA32735.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323254012|gb|EGA37833.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323259060|gb|EGA42708.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323261983|gb|EGA45548.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323267766|gb|EGA51247.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323269675|gb|EGA53127.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
 gi|326624403|gb|EGE30748.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
 gi|326628781|gb|EGE35124.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
          Length = 245

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 124/225 (55%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F ++ LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 20  MNPIVINRLQRKLGYTFNHQELLQQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 76

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE DL   +R+     K       SI AD VE
Sbjct: 77  HRFPRVDEGDMSRMRATLVRGNTLAELAREFDLGECLRLGPGELKSGGFRRESILADTVE 136

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  ++K R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 137 ALIGGVFLDSNIQTVEQLILNWYKTRLDEISPGDKQKDPKTRLQEYLQGRHLPLPSYLVV 196

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SGL+ P  G   S+R AEQ AA + LK+
Sbjct: 197 QVRGEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAAAEQALKK 241


>gi|291550077|emb|CBL26339.1| RNAse III [Ruminococcus torques L2-14]
          Length = 228

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 81/220 (36%), Positives = 116/220 (52%), Gaps = 5/220 (2%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLISTLLF 60
           R   LE++IGY F ++SL+E+AL HSS ++       E  ERLEFLGD +L L+ S  LF
Sbjct: 3   RVKELEQKIGYVFKDKSLIERALMHSSYTNEKHLKKYECNERLEFLGDAVLELVSSAYLF 62

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           N F    EGEL+    S+V   + +  AR++ L  ++ +             SI +D +E
Sbjct: 63  NEFPKVSEGELTKTRASMVCEPSLAMCARDIGLGDYLLLGKGEEATGGRKRDSITSDAME 122

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           +LI A+YLDGG   A  F+  ++    L+  K   D+KT LQE   A       Y++   
Sbjct: 123 ALIGAIYLDGGFTNAKEFI-HHFILTDLEDKKLFYDSKTILQEIVQANMTGNVSYELIDE 181

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
            GPDH+  F V   I   A  +G   SK++AEQ AA E +
Sbjct: 182 QGPDHNKIFEVEARIGRKAWGRGKGSSKKSAEQQAAYEAI 221


>gi|225025907|ref|ZP_03715099.1| hypothetical protein EUBHAL_00143 [Eubacterium hallii DSM 3353]
 gi|224956693|gb|EEG37902.1| hypothetical protein EUBHAL_00143 [Eubacterium hallii DSM 3353]
          Length = 232

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 81/220 (36%), Positives = 120/220 (54%), Gaps = 5/220 (2%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSY----QESYERLEFLGDRILGLLISTLLF 60
           R+  LE++IGY F N+  L  A+THSS ++      + + ERLEFLGD +L + IS  +F
Sbjct: 6   RFKGLEEKIGYTFTNKRTLALAMTHSSYANEQRGRRKANNERLEFLGDAVLEVTISDYVF 65

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             +    EG L+   +SLV   T +  AR+++L  ++ +S            SI +D  E
Sbjct: 66  REYPGYNEGRLTKLRSSLVCEYTLAICARDVELGKYLLLSRGEDATGGRERDSILSDAFE 125

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           +LI A+YLDGG++ A TF+  +  +       F  DAKT LQE   A      EY +T  
Sbjct: 126 ALIGAIYLDGGMDRARTFIHTHLLKDVEDKSLFY-DAKTILQEMVQAGPDPRLEYVLTRE 184

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
           +GPDH+  FTV  +I G   A G   +K+ AEQ+AA + +
Sbjct: 185 AGPDHNKEFTVEAKIGGKTYAIGKGKTKKGAEQIAAYQTI 224


>gi|310658889|ref|YP_003936610.1| ribonuclease 3 [Clostridium sticklandii DSM 519]
 gi|308825667|emb|CBH21705.1| Ribonuclease 3 (Ribonuclease III) (RNase III) [Clostridium
           sticklandii]
          Length = 229

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 83/222 (37%), Positives = 121/222 (54%), Gaps = 8/222 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQE----SYERLEFLGDRILGLLISTLLFNHFD 64
           L+K+I Y F +  LL++ALTHSS S+ Y++    + ERLEFLGD ILGL+IS  LF    
Sbjct: 8   LQKKINYEFQDLKLLKEALTHSSYSNEYKKIKNRNNERLEFLGDSILGLIISNYLFRLKK 67

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EGEL+    ++V   +   +A+ + L  ++ +             SI AD  E+LIA
Sbjct: 68  ELPEGELTKIRAAIVCERSLKDIAKSIHLGEYLYLGKGEESTGGRTRDSILADATEALIA 127

Query: 125 ALYLDGGIEVAGTFVDKYWKQ---RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           A+YLDGG   A  FV ++      +A++ GK  RD KT+LQE           YK+  + 
Sbjct: 128 AIYLDGGFRKATDFVLEHMGDIISQAIQ-GKIMRDYKTQLQELIQKDNKENIIYKLVDQL 186

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKRE 223
           GPDHD  F + V +       G+  SK+ AEQ AA + +++E
Sbjct: 187 GPDHDKTFKMNVFLGEKLIGTGIGKSKKEAEQEAAKDAMEKE 228


>gi|16761493|ref|NP_457110.1| ribonuclease III [Salmonella enterica subsp. enterica serovar Typhi
           str. CT18]
 gi|22654063|sp|Q8Z4K4|RNC_SALTI RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|25289227|pir||AC0829 ribonuclease III (EC 3.1.26.3) [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16503793|emb|CAD02783.1| ribonuclease III [Salmonella enterica subsp. enterica serovar
           Typhi]
          Length = 226

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 123/225 (54%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F ++ LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPIVINRLQRKLGYTFNHQELLQQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE DL   +R+     K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAELAREFDLGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  ++K R   +  G  ++D KT LQE+        P Y V 
Sbjct: 118 ALIGGVFLDSNIQTVEQLILNWYKTRLDEISPGDKQKDPKTRLQEYLQGHHLPLPSYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SGL+ P  G   S+R AEQ AA + LK+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAAAEQALKK 222


>gi|317180453|dbj|BAJ58239.1| ribonuclease III [Helicobacter pylori F32]
          Length = 238

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 123/221 (55%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y+TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 17  YATLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 74

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VSA   +++A+ + L  ++RVSS           SI +   E+L+A 
Sbjct: 75  YDEGKLSKLRASIVSAHGFTKLAKVIALQDYLRVSSSEEISKGREKPSILSSAFEALMAG 134

Query: 126 LYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+    ++    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 135 VYLEAGLAKVRKITQNLLNRAYKRLDLEH--LFMDYKTALQELTQAQFCVIPTYQLLKEK 192

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F + + I     A     SK+ AEQ  A + L++
Sbjct: 193 GPDHHKEFEMALYIQDKIYATAKGKSKKEAEQQCAYQALQK 233


>gi|283786183|ref|YP_003366048.1| Ribonuclease III [Citrobacter rodentium ICC168]
 gi|282949637|emb|CBG89256.1| Ribonuclease III [Citrobacter rodentium ICC168]
          Length = 226

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 80/225 (35%), Positives = 124/225 (55%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F ++ LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPIVINRLQRKLGYTFTHQELLQQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE DL   +R+     K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAELAREFDLGECLRLGPGELKSGGYRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  +++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGVFLDSDIQTVEKLILNWYQTRLDEISPGDKQKDPKTRLQEYLQGRHLPLPSYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SGL+ P  G   S+R AEQ AA + LK+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAAAEQALKK 222


>gi|317181975|dbj|BAJ59759.1| ribonuclease III [Helicobacter pylori F57]
          Length = 238

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 123/221 (55%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y+TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 17  YATLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 74

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VSA   +++A+ + L  ++RVSS           SI +   E+L+A 
Sbjct: 75  YDEGKLSKLRASIVSAHGFTKLAKVIALQDYLRVSSSEEISNGREKPSILSSAFEALMAG 134

Query: 126 LYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+    ++    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 135 VYLEAGLAKVRKITQNLLNRTYKRLDLEH--LFMDYKTALQELTQAQFCVIPTYQLLKEK 192

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F + + I     A     SK+ AEQ  A + L++
Sbjct: 193 GPDHHKEFEMALYIQDKIYATAKGKSKKEAEQQCAYQALQK 233


>gi|71083743|ref|YP_266463.1| ribonuclease III [Candidatus Pelagibacter ubique HTCC1062]
 gi|91763221|ref|ZP_01265185.1| ribonuclease III [Candidatus Pelagibacter ubique HTCC1002]
 gi|90101634|sp|Q4FLS9|RNC_PELUB RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|71062856|gb|AAZ21859.1| ribonuclease III [Candidatus Pelagibacter ubique HTCC1062]
 gi|91717634|gb|EAS84285.1| ribonuclease III [Candidatus Pelagibacter ubique HTCC1002]
          Length = 222

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 114/205 (55%), Gaps = 3/205 (1%)

Query: 17  FANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELSVRFN 76
           F+++ +  K+LTH S       + E++EFLGDR+LGL+I+  L   +   KEG L  +F 
Sbjct: 16  FSDQKIFIKSLTHKSFDSI--NNNEKIEFLGDRVLGLIIAKKLLELYPDEKEGVLDKKFA 73

Query: 77  SLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIEVAG 136
           SLV+ + C ++A++++L  +I V +   K +      I AD +E+LI A+YLD G+    
Sbjct: 74  SLVNKKKCLEIAKKIELEKYILVLNPKNKKI-EIEDKIVADCLEALIGAIYLDKGLNFTE 132

Query: 137 TFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVVVEIS 196
            F+   W +    S   + DAKT+LQE++   F V P YK+   +GP H P F V V++ 
Sbjct: 133 RFILNLWSEHITASVITQIDAKTKLQEYSLKIFKVLPIYKLISNTGPRHKPLFKVAVKLK 192

Query: 197 GLAPAQGMDCSKRAAEQVAAAEVLK 221
                     SK+ AEQ AA+  L+
Sbjct: 193 NTKFFTAEGTSKKDAEQNAASLCLQ 217


>gi|86152331|ref|ZP_01070542.1| ribonuclease III [Campylobacter jejuni subsp. jejuni 260.94]
 gi|315125039|ref|YP_004067043.1| ribonuclease III [Campylobacter jejuni subsp. jejuni ICDCCJ07001]
 gi|85840820|gb|EAQ58071.1| ribonuclease III [Campylobacter jejuni subsp. jejuni 260.94]
 gi|315018761|gb|ADT66854.1| ribonuclease III [Campylobacter jejuni subsp. jejuni ICDCCJ07001]
          Length = 224

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 125/220 (56%), Gaps = 8/220 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE+ + Y F +++LL  ALTH S   SY    ERLEFLGD +L L++   LF+ F    E
Sbjct: 7   LERSLTYEFKDKNLLIHALTHKSFKKSYNN--ERLEFLGDAVLDLVVGEYLFHKFAKDAE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV+ ++ +++A  L+L  FI +S   + +      SI +D +E++I A++L
Sbjct: 65  GDLSKLRAALVNEKSFAKIANSLNLGDFIFMSVAEKNNGGKEKPSILSDALEAIIGAIHL 124

Query: 129 DGGIEVAGT----FVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           + G E A T     ++K + Q  + +    +D KT+LQE    K G TP+Y+     GPD
Sbjct: 125 EAGFEFAKTIALRLIEKNFPQ--IDAKILIKDYKTKLQEITQGKIGQTPQYETVRAFGPD 182

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           H  +F + + + G   A+ +  SK+ A+Q+AA   L++ G
Sbjct: 183 HLKQFEIALMLDGKELARAIAGSKKEAQQMAAKIALEKLG 222


>gi|207092393|ref|ZP_03240180.1| ribonuclease III [Helicobacter pylori HPKX_438_AG0C1]
          Length = 239

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 123/221 (55%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y+TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 18  YTTLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 75

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VSA+  +++A+ + L  ++RVSS           SI +   E+L+A 
Sbjct: 76  YDEGKLSKLRASIVSAQGFTKLAKVISLQDYLRVSSSEEISKGREKPSILSSAFEALMAG 135

Query: 126 LYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+    ++    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 136 VYLEAGLAKVRKIMQNLLNRAYKRLDLEH--LSVDYKTALQELTQAQFCVIPTYQLLKEK 193

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F + + I     A     SK+ AEQ  A   L++
Sbjct: 194 GPDHHKEFEMALYIQDKMYATAKGKSKKEAEQQCAYYALQK 234


>gi|297717874|gb|ADI50080.1| ribonuclease III [Candidatus Odyssella thessalonicensis L13]
          Length = 211

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 125/211 (59%), Gaps = 7/211 (3%)

Query: 12  RIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGEL 71
           ++ + F + SL +KA+TH S        +ERLEFLGDR+LG++++ +L+  F   KEG+L
Sbjct: 2   KLKFTFKDPSLFDKAITHPSFRRRKVNDFERLEFLGDRVLGIIVAEMLYKAFPLEKEGDL 61

Query: 72  SVRFNSLVSAETCSQVARELDLASFIR-VSSDLRKDVCSFMTSIQADVVESLIAALYLDG 130
           + R   L+S + C ++A E++L   I+ V + L  +     +++ +D +E+LI A++LD 
Sbjct: 62  AKRQAVLISRDVCQEIAYEIELHEDIKVVGTGLDGN-----SAVLSDAMEALIGAMFLDQ 116

Query: 131 GIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFT 190
           G+EV    +   W++R   +    +D K+ LQEW  ++    P Y++  ++GP H P F 
Sbjct: 117 GLEVTRQHILPLWEKRLAITQAPPKDHKSLLQEWTQSRGLGIPAYELVNQTGPAHAPEFE 176

Query: 191 VVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           +++++   +  +    S++ AEQ AA ++L+
Sbjct: 177 ILLKVDDHS-VKARGKSRKLAEQEAAKQMLQ 206


>gi|21672530|ref|NP_660597.1| ribonuclease III [Buchnera aphidicola str. Sg (Schizaphis
           graminum)]
 gi|25009123|sp|Q8K9R1|RNC_BUCAP RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|21623153|gb|AAM67808.1| ribonuclease III [Buchnera aphidicola str. Sg (Schizaphis
           graminum)]
          Length = 226

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 77/228 (33%), Positives = 127/228 (55%), Gaps = 6/228 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + +++ +GY F ++ LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNHIVANKIQQILGYTFTHQELLKQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
            HF    EG++S    +LV   T +++A E DL  ++++     K       SI A+ VE
Sbjct: 58  QHFPYIDEGDMSRMRATLVRGNTLAEIAYEFDLGEYLQLGQGELKSGGFRRESILANTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI ++YLD  I+     + K++++R   +  G  ++D KT LQE+  +K    P Y + 
Sbjct: 118 ALIGSIYLDSNIKTVEELILKWYEKRLEKISPGDTQKDPKTRLQEYLQSKHLSLPSYFIV 177

Query: 179 FRSGPDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLKREGI 225
              G  H+  FT+  E+S L+ +  G   S+R AEQ AA + L + G+
Sbjct: 178 EVYGEAHNQLFTIHCEVSTLSTSFIGKGTSRRKAEQDAARKALIKLGV 225


>gi|262273710|ref|ZP_06051523.1| ribonuclease III [Grimontia hollisae CIP 101886]
 gi|262222125|gb|EEY73437.1| ribonuclease III [Grimontia hollisae CIP 101886]
          Length = 224

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 114/204 (55%), Gaps = 6/204 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L++RIGY F + +LL  ALTH S S ++ E   RLEFLGD IL  +++  L++ F +  E
Sbjct: 8   LQRRIGYTFNDTTLLSLALTHRSASGNHNE---RLEFLGDSILSFVVADDLYHRFPNVDE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G++S    +LV   T +++ RE +L   +++     K       SI AD VE++I A+YL
Sbjct: 65  GDMSRMRATLVRGNTLAELGREFELGDVLQLGPGELKSGGFRRDSILADAVEAIIGAIYL 124

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  +E     V  ++KQR   ++ G  ++D KT LQE+   +    P Y VT   G  H+
Sbjct: 125 DSSLETVRGIVLNWYKQRLETIQPGANQKDPKTRLQEFLQGRRKPLPAYNVTKVQGEAHN 184

Query: 187 PRFTVVVEISGL-APAQGMDCSKR 209
            +FTV  E++GL  P  G   S+R
Sbjct: 185 QQFTVECEVAGLDRPVVGKGSSRR 208


>gi|169342696|ref|ZP_02863737.1| ribonuclease III [Clostridium perfringens C str. JGS1495]
 gi|169299202|gb|EDS81272.1| ribonuclease III [Clostridium perfringens C str. JGS1495]
          Length = 237

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 125/229 (54%), Gaps = 6/229 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQES--YERLEFLGDRILGLLISTL 58
           M  +    +EK IG  F N+ +L  ALTHSS ++ +++    ERLEFLGD +L L ++  
Sbjct: 1   MKDINLIEVEKLIGIEFENKGVLITALTHSSYANQFKDVKYNERLEFLGDSVLQLCVTKY 60

Query: 59  LFNHFDSAKEGELSVRFNSLVSAE-TCSQVARELDLASFIRVSSDLRKDVCSFMTSIQAD 117
           LFN++    EGEL+ +  +LV  E +  +V++ L L  +IR+S           TSIQAD
Sbjct: 61  LFNNYKDKSEGELT-KIRALVVCENSLHKVSKNLSLGKYIRMSKGEELTGGRERTSIQAD 119

Query: 118 VVESLIAALYLDGGIEVAGTFVDKYWKQRALK--SGKFRRDAKTELQEWAHAKFGVTPEY 175
            +E++IAA+YLD GIEVA  F+ + +K    K  + +   D KT LQE       V   Y
Sbjct: 120 ALEAVIAAVYLDKGIEVANDFILRNFKDVIDKAINEEIILDFKTRLQEVLQKNGEVNIVY 179

Query: 176 KVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
            +    GP H  +F   + I+     QG+  SK+ +EQ AA   L+R G
Sbjct: 180 NLVKHEGPPHRRKFFTDLLINNEVMGQGVGFSKKESEQNAAKAALQRLG 228


>gi|94676727|ref|YP_588731.1| ribonuclease III [Baumannia cicadellinicola str. Hc (Homalodisca
           coagulata)]
 gi|94219877|gb|ABF14036.1| ribonuclease III [Baumannia cicadellinicola str. Hc (Homalodisca
           coagulata)]
          Length = 225

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 83/218 (38%), Positives = 124/218 (56%), Gaps = 6/218 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L+K+IGY F N++LL +ALTH S S+ + E   RLEFLGD IL  +I+  L+  F   
Sbjct: 6   NNLQKKIGYYFQNQNLLLQALTHRSASNKHNE---RLEFLGDSILSYVIAHALYQRFQYI 62

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG++S    +LV   T +++AREL+L++ +R+     K       SI AD VE+LI ++
Sbjct: 63  NEGDMSRMRATLVRGNTLAEIARELNLSTCLRLGIGELKSGGLSRDSILADAVEALIGSI 122

Query: 127 YLDGGIEVAGTFVDKYWKQRALK--SGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           +LD  I     F+   ++ R  K   G+ ++D KT LQE+   +    P Y +   SG  
Sbjct: 123 FLDSNIFTVEKFILNLYRSRLNKIIPGERQKDPKTRLQEYLQGQHMPLPIYIIVQISGET 182

Query: 185 HDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLK 221
           HD RF +  +++ LA P  G   S+R AEQ AA + LK
Sbjct: 183 HDQRFIIHCQVNNLANPIIGHGSSRRQAEQAAAQQALK 220


>gi|289423974|ref|ZP_06425766.1| ribonuclease III [Peptostreptococcus anaerobius 653-L]
 gi|289155610|gb|EFD04283.1| ribonuclease III [Peptostreptococcus anaerobius 653-L]
          Length = 236

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 82/224 (36%), Positives = 126/224 (56%), Gaps = 5/224 (2%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSYQES--YERLEFLGDRILGLLISTLLFNH 62
           + S+ EK+IGY F ++  ++ ALTHSS ++ ++E    ERLEFLGD +LGL++S  LF+ 
Sbjct: 11  KISSFEKKIGYIFNDKENIQVALTHSSFANEHKEYKYNERLEFLGDSVLGLVVSDYLFSV 70

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
                EG+L+    ++V  E+ S VAR+L+L  ++ + +  R+   S   SI AD  E++
Sbjct: 71  RTDLPEGQLTKFRANVVCEESLSVVARKLNLGEYLLLGNGERQSGGSDRDSILADATEAV 130

Query: 123 IAALYLDGGIEVAGTFVDKYWKQRALKS--GKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           IAA+Y+DGG + A  F+    +    K+  G   RD KT LQE   +K G    Y++   
Sbjct: 131 IAAIYIDGGFDKAKEFIMYNLRDVIAKTIDGNIFRDYKTILQEVIQSKNGRIS-YRLVQE 189

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
            GPDHD  F + V         G+  +K+ AE+ AA   L+  G
Sbjct: 190 KGPDHDKVFEMEVRSGNKVLGFGVGKNKKDAEKEAAKNALENMG 233


>gi|257440564|ref|ZP_05616319.1| ribonuclease III [Faecalibacterium prausnitzii A2-165]
 gi|257196887|gb|EEU95171.1| ribonuclease III [Faecalibacterium prausnitzii A2-165]
          Length = 224

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 86/221 (38%), Positives = 120/221 (54%), Gaps = 9/221 (4%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ---ESYERLEFLGDRILGLLISTLLFNHFDS 65
           LE  IGY F N  LLE ALTH+S ++  +   +  ERLEFLGD +L ++ +  LF+ +  
Sbjct: 5   LETIIGYKFKNPKLLETALTHTSYANESRTPVQHNERLEFLGDSVLQIVSADYLFHAYAD 64

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+L+   +SLVS     Q A+E++L  ++R+     +       S+ +D  E++IAA
Sbjct: 65  RPEGDLTRIRSSLVSEGALFQFAQEINLGEYLRLGRGEERCGGRTRPSVVSDAFEAVIAA 124

Query: 126 LYLDGGIEVAGTFVDKYWKQRALKSGKF-RRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           LYLDGG+EVA +F+  +     +  GK    D KT LQE           Y V   SGPD
Sbjct: 125 LYLDGGMEVAKSFILPF-----ITEGKHAEADYKTRLQEIVQQNPEERLSYVVEQESGPD 179

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           HD  F V V  +    A+G   SK+ AEQ AA E LK  G+
Sbjct: 180 HDKHFVVAVRFNSDKVARGEGRSKKMAEQHAAREALKLLGV 220


>gi|308063545|gb|ADO05432.1| ribonuclease III [Helicobacter pylori Sat464]
          Length = 238

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 123/221 (55%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y+TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 17  YATLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 74

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VSA   +++A+ + L  ++RVSS           SI +   E+L+A 
Sbjct: 75  YDEGKLSKLRASIVSAHGFTKLAKVIALQDYLRVSSSEEISNGREKPSILSSAFEALMAG 134

Query: 126 LYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+    ++    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 135 VYLEAGLAKVQKIIQNLLNRAYKRLDLEH--LFMDYKTALQELTQAQFCVIPTYQLLKEK 192

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F + + I     A     SK+ AEQ  A + L++
Sbjct: 193 GPDHHKEFEMALYIQDKIYATAKGKSKKEAEQQCAYQALQK 233


>gi|291278588|ref|YP_003495423.1| ribonuclease III [Deferribacter desulfuricans SSM1]
 gi|290753290|dbj|BAI79667.1| ribonuclease III [Deferribacter desulfuricans SSM1]
          Length = 231

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 83/225 (36%), Positives = 127/225 (56%), Gaps = 22/225 (9%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISH--SYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           LE+ IGY F N+SLL +ALTHSS ++    + +YERLEFLGD +L L+++  L   +   
Sbjct: 7   LEELIGYRFKNKSLLLEALTHSSYAYEKKLKRNYERLEFLGDSVLQLIVTEYLVIKYKEF 66

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCS---FMTSIQADVVESLI 123
           KEG LS   +  VS +  S++A ++ L  F+ +    + ++ S      SI AD+ ESL+
Sbjct: 67  KEGVLSKYRSFFVSEDIISEIALKIRLNDFLMLG---KGEIVSGGYTKPSILADIFESLL 123

Query: 124 AALYLDGG--------IEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEY 175
            A+YLDGG        + +    +D+Y ++  +       D KTELQ+    KFG  PEY
Sbjct: 124 GAVYLDGGYNEARRIVLMLMSELMDEYIEKGII------IDPKTELQKITQQKFGYIPEY 177

Query: 176 KVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
           KV    GP+HD  FTV ++++      G+  +K+ AE  AA++ L
Sbjct: 178 KVLKEEGPEHDKVFTVELKLADGNKFIGVGRNKKKAEIDAASKAL 222


>gi|217033708|ref|ZP_03439135.1| hypothetical protein HP9810_5g50 [Helicobacter pylori 98-10]
 gi|216943897|gb|EEC23334.1| hypothetical protein HP9810_5g50 [Helicobacter pylori 98-10]
          Length = 238

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 123/221 (55%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y+TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 17  YTTLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 74

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VSA   +++A+ + L  ++RVSS           SI +   E+L+A 
Sbjct: 75  YDEGKLSKLRASIVSAHGFTKLAKVIALQDYLRVSSSEEISNGREKPSILSSAFEALMAG 134

Query: 126 LYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+    ++    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 135 VYLEAGLAKVRKIIQNLLNRAYKRLDLEH--LFMDYKTALQELTQAQFCVIPTYQLLKEK 192

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F + + I     A     SK+ AEQ  A + L++
Sbjct: 193 GPDHHKEFEMALYIQDKIYATAKGKSKKEAEQQCAYQALQK 233


>gi|87118656|ref|ZP_01074555.1| ribonuclease III [Marinomonas sp. MED121]
 gi|86166290|gb|EAQ67556.1| ribonuclease III [Marinomonas sp. MED121]
          Length = 217

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 84/212 (39%), Positives = 118/212 (55%), Gaps = 8/212 (3%)

Query: 13  IGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELS 72
           +GY FA+  LLE ALTH S      ++ ERLEFLGD IL  +I+  LF+ F  AKEGELS
Sbjct: 1   MGYFFADLGLLELALTHRSFG---GKNNERLEFLGDSILNYVIAEDLFHRFPKAKEGELS 57

Query: 73  VRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGI 132
               SLV  ET +++ARE  L  ++++ +   K       SI  D VE +I A++LD G+
Sbjct: 58  RLRASLVKGETLAEIAREFKLGDYLKLGAGELKSGGFRRDSILEDAVEGIIGAIFLDAGM 117

Query: 133 EVAGTFVDKYWKQRALKSGKFR---RDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
           +     +  +++ R L +   +   +DAKT LQE+  A+    P+Y+VT   G  HD  F
Sbjct: 118 DTCSERILSWYESR-LNATSLKIVTKDAKTRLQEFLQARKHALPQYEVTEVLGEPHDQTF 176

Query: 190 TVVVEISGLA-PAQGMDCSKRAAEQVAAAEVL 220
            V   I   A P +G   S+R AEQ AA + L
Sbjct: 177 YVHCVIELFADPIEGKGNSRRIAEQKAATQAL 208


>gi|261838098|gb|ACX97864.1| ribonuclease III [Helicobacter pylori 51]
          Length = 239

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 123/221 (55%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y+TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 18  YATLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 75

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VSA   +++A+ + L  ++RVSS           SI +   E+L+A 
Sbjct: 76  YDEGKLSKLRASIVSAHGFTKLAKVIALQDYLRVSSSEEISKGREKPSILSSAFEALMAG 135

Query: 126 LYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+    ++    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 136 VYLEAGLAKVRKIIQNLLNRAYKRLDLEH--LFMDYKTALQELTQAQFCVIPTYQLLKEK 193

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F + + I     A     SK+ AEQ  A + L++
Sbjct: 194 GPDHHKEFEMALYIQDKIYATAKGKSKKEAEQQCAYQALQK 234


>gi|308061992|gb|ADO03880.1| ribonuclease III [Helicobacter pylori Cuz20]
          Length = 239

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 123/221 (55%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y+TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 18  YATLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 75

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VSA   +++A+ + L  ++RVSS           SI +   E+L+A 
Sbjct: 76  YDEGKLSKLRASIVSAHGFTKLAKVIALQDYLRVSSSEEISNGREKPSILSSAFEALMAG 135

Query: 126 LYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+    ++    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 136 VYLEAGLAKVRKIIQNLLNRAYKRLDLEH--LFMDYKTALQELTQAQFCVIPTYQLLKEK 193

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F + + I     A     SK+ AEQ  A + L++
Sbjct: 194 GPDHHKEFEMALYIQDKIYATAKGKSKKEAEQQCAYQALQK 234


>gi|24372926|ref|NP_716968.1| ribonuclease III [Shewanella oneidensis MR-1]
 gi|81462673|sp|Q8EH81|RNC_SHEON RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|24347062|gb|AAN54413.1|AE015579_2 ribonuclease III [Shewanella oneidensis MR-1]
          Length = 226

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 81/216 (37%), Positives = 122/216 (56%), Gaps = 6/216 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L + +GY F N  LL +ALTH S ++ + E   RLEFLGD IL ++IS  L++ F  A E
Sbjct: 10  LCRTLGYEFKNLDLLTQALTHRSAANKHNE---RLEFLGDSILSIVISDALYHQFPKATE 66

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV  +T + +A+   L  ++ +     K       SI AD VE++I A+YL
Sbjct: 67  GDLSRMRATLVRGDTLTLIAQAFKLGDYLFLGPGELKSGGFRRESILADAVEAIIGAIYL 126

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  +EV    +  ++ +R   ++ G  ++DAKT LQE+        P+Y+V    G  HD
Sbjct: 127 DSDLEVCRQLLLNWYAERLAEIQPGINQKDAKTLLQEYLQGLKKPLPDYQVINIEGDAHD 186

Query: 187 PRFTVVVEISGLAPAQ-GMDCSKRAAEQVAAAEVLK 221
             FTV   I  L+ +  G+  S+R AEQ+AAA+VL+
Sbjct: 187 QTFTVECRIDDLSQSVIGVASSRRKAEQIAAAQVLE 222


>gi|114048421|ref|YP_738971.1| ribonuclease III [Shewanella sp. MR-7]
 gi|122944480|sp|Q0HSJ1|RNC_SHESR RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|113889863|gb|ABI43914.1| RNAse III [Shewanella sp. MR-7]
          Length = 226

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 81/216 (37%), Positives = 122/216 (56%), Gaps = 6/216 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L + +GY F N  LL +ALTH S ++ + E   RLEFLGD IL ++IS  L++ F  A E
Sbjct: 10  LCRTLGYEFKNLELLTQALTHRSAANKHNE---RLEFLGDSILSIVISDALYHQFPKATE 66

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV  +T + +A+   L  ++ +     K       SI AD VE++I A+YL
Sbjct: 67  GDLSRMRATLVRGDTLTLIAKAFKLGDYLFLGPGELKSGGFRRESILADAVEAIIGAIYL 126

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  +EV    +  ++ +R   ++ G  ++DAKT LQE+        P+Y+V    G  HD
Sbjct: 127 DSDLEVCRKLLLHWYAERLAEIQPGVNQKDAKTLLQEYLQGLKKPLPDYQVINIEGDAHD 186

Query: 187 PRFTVVVEISGLAPAQ-GMDCSKRAAEQVAAAEVLK 221
             FTV   I  L+ +  G+  S+R AEQ+AAA+VL+
Sbjct: 187 QTFTVECRIDDLSESVIGVASSRRKAEQIAAAQVLE 222


>gi|117921465|ref|YP_870657.1| ribonuclease III [Shewanella sp. ANA-3]
 gi|189043353|sp|A0KZN2|RNC_SHESA RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|117613797|gb|ABK49251.1| RNAse III [Shewanella sp. ANA-3]
          Length = 226

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 81/216 (37%), Positives = 122/216 (56%), Gaps = 6/216 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L + +GY F N  LL +ALTH S ++ + E   RLEFLGD IL ++IS  L++ F  A E
Sbjct: 10  LCRTLGYEFKNIDLLTQALTHRSAANKHNE---RLEFLGDSILSIVISDALYHQFPKATE 66

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV  +T + +A+   L  ++ +     K       SI AD VE++I A+YL
Sbjct: 67  GDLSRMRATLVRGDTLTLIAKAFKLGDYLFLGPGELKSGGFRRESILADAVEAIIGAIYL 126

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  +EV    +  ++ +R   ++ G  ++DAKT LQE+        P+Y+V    G  HD
Sbjct: 127 DSDLEVCRKLLLHWYAERLAEIQPGVNQKDAKTLLQEYLQGLKKPLPDYQVINIEGDAHD 186

Query: 187 PRFTVVVEISGLAPAQ-GMDCSKRAAEQVAAAEVLK 221
             FTV   I  L+ +  G+  S+R AEQ+AAA+VL+
Sbjct: 187 QTFTVECRIDDLSESVIGVASSRRKAEQIAAAQVLE 222


>gi|329297705|ref|ZP_08255041.1| ribonuclease III [Plautia stali symbiont]
          Length = 226

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 126/228 (55%), Gaps = 6/228 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F +  LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPILINKLQRKLGYTFTHPELLQQALTHRSASSKHNE---RLEFLGDSILSYVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE +L   +R+ S   K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAEMAREFELGECLRLGSGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  +++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGIFLDSNIQTVEKLILDWYQNRLEQISPGDKQKDPKTRLQEYLQGRHLPLPSYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKREGI 225
              G  HD  FT+  ++SG+A P  G+  S+R AEQ AA + L + G+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGMAEPVVGVGSSRRKAEQAAAEQALIKLGL 225


>gi|182417248|ref|ZP_02948601.1| ribonuclease III [Clostridium butyricum 5521]
 gi|237669155|ref|ZP_04529139.1| ribonuclease III [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|182378894|gb|EDT76407.1| ribonuclease III [Clostridium butyricum 5521]
 gi|237657503|gb|EEP55059.1| ribonuclease III [Clostridium butyricum E4 str. BoNT E BL5262]
          Length = 232

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 81/226 (35%), Positives = 124/226 (54%), Gaps = 4/226 (1%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTL 58
           M+      +E+ +G  F N +LL+ ALTHSS ++ ++  E  ERLEFLGD +L L I+  
Sbjct: 1   MNKYTLKEIEENLGVCFNNPTLLKTALTHSSFANQFKDAEYNERLEFLGDAVLQLCITEY 60

Query: 59  LFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADV 118
           LFN+F S  EGEL+   + +V   +  ++A++L L  +IR+S            SIQAD 
Sbjct: 61  LFNNFKSKSEGELTKTRSLIVCENSLYEIAKKLHLGEYIRMSKGEELTGGRERISIQADA 120

Query: 119 VESLIAALYLDGGIEVAGTFVDKYWKQRALK--SGKFRRDAKTELQEWAHAKFGVTPEYK 176
           VE++IAA+YLD GI     F+  ++++   K  + +   D KT+LQE+      V+  Y+
Sbjct: 121 VEAVIAAVYLDKGIGFVRDFILLHFEEIIKKAINNEIILDFKTKLQEFLQKDGEVSIHYE 180

Query: 177 VTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           +    GP H  +F   V I      +G   SK+ AEQ AA + L +
Sbjct: 181 LIKHEGPPHRRKFFTNVVIENNIMGEGCGYSKKEAEQNAAKQALMK 226


>gi|149173983|ref|ZP_01852611.1| ribonuclease III [Planctomyces maris DSM 8797]
 gi|148846963|gb|EDL61298.1| ribonuclease III [Planctomyces maris DSM 8797]
          Length = 247

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 81/216 (37%), Positives = 122/216 (56%), Gaps = 7/216 (3%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           ++ +GY F +  LL+  LTH+S + +  +S ERLEFLGD ILG ++   LF+ F +A EG
Sbjct: 18  QQNLGYRFVDCELLKSCLTHTSAAKTRMDSNERLEFLGDAILGSIVCEKLFDQFPNAPEG 77

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLD 129
           EL+   +++VS  TC+++ARE  L  FI V   L     +   S+ A + E+LIA +YLD
Sbjct: 78  ELTRIKSAVVSRNTCTRLAREKGLDRFIFVGKGLAM-TENLPESLLAGMFEALIAGIYLD 136

Query: 130 GGIEVAGTFVDKYWKQRALKSGK--FRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDP 187
           GGI     F+D   ++   K+ +     + K+ LQ+++  KF  TP Y+V    GPDH  
Sbjct: 137 GGIAPVHQFLDPLIERENSKASRSVHGYNYKSLLQQYSQKKFSQTPIYEVLDEKGPDHSK 196

Query: 188 RF--TVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
            F  T ++      PA G   +K+ AEQ AA   L+
Sbjct: 197 FFKVTAIIGEHKYEPAWG--STKKEAEQRAAYNALR 230


>gi|18310700|ref|NP_562634.1| ribonuclease III [Clostridium perfringens str. 13]
 gi|168210649|ref|ZP_02636274.1| ribonuclease III [Clostridium perfringens B str. ATCC 3626]
 gi|168214195|ref|ZP_02639820.1| ribonuclease III [Clostridium perfringens CPE str. F4969]
 gi|168217005|ref|ZP_02642630.1| ribonuclease III [Clostridium perfringens NCTC 8239]
 gi|182625857|ref|ZP_02953623.1| ribonuclease III [Clostridium perfringens D str. JGS1721]
 gi|22654058|sp|Q8XJN8|RNC_CLOPE RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|18145381|dbj|BAB81424.1| ribonuclease III [Clostridium perfringens str. 13]
 gi|170711273|gb|EDT23455.1| ribonuclease III [Clostridium perfringens B str. ATCC 3626]
 gi|170714262|gb|EDT26444.1| ribonuclease III [Clostridium perfringens CPE str. F4969]
 gi|177908891|gb|EDT71383.1| ribonuclease III [Clostridium perfringens D str. JGS1721]
 gi|182380899|gb|EDT78378.1| ribonuclease III [Clostridium perfringens NCTC 8239]
          Length = 237

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 125/229 (54%), Gaps = 6/229 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQES--YERLEFLGDRILGLLISTL 58
           M  +    +EK IG  F N+ +L  ALTHSS ++ +++    ERLEFLGD +L L ++  
Sbjct: 1   MKDINLIEVEKLIGIEFENKGVLITALTHSSYANQFKDVKYNERLEFLGDSVLQLCVTKY 60

Query: 59  LFNHFDSAKEGELSVRFNSLVSAE-TCSQVARELDLASFIRVSSDLRKDVCSFMTSIQAD 117
           LFN++    EGEL+ +  +LV  E +  +V++ L L  +IR+S           TSIQAD
Sbjct: 61  LFNNYKDKSEGELT-KIRALVVCENSLHKVSKNLSLGKYIRMSKGEELTGGRERTSIQAD 119

Query: 118 VVESLIAALYLDGGIEVAGTFVDKYWKQRALK--SGKFRRDAKTELQEWAHAKFGVTPEY 175
            +E++IAA+YLD GIEVA  F+ + +K    K  + +   D KT LQE       V   Y
Sbjct: 120 ALEAVIAAVYLDKGIEVANDFILRNFKDVIDKAINEEIILDFKTRLQEVLQKNGEVNIVY 179

Query: 176 KVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
            +    GP H  +F   + I+     QG+  SK+ +EQ AA   L+R G
Sbjct: 180 NLVKHEGPPHRRKFFTDLLINNEIMGQGVGFSKKESEQNAAKAALQRLG 228


>gi|88858204|ref|ZP_01132846.1| RNase III, dsRNA [Pseudoalteromonas tunicata D2]
 gi|88819821|gb|EAR29634.1| RNase III, dsRNA [Pseudoalteromonas tunicata D2]
          Length = 225

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 78/217 (35%), Positives = 118/217 (54%), Gaps = 5/217 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L  +IGY F N +LLE+A+TH S  H  Q + ERLEFLGD IL  +I+  L+  F  +
Sbjct: 6   TDLYTKIGYTFNNVALLEQAMTHRS--HKGQHN-ERLEFLGDSILSFVIANELYKRFPKS 62

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           +EG+LS   ++LV  +T ++   E +L  ++R+     K       S  AD VE++I A+
Sbjct: 63  REGDLSRMRSTLVRGQTLAEFGLEFNLGDYLRLGPGELKSGGYRRESTLADAVEAIIGAV 122

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           +LD GI+     +  ++K R   +  G  ++D KT LQE+  A+    P Y V    G  
Sbjct: 123 FLDSGIDTCSNLILSWYKFRLDEISPGLNQKDPKTLLQEYLQARKLPLPNYTVIDTKGQA 182

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           H+  FTV   + G+     +  S+R AEQ AA + LK
Sbjct: 183 HNQSFTVECVVEGMNSIVSVGSSRRKAEQKAAEKALK 219


>gi|120599802|ref|YP_964376.1| ribonuclease III [Shewanella sp. W3-18-1]
 gi|146292262|ref|YP_001182686.1| ribonuclease III [Shewanella putrefaciens CN-32]
 gi|189043352|sp|A4Y4K4|RNC_SHEPC RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|189043355|sp|A1RMC7|RNC_SHESW RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|120559895|gb|ABM25822.1| RNAse III [Shewanella sp. W3-18-1]
 gi|145563952|gb|ABP74887.1| RNAse III [Shewanella putrefaciens CN-32]
 gi|319425561|gb|ADV53635.1| ribonuclease III [Shewanella putrefaciens 200]
          Length = 226

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 81/216 (37%), Positives = 122/216 (56%), Gaps = 6/216 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L + +GY F    LL +ALTH S ++ + E   RLEFLGD IL ++IS  L++ F  A E
Sbjct: 10  LCRTLGYEFTQIELLTQALTHRSAANKHNE---RLEFLGDSILSIVISDALYHQFPKATE 66

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV  +T + +A+E  L  ++ +     K       SI AD VE++I A+YL
Sbjct: 67  GDLSRMRATLVRGDTLTIIAQEFKLGDYLYLGPGELKSGGFRRESILADAVEAIIGAIYL 126

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  +EV    +  ++ +R   ++ G  ++DAKT LQE+        P+Y+V    G  HD
Sbjct: 127 DSDLEVCRKLLLTWYAERLAEIQPGVSQKDAKTLLQEYLQGLKKPLPDYQVINIEGDAHD 186

Query: 187 PRFTVVVEISGLAPAQ-GMDCSKRAAEQVAAAEVLK 221
             FTV   I  L+ +  G+  S+R AEQ+AAA+VL+
Sbjct: 187 QTFTVECRIEDLSQSVIGVASSRRKAEQIAAAQVLE 222


>gi|113971183|ref|YP_734976.1| ribonuclease III [Shewanella sp. MR-4]
 gi|122943634|sp|Q0HG98|RNC_SHESM RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|113885867|gb|ABI39919.1| RNAse III [Shewanella sp. MR-4]
          Length = 226

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 81/216 (37%), Positives = 122/216 (56%), Gaps = 6/216 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L + +GY F N  LL +ALTH S ++ + E   RLEFLGD IL ++IS  L++ F  A E
Sbjct: 10  LCRTLGYEFKNIELLTQALTHRSAANKHNE---RLEFLGDSILSIVISDALYHQFPKATE 66

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV  +T + +A+   L  ++ +     K       SI AD VE++I A+YL
Sbjct: 67  GDLSRMRATLVRGDTLTLIAKAFKLGDYLFLGPGELKSGGFRRESILADAVEAIIGAIYL 126

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  +EV    +  ++ +R   ++ G  ++DAKT LQE+        P+Y+V    G  HD
Sbjct: 127 DSDLEVCRKLLLHWYAERLAEIQPGVNQKDAKTLLQEYLQGLKKPLPDYQVINIEGDAHD 186

Query: 187 PRFTVVVEISGLAPAQ-GMDCSKRAAEQVAAAEVLK 221
             FTV   I  L+ +  G+  S+R AEQ+AAA+VL+
Sbjct: 187 QTFTVECRIDDLSESVIGVASSRRKAEQIAAAQVLE 222


>gi|262368562|ref|ZP_06061891.1| dsRNA-specific ribonuclease [Acinetobacter johnsonii SH046]
 gi|262316240|gb|EEY97278.1| dsRNA-specific ribonuclease [Acinetobacter johnsonii SH046]
          Length = 230

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 81/223 (36%), Positives = 121/223 (54%), Gaps = 5/223 (2%)

Query: 2   SALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFN 61
           S L  + L  RIGY F    LL+ ALTH S+SH Y  +YERLEFLGD +LG++I+  L+ 
Sbjct: 6   SKLSEARLASRIGYQFKQPELLQLALTHRSVSHKY--NYERLEFLGDSLLGMIIANYLYK 63

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVES 121
            + +  EG L+    +LV  E   ++A +L L+  + +S+   K       SI AD VES
Sbjct: 64  AYPTENEGRLTRMRATLVRQEALGKIANDLKLSQSLILSTGELKSGGHHRESILADTVES 123

Query: 122 LIAALYLD-GGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +I A+Y+D   + V    V K+++     ++     +D K+ LQE+  A+    P Y V 
Sbjct: 124 IIGAIYVDCSDLTVLEPIVLKWYEPYLDHIEPTDQLKDPKSRLQEYLQARKKALPVYDVV 183

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
              G   +  F V  ++ GL+   G   S+R AEQ AAA++LK
Sbjct: 184 DIQGDAPNQHFKVECKVDGLSVVNGEGTSRRFAEQAAAADILK 226


>gi|238897755|ref|YP_002923434.1| RNase III, ds RNA [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|259491902|sp|C4K3Z3|RNC_HAMD5 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|229465512|gb|ACQ67286.1| RNase III, ds RNA [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 226

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 74/225 (32%), Positives = 127/225 (56%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+++  ++LE ++ Y+F  RSLL +ALTH S+   + +  ERLEFLGD IL  +I+  L+
Sbjct: 1   MNSININSLELKLRYSFKERSLLLQALTHRSL---HTQHNERLEFLGDSILSFVIANQLY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG +S    +LV  +T +++ARE D+ +++++     K   +   SI AD +E
Sbjct: 58  HRFPEINEGNMSRMRATLVRGDTLTEIAREFDIGAYLQLGQGELKTGGAQRESILADSIE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           ++I A++LD  I+     + +++ +R   +     ++D KT LQE+  +     P Y + 
Sbjct: 118 AIIGAIFLDSDIQTVEKTILRWYHKRLEQINPTHHQKDPKTRLQEYMQSHQLPLPFYLLA 177

Query: 179 FRSGPDHDPRFTVVVEISGLAP-AQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SGL     G   ++R AEQ AA + LK+
Sbjct: 178 QVCGEAHDQEFTIHCQVSGLEELVVGKGSNRRKAEQEAAEKTLKK 222


>gi|205355648|ref|ZP_03222418.1| ribonuclease III [Campylobacter jejuni subsp. jejuni CG8421]
 gi|205346425|gb|EDZ33058.1| ribonuclease III [Campylobacter jejuni subsp. jejuni CG8421]
          Length = 225

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 125/220 (56%), Gaps = 8/220 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE+ + Y F +++LL  ALTH S   SY  + ERLEFLGD +L L++   LF+ F    E
Sbjct: 8   LEQSLTYEFKDKNLLIHALTHKSFKKSY--NNERLEFLGDAVLDLVVGEYLFHKFAKDAE 65

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV+ ++ +++A  L+L  FI +S     +      SI +D +E++I A++L
Sbjct: 66  GDLSKLRAALVNEKSFAKIANSLNLGDFILMSVAEENNGGKEKPSILSDTLEAIIGAIHL 125

Query: 129 DGGIEVAGT----FVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           + G E A T     ++K + Q  + +    +D KT+LQE    K G TP+Y+     GPD
Sbjct: 126 EAGFEFAKTIALRLIEKNFPQ--IDAKILIKDYKTKLQEITQGKIGQTPQYETVRAFGPD 183

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           H  +F + + + G   A+ +  SK+ A+Q+AA   L++ G
Sbjct: 184 HLKQFEIALMLDGKELARAIAGSKKEAQQMAAKIALEKLG 223


>gi|87311240|ref|ZP_01093362.1| ribonuclease III [Blastopirellula marina DSM 3645]
 gi|87285980|gb|EAQ77892.1| ribonuclease III [Blastopirellula marina DSM 3645]
          Length = 243

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 84/216 (38%), Positives = 121/216 (56%), Gaps = 3/216 (1%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           S  E RIGY F  +SLL+ ALTH+S +    ES ERLEFLGD ILG ++   LF+ F   
Sbjct: 16  SRCEVRIGYEFQEKSLLKSALTHASGASHRLESNERLEFLGDAILGRVVCEALFHSFPHF 75

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG+L+   + +VS  TC++++R L L  F+ V   +     S   S+ ADV E++IAA+
Sbjct: 76  LEGDLTRIKSVVVSRLTCAKLSRVLGLEEFLIVGKGMSSSP-SVPPSLLADVFEAIIAAI 134

Query: 127 YLDGGIEVAGTFVDKYWKQRA--LKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLDGG + A  FV +  +       SG+   + K+ LQ++A  + G TP Y +    GPD
Sbjct: 135 YLDGGPKPAEDFVLRNLEDEIELAVSGEAGANFKSALQQYAQREHGATPNYLLLDEKGPD 194

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
           H   F V  +++G+        +K+ AEQ AA   L
Sbjct: 195 HSKCFQVAAQVAGIRYVAAWGRNKKEAEQRAAQNAL 230


>gi|108563072|ref|YP_627388.1| ribonuclease III [Helicobacter pylori HPAG1]
 gi|107836845|gb|ABF84714.1| ribonuclease III [Helicobacter pylori HPAG1]
          Length = 240

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 122/221 (55%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y+TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 19  YTTLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 76

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VSA   +++A+ + L  ++RVSS           SI +   E+L+A 
Sbjct: 77  YDEGKLSKLRASIVSAHGFTKLAKAIALQDYLRVSSSEEISNGREKPSILSSAFEALMAG 136

Query: 126 LYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+    ++    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 137 VYLEAGLAKVRKIMQNLLNRAYKRLDLEH--LFMDYKTALQELTQAQFCVIPTYQLLQEK 194

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F + + I     A     SK+ AEQ  A   L++
Sbjct: 195 GPDHHKEFEMALYIQDKMYATAKGKSKKEAEQQCAYYALQK 235


>gi|127511987|ref|YP_001093184.1| ribonuclease III [Shewanella loihica PV-4]
 gi|189043350|sp|A3QBS7|RNC_SHELP RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|126637282|gb|ABO22925.1| RNAse III [Shewanella loihica PV-4]
          Length = 225

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 84/216 (38%), Positives = 120/216 (55%), Gaps = 5/216 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L + +GY F   +LLE+ALTH S +  + E   RLEFLGD IL ++IS  L++ F  A E
Sbjct: 10  LGRILGYQFQQIALLEQALTHRSAASKHNE---RLEFLGDSILSIVISDALYHQFPKATE 66

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV  +  +++A+E  L  ++++     K       SI AD +E++I A+YL
Sbjct: 67  GDLSRMRATLVCGKMLAEIAKEFKLGDYLKLGPGELKSGGFRRESILADAMEAIIGAIYL 126

Query: 129 DGGIEVAGTFVDKYWKQR-ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDP 187
           D  IE   T V  ++K R A+     ++D KT LQE         P Y V   SG  H  
Sbjct: 127 DADIETCRTLVLNWYKSRLAVIEPVNQKDPKTLLQEHLQGFKQPLPVYTVVNISGEAHAQ 186

Query: 188 RFTVVVEISGLAPAQ-GMDCSKRAAEQVAAAEVLKR 222
            FTV  ++  L  A  G+  S+R AEQ+AAAEVL+R
Sbjct: 187 TFTVECKVEQLKEAVIGVANSRRKAEQIAAAEVLER 222


>gi|331082011|ref|ZP_08331139.1| ribonuclease III [Lachnospiraceae bacterium 6_1_63FAA]
 gi|330405606|gb|EGG85136.1| ribonuclease III [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 236

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 80/222 (36%), Positives = 120/222 (54%), Gaps = 5/222 (2%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISH----SYQESYERLEFLGDRILGLLISTLLF 60
           ++  LEK+IGY F N  LL  ALTHSS ++    +Y+E+ ERLEFLGD +L L  S  LF
Sbjct: 6   KFLELEKKIGYEFENFDLLVNALTHSSYANEHHIAYKENNERLEFLGDAVLELTSSEFLF 65

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             +    EG+L+ +  S+V   T +  A+E+ L  ++ +             SI +D +E
Sbjct: 66  YQYADLPEGKLTKKRASIVCEPTLALCAKEISLGDYLLLGKGEEATGGRNRNSIISDAME 125

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           +LI A+YLDGG   A  FV KY     +++ +   D+KT LQE   A++    +Y +   
Sbjct: 126 ALIGAIYLDGGFANAKEFVHKYI-LNDIENKQLFYDSKTTLQEIVQAQYEDDVKYVLVKE 184

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
            GPDH+  F V   +      +G   +K+AAEQ AA   +K+
Sbjct: 185 EGPDHNKSFYVEALLGDKKLGEGCGHTKKAAEQQAAYCAIKK 226


>gi|297343244|pdb|3N3W|A Chain A, 2.2 Angstrom Resolution Crystal Structure Of Nuclease
           Domain Ribonuclase Iii (Rnc) From Campylobacter Jejuni
 gi|297343245|pdb|3N3W|B Chain B, 2.2 Angstrom Resolution Crystal Structure Of Nuclease
           Domain Ribonuclase Iii (Rnc) From Campylobacter Jejuni
          Length = 248

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 124/220 (56%), Gaps = 8/220 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE+ + Y F +++LL  ALTH S   SY    ERLEFLGD +L L++   LF+ F    E
Sbjct: 31  LEQSLTYEFKDKNLLIHALTHKSFKKSYNN--ERLEFLGDAVLDLVVGEYLFHKFAKDAE 88

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV+ ++ +++A  L+L  FI +S     +      SI +D +E++I A++L
Sbjct: 89  GDLSKLRAALVNEKSFAKIANSLNLGDFILMSVAEENNGGKEKPSILSDALEAIIGAIHL 148

Query: 129 DGGIEVAGT----FVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           + G E A T     ++K + Q  + +    +D KT+LQE    K G TP+Y+     GPD
Sbjct: 149 EAGFEFAKTIALRLIEKNFPQ--IDAKILIKDYKTKLQEITQGKIGQTPQYETVRAFGPD 206

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           H  +F + + + G   A+ +  SK+ A+Q+AA   L++ G
Sbjct: 207 HLKQFEIALMLDGKELARAIAGSKKEAQQMAAKIALEKLG 246


>gi|317010882|gb|ADU84629.1| ribonuclease III [Helicobacter pylori SouthAfrica7]
          Length = 234

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 125/225 (55%), Gaps = 9/225 (4%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 13  YITLEKALGYSFKDKHLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 70

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VSA+  +++A+ + L  ++RVSS           SI +   E+L+A 
Sbjct: 71  YDEGKLSKLRASIVSAQGFTKLAKVISLQDYLRVSSSEETSKGREKPSILSSAFEALMAG 130

Query: 126 LYLDGGIE----VAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G++    +    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 131 VYLEAGLDKVRKIMQNLLNRAYKRLDLEH--LSVDYKTALQELTQAQFCVIPTYQLLKEK 188

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR-EGI 225
           GP H   F + + I     A     SK+ AEQ  A + L++ +GI
Sbjct: 189 GPAHHKEFEMALYIQNQMYATAKGKSKKEAEQQCAYQALQKLKGI 233


>gi|323705471|ref|ZP_08117046.1| ribonuclease III [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323535373|gb|EGB25149.1| ribonuclease III [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 232

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 81/226 (35%), Positives = 120/226 (53%), Gaps = 5/226 (2%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSS---ISHSYQESYERLEFLGDRILGLLISTLLFN 61
           RY  LEK +GY F N+ LL+ ALTHSS    S ++  S ERLEFLGD +L ++IS  L+ 
Sbjct: 6   RYENLEKNMGYTFNNKKLLKNALTHSSWANESKNFLSSNERLEFLGDSVLSIVISEYLYK 65

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVES 121
           +    +EG LS     +V   + ++ ARE+D+  ++ +             SI AD +E+
Sbjct: 66  NRTDLEEGYLSKYRAEIVCEPSLARCAREIDIGKYLNIGRGEEMTGGRNRDSILADAMEA 125

Query: 122 LIAALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTF 179
           LIAA+YLD  ++     V + +++    + SG   RD KT+LQE           YK+  
Sbjct: 126 LIAAVYLDSDLKTVSEVVLRLFEKIINEVLSGLIYRDYKTKLQEVTQKMGSERVIYKLID 185

Query: 180 RSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
             GPDH+  F + V +      +G   SK+ AEQ AA E L + G+
Sbjct: 186 EYGPDHNKMFVIEVFVGENRLGRGKGRSKKEAEQYAAMEALSKMGL 231


>gi|292490849|ref|YP_003526288.1| ribonuclease III [Nitrosococcus halophilus Nc4]
 gi|291579444|gb|ADE13901.1| ribonuclease III [Nitrosococcus halophilus Nc4]
          Length = 231

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 83/213 (38%), Positives = 119/213 (55%), Gaps = 6/213 (2%)

Query: 12  RIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGEL 71
           ++GY F   +LL  A+TH S +   +E+ ERLEFLGD IL  LI+  L+  F  A+EG+L
Sbjct: 11  KLGYRFTEPALLRCAITHRSAA---KENNERLEFLGDSILNFLIAEFLYIRFPKAQEGKL 67

Query: 72  SVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGG 131
           S    +LV  ET +++AREL++   + +     K      TSI AD  E++I A+YLDGG
Sbjct: 68  SRLRATLVKGETLAELARELEIGDHLILGPGELKSGGYRRTSILADAFEAVIGAVYLDGG 127

Query: 132 IEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
           +E     V   ++ R  AL S    +D KT LQE+  A+    P+Y+V+   G  HD  F
Sbjct: 128 LEACRKLVASLYEDRLEALTSEVLLKDPKTRLQEYLQARQLPLPDYRVSAVRGEAHDQVF 187

Query: 190 TVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLK 221
            V   I+   P+  G   S+R AEQ AA + L+
Sbjct: 188 QVECIINDTFPSVVGTGRSRRKAEQDAATQALE 220


>gi|331084978|ref|ZP_08334065.1| ribonuclease III [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|330408678|gb|EGG88143.1| ribonuclease III [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 229

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 114/220 (51%), Gaps = 5/220 (2%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISH----SYQESYERLEFLGDRILGLLISTLLF 60
           R   LEK+IGY F  + LL+KA+ HSS ++      Q+  ERLEFLGD +L L  S  LF
Sbjct: 3   RLKELEKKIGYTFQKKELLQKAMMHSSYTNEKHMKKQDCNERLEFLGDAVLELTTSEALF 62

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
               S  EGEL+    S+V     + VA+EL L S++ +             SI +D VE
Sbjct: 63  FDNPSMPEGELTKTRASIVCEPALAFVAKELMLGSYLLLGKGEEATGGRQRDSITSDAVE 122

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           +LI A+YLDGG   A  F+ K+     L++ K   D+KT LQE   AKF     Y +   
Sbjct: 123 ALIGAIYLDGGFASAKEFIQKFI-LSDLENKKLFYDSKTILQEMVQAKFTENVRYVLEKE 181

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
            GPDH+  FT    I       G   +K+A+EQ AA + +
Sbjct: 182 EGPDHNKSFTTSAYIGEECYGTGSGRTKKASEQEAAYQTI 221


>gi|121613213|ref|YP_001001278.1| ribonuclease III [Campylobacter jejuni subsp. jejuni 81-176]
 gi|121504230|gb|EAQ72743.2| ribonuclease III [Campylobacter jejuni subsp. jejuni 81-176]
          Length = 225

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 124/220 (56%), Gaps = 8/220 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE+ + Y F +++LL  ALTH S   SY    ERLEFLGD +L L++   LF+ F    E
Sbjct: 8   LERSLTYEFKDKNLLIHALTHKSFKKSYNN--ERLEFLGDAVLDLVVGEYLFHKFAKDAE 65

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV+ ++ +++A  L+L  FI +S     +      SI +D +E++I A++L
Sbjct: 66  GDLSKLRAALVNEKSFAKIANSLNLGDFIFMSVAEENNGGKEKPSILSDALEAIIGAIHL 125

Query: 129 DGGIEVAGT----FVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           + G E A T     ++K + Q  + +    +D KT+LQE    K G TP+Y+     GPD
Sbjct: 126 EAGFEFAKTIALRLIEKNFPQ--IDAKILIKDYKTKLQEITQGKIGQTPQYETVRAFGPD 183

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           H  +F + + + G   A+ +  SK+ A+Q+AA   L++ G
Sbjct: 184 HLKQFEIALMLDGKELARAIAGSKKEAQQMAAKIALEKLG 223


>gi|148925776|ref|ZP_01809464.1| ribonuclease III [Campylobacter jejuni subsp. jejuni CG8486]
 gi|145845786|gb|EDK22877.1| ribonuclease III [Campylobacter jejuni subsp. jejuni CG8486]
          Length = 229

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 125/220 (56%), Gaps = 8/220 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE+ + Y F +++LL  ALTH S   SY  + ERLEFLGD +L L++   LF+ F    E
Sbjct: 12  LEQSLTYEFKDKNLLIHALTHKSFKKSY--NNERLEFLGDAVLDLVVGEYLFHKFAKDAE 69

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV+ ++ +++A  L+L  FI +S     +      SI +D +E++I A++L
Sbjct: 70  GDLSKLRAALVNEKSFAKIANSLNLGDFILMSVAEENNGGKEKPSILSDALEAIIGAIHL 129

Query: 129 DGGIEVAGT----FVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           + G E A T     ++K + Q  + +    +D KT+LQE    K G TP+Y+     GPD
Sbjct: 130 EAGFEFAKTIALRLIEKNFPQ--IDAKILIKDYKTKLQEITQGKIGQTPQYETVRAFGPD 187

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           H  +F + + + G   A+ +  SK+ A+Q+AA   L++ G
Sbjct: 188 HLKQFEIALMLDGKELARAIAGSKKEAQQMAAKIALEKLG 227


>gi|187918561|ref|YP_001884124.1| ribonuclease III [Borrelia hermsii DAH]
 gi|119861409|gb|AAX17204.1| ribonuclease III [Borrelia hermsii DAH]
          Length = 243

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 117/211 (55%), Gaps = 7/211 (3%)

Query: 17  FANRSLLEKALTHSSISHSYQESY---ERLEFLGDRILGLLISTLLFNHFDSAKEGELSV 73
           F +  LL  +L+HSS ++ + + Y   ERLEFLGD +L L+I+  L+  +    EGELS 
Sbjct: 27  FNDIDLLNMSLSHSSYANEFDQKYANNERLEFLGDSVLNLIITDYLYKFYPEKSEGELSK 86

Query: 74  RFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIE 133
             + +VS E+ S +AREL+L ++I +      +       I AD +E+ + ALYLDGG  
Sbjct: 87  ARSYIVSEESLSSIARELNLGNYILLGRGEENNDGRNKKGIIADAIEAFVGALYLDGGFL 146

Query: 134 VAGTFVDKYWK---QRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFT 190
            A  FV + ++   +     G F +D K+ LQE+   K+ ++P Y++    GPDH+  F 
Sbjct: 147 KASAFVVELFEVHIRLMFNRGDF-KDYKSLLQEYVQKKYKISPNYRLAKELGPDHNKIFC 205

Query: 191 VVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           V + ++    + G   SK+ AE +AA   LK
Sbjct: 206 VELYVNDKFISNGKGKSKKEAEMIAAEMALK 236


>gi|86149260|ref|ZP_01067491.1| ribonuclease III [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|88596211|ref|ZP_01099448.1| ribonuclease III [Campylobacter jejuni subsp. jejuni 84-25]
 gi|218563224|ref|YP_002345004.1| ribonuclease III [Campylobacter jejuni subsp. jejuni NCTC 11168]
 gi|22654076|sp|Q9PM40|RNC_CAMJE RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|85840042|gb|EAQ57300.1| ribonuclease III [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|88191052|gb|EAQ95024.1| ribonuclease III [Campylobacter jejuni subsp. jejuni 84-25]
 gi|112360931|emb|CAL35732.1| ribonuclease III [Campylobacter jejuni subsp. jejuni NCTC 11168]
 gi|284926829|gb|ADC29181.1| ribonuclease III [Campylobacter jejuni subsp. jejuni IA3902]
 gi|315927617|gb|EFV06948.1| ribonuclease III [Campylobacter jejuni subsp. jejuni DFVF1099]
 gi|315928870|gb|EFV08132.1| ribonuclease III [Campylobacter jejuni subsp. jejuni 305]
          Length = 224

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 124/220 (56%), Gaps = 8/220 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE+ + Y F +++LL  ALTH S   SY    ERLEFLGD +L L++   LF+ F    E
Sbjct: 7   LEQSLTYEFKDKNLLIHALTHKSFKKSYNN--ERLEFLGDAVLDLVVGEYLFHKFAKDAE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV+ ++ +++A  L+L  FI +S     +      SI +D +E++I A++L
Sbjct: 65  GDLSKLRAALVNEKSFAKIANSLNLGDFILMSVAEENNGGKEKPSILSDALEAIIGAIHL 124

Query: 129 DGGIEVAGT----FVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           + G E A T     ++K + Q  + +    +D KT+LQE    K G TP+Y+     GPD
Sbjct: 125 EAGFEFAKTIALRLIEKNFPQ--IDAKILIKDYKTKLQEITQGKIGQTPQYETVRAFGPD 182

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           H  +F + + + G   A+ +  SK+ A+Q+AA   L++ G
Sbjct: 183 HLKQFEIALMLDGKELARAIAGSKKEAQQMAAKIALEKLG 222


>gi|50085655|ref|YP_047165.1| ribonuclease III [Acinetobacter sp. ADP1]
 gi|81392620|sp|Q6F9C2|RNC_ACIAD RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|49531631|emb|CAG69343.1| ribonuclease III, ds RNA [Acinetobacter sp. ADP1]
          Length = 230

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 81/223 (36%), Positives = 119/223 (53%), Gaps = 5/223 (2%)

Query: 2   SALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFN 61
           S L    L+ RIGY F    LL+ ALTH S+SH Y  +YERLEFLGD +LG++I+  L+ 
Sbjct: 6   SKLSDPRLQSRIGYEFKQLELLQLALTHRSVSHKY--NYERLEFLGDSLLGMIIANYLYQ 63

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVES 121
            +    EG L+    +LV  E   ++A +L L+  + +S+   K       SI AD VE+
Sbjct: 64  AYPHENEGRLTRMRATLVRQEALGKIANDLKLSRCLILSTGELKSGGHHRESILADTVEA 123

Query: 122 LIAALYLDGG-IEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +I A+Y+D   + +    V K++      ++     +D K+ LQE+  A+    P Y+V 
Sbjct: 124 IIGAIYVDSNDLNLLKNIVLKWYIPYLDHIEPTDQLKDPKSRLQEYLQARKKPLPVYEVV 183

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
              G   +  F VV  + GL    G   S+R AEQ AAAE+LK
Sbjct: 184 DIQGDAPNQHFKVVCLVEGLPRVMGEGSSRRFAEQTAAAEILK 226


>gi|86152963|ref|ZP_01071168.1| ribonuclease III [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|167006173|ref|ZP_02271931.1| ribonuclease III [Campylobacter jejuni subsp. jejuni 81-176]
 gi|85843848|gb|EAQ61058.1| ribonuclease III [Campylobacter jejuni subsp. jejuni HB93-13]
          Length = 224

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 124/220 (56%), Gaps = 8/220 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE+ + Y F +++LL  ALTH S   SY    ERLEFLGD +L L++   LF+ F    E
Sbjct: 7   LERSLTYEFKDKNLLIHALTHKSFKKSYNN--ERLEFLGDAVLDLVVGEYLFHKFAKDAE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV+ ++ +++A  L+L  FI +S     +      SI +D +E++I A++L
Sbjct: 65  GDLSKLRAALVNEKSFAKIANSLNLGDFIFMSVAEENNGGKEKPSILSDALEAIIGAIHL 124

Query: 129 DGGIEVAGT----FVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           + G E A T     ++K + Q  + +    +D KT+LQE    K G TP+Y+     GPD
Sbjct: 125 EAGFEFAKTIALRLIEKNFPQ--IDAKILIKDYKTKLQEITQGKIGQTPQYETVRAFGPD 182

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           H  +F + + + G   A+ +  SK+ A+Q+AA   L++ G
Sbjct: 183 HLKQFEIALMLDGKELARAIAGSKKEAQQMAAKIALEKLG 222


>gi|149194957|ref|ZP_01872050.1| ribonuclease III [Caminibacter mediatlanticus TB-2]
 gi|149134878|gb|EDM23361.1| ribonuclease III [Caminibacter mediatlanticus TB-2]
          Length = 227

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 81/220 (36%), Positives = 120/220 (54%), Gaps = 7/220 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L+K +GY F +  L+ +ALTH S S  +    ERLE+LGD +L L++   L+N F  A+E
Sbjct: 6   LQKSLGYQFKDEKLITEALTHRSYSKEFNN--ERLEYLGDAVLDLIVGEYLYNLFPKAEE 63

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G LS    +LV+ E+  ++A+ L+L  ++ +S     +      SI +   E+LI ALYL
Sbjct: 64  GILSKLRAALVNEESFDKLAKRLNLGKYLFLSPAEENNKGREKPSILSSAFEALIGALYL 123

Query: 129 DGGIEVAGTFVDKYWKQRALK--SGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           + G + A     K  K+   K    +  +D KT LQE   A FGV PEY++   +GPDH 
Sbjct: 124 EAGFDKAKEIALKLLKEEYPKITPEELLKDYKTTLQEITQAHFGVVPEYRLLSATGPDHK 183

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAA---AEVLKRE 223
             F + V I+    A+    SK+AA+Q  A    E LK+E
Sbjct: 184 KEFEIGVFINDREYARAKGRSKKAAQQEGARLTIEKLKKE 223


>gi|15611674|ref|NP_223325.1| ribonuclease III [Helicobacter pylori J99]
 gi|7531198|sp|Q9ZLH2|RNC_HELPJ RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|4155159|gb|AAD06188.1| RIBONUCLEASE III [Helicobacter pylori J99]
          Length = 239

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 122/221 (55%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 18  YLTLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 75

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VSA   +++A+ + L  ++RVSS           SI +   E+L+A 
Sbjct: 76  YDEGKLSKLRASIVSAHGFTKLAKAIALQDYLRVSSSEEISKGREKPSILSSAFEALMAG 135

Query: 126 LYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+    ++    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 136 VYLEAGLAKVRKIIQNLLNRAYKRLDLEH--LFMDYKTALQELTQAQFCVIPTYQLLQEK 193

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F + + I     A     SK+ AEQ  A + L++
Sbjct: 194 GPDHHKEFEMALYIQDKMYATAKGKSKKEAEQQCAYQALQK 234


>gi|260588638|ref|ZP_05854551.1| ribonuclease III [Blautia hansenii DSM 20583]
 gi|260541113|gb|EEX21682.1| ribonuclease III [Blautia hansenii DSM 20583]
          Length = 263

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 80/222 (36%), Positives = 120/222 (54%), Gaps = 5/222 (2%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISH----SYQESYERLEFLGDRILGLLISTLLF 60
           ++  LEK+IGY F N  LL  ALTHSS ++    +Y+E+ ERLEFLGD +L L  S  LF
Sbjct: 33  KFLELEKKIGYEFENFDLLVNALTHSSYANEHHIAYKENNERLEFLGDAVLELTSSEFLF 92

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             +    EG+L+ +  S+V   T +  A+E+ L  ++ +             SI +D +E
Sbjct: 93  YQYADLPEGKLTKKRASIVCEPTLALCAKEISLGDYLLLGKGEEATGGRNRNSIISDAME 152

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           +LI A+YLDGG   A  FV KY     +++ +   D+KT LQE   A++    +Y +   
Sbjct: 153 ALIGAIYLDGGFANAKEFVHKYI-LNDIENKQLFYDSKTTLQEIVQAQYEDDVKYVLVKE 211

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
            GPDH+  F V   +      +G   +K+AAEQ AA   +K+
Sbjct: 212 EGPDHNKSFYVEALLGDKKLGEGCGHTKKAAEQQAAYCAIKK 253


>gi|308182848|ref|YP_003926975.1| ribonuclease III [Helicobacter pylori PeCan4]
 gi|308065033|gb|ADO06925.1| ribonuclease III [Helicobacter pylori PeCan4]
          Length = 239

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 123/221 (55%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 18  YLTLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 75

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VSA+  +++A+ + L  ++RVSS           SI +   E+L+A 
Sbjct: 76  YDEGKLSKLRASIVSAQGFTKLAKAIALQDYLRVSSSEEISNGREKPSILSSAFEALMAG 135

Query: 126 LYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+    ++    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 136 VYLEAGLAKVRKIIQNLLNRAYKRLDLEH--LFMDYKTALQELTQAQFCVIPIYQLLKEK 193

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F + + I     A     SK+ AEQ  A + L++
Sbjct: 194 GPDHHKEFEMALYIQDKMYATAKGKSKKEAEQQCAYQALQK 234


>gi|308187806|ref|YP_003931937.1| RNase III, ds RNA [Pantoea vagans C9-1]
 gi|308058316|gb|ADO10488.1| RNase III, ds RNA [Pantoea vagans C9-1]
          Length = 226

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 81/228 (35%), Positives = 125/228 (54%), Gaps = 6/228 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F +  LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPILINKLQRKLGYTFTHSELLQQALTHRSASSKHNE---RLEFLGDSILSYVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE DL   +R+     K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAEMAREFDLGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  IE     +  +++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGIFLDSSIERVEQLILDWYQTRLDEISPGDKQKDPKTRLQEYLQGRHLPLPSYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKREGI 225
              G  HD  FT+  ++SG+A P  G+  S+R AEQ AA + L + G+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGMAEPVVGVGSSRRKAEQAAAEQALIKLGL 225


>gi|110801795|ref|YP_699005.1| ribonuclease III [Clostridium perfringens SM101]
 gi|110682296|gb|ABG85666.1| ribonuclease III [Clostridium perfringens SM101]
          Length = 241

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 84/221 (38%), Positives = 123/221 (55%), Gaps = 6/221 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQES--YERLEFLGDRILGLLISTLLFNHFDSA 66
           +EK IG  F N+ +L  ALTHSS ++ +++    ERLEFLGD +L L ++  LFN++   
Sbjct: 13  VEKLIGIEFENKGVLITALTHSSYANQFKDVKYNERLEFLGDSVLQLCVTKYLFNNYKDK 72

Query: 67  KEGELSVRFNSLVSAE-TCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
            EGEL+ +  +LV  E +  +V++ L L  +IR+S           TSIQAD +E++IAA
Sbjct: 73  SEGELT-KIRALVVCENSLHKVSKNLSLGKYIRMSKGEELTGGRERTSIQADALEAVIAA 131

Query: 126 LYLDGGIEVAGTFVDKYWKQRALK--SGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           +YLD GIEVA  F+ + +K    K  + +   D KT LQE       V   Y +    GP
Sbjct: 132 VYLDKGIEVANDFILRNFKDVIDKAINEEIILDFKTRLQEVLQKNGEVNIVYNLVKHEGP 191

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
            H  +F   + I+     QG+  SK+ +EQ AA   L+R G
Sbjct: 192 PHRRKFFTDLLINNEVMGQGVGFSKKESEQNAAKAALQRLG 232


>gi|90407379|ref|ZP_01215564.1| ribonuclease III [Psychromonas sp. CNPT3]
 gi|90311530|gb|EAS39630.1| ribonuclease III [Psychromonas sp. CNPT3]
          Length = 231

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 82/222 (36%), Positives = 118/222 (53%), Gaps = 5/222 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M       LE+RIGY F N +LL++ALTH S   ++ E   RLEFLGD IL  +IST L+
Sbjct: 5   MKETELKRLERRIGYKFNNFALLKQALTHRSALGAHNE---RLEFLGDSILSFVISTDLY 61

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F    EG+LS    +LV  +  +++ RE +L   + +     K       SI AD VE
Sbjct: 62  LRFPKVNEGDLSRMRATLVCGKMLAEIGREFELGDSLILGPGELKSGGFRRDSIIADGVE 121

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           S+I A++LD  I      V  ++  R   ++ G  ++D KT LQE   ++    P Y+V 
Sbjct: 122 SIIGAVFLDSDINSVDRLVLAWFNSRLTTIEPGIGQKDPKTRLQEHLQSRKQGLPLYEVL 181

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
              G  H+ RFT+   I G+   QG   S+R AEQ+AA ++L
Sbjct: 182 EIRGEAHNQRFTMSCIIDGIEAVQGQGTSRRKAEQIAAEKML 223


>gi|210134869|ref|YP_002301308.1| ribonuclease III [Helicobacter pylori P12]
 gi|226741371|sp|B6JLQ0|RNC_HELP2 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|210132837|gb|ACJ07828.1| ribonuclease III [Helicobacter pylori P12]
          Length = 239

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 122/221 (55%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 18  YLTLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 75

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VSA   +++A+ + L  ++RVSS           SI +   E+L+A 
Sbjct: 76  YDEGKLSKLRASIVSAHGFTKLAKAIALQDYLRVSSSEEISNGREKPSILSSAFEALMAG 135

Query: 126 LYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+    ++    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 136 VYLEAGLAKVRKIIQNLLNRAYKRLDLEH--LFMDYKTALQELTQAQFCVIPTYQLLQEK 193

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F + + I     A     SK+ AEQ  A + L++
Sbjct: 194 GPDHHKEFEMALYIQDKMYATAKGKSKKEAEQQCAYQALQK 234


>gi|317012480|gb|ADU83088.1| ribonuclease III [Helicobacter pylori Lithuania75]
          Length = 239

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 79/221 (35%), Positives = 122/221 (55%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 18  YLTLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 75

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VSA   +++A+ + L  ++R+SS           SI +   E+L+A 
Sbjct: 76  YDEGKLSKLRASIVSAHGFTKLAKAIALQDYLRISSSEEISNGREKPSILSSAFEALMAG 135

Query: 126 LYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+    ++    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 136 VYLEAGLAKVRKIMQNLLNRAYKRLDLEH--LFMDYKTALQELTQAQFCVIPTYQLLQEK 193

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F + + I     A     SK+ AEQ  A + L++
Sbjct: 194 GPDHHKEFEMALYIQDKMYATAKGKSKKEAEQQCAYQALQK 234


>gi|226328142|ref|ZP_03803660.1| hypothetical protein PROPEN_02033 [Proteus penneri ATCC 35198]
 gi|225203846|gb|EEG86200.1| hypothetical protein PROPEN_02033 [Proteus penneri ATCC 35198]
          Length = 227

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 76/213 (35%), Positives = 115/213 (53%), Gaps = 7/213 (3%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ L  + L+K++GY F    LL +ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNTLLVNQLQKKLGYTFTQNELLLQALTHRSASSKHNE---RLEFLGDSILSYVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE +L   +R+     K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAELAREFELGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIE-VAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKV 177
           +LI A++LD  I+ +    +  +++ R   +  G  ++D KT LQE+   +    P Y V
Sbjct: 118 ALIGAIFLDSDIQNIEKKIILNWYENRLAEISPGDKQKDPKTRLQEYLQGRHLPLPSYNV 177

Query: 178 TFRSGPDHDPRFTVVVEISGL-APAQGMDCSKR 209
               G  HD  FT+  +ISG+  P +GM  S+R
Sbjct: 178 VQVRGEAHDQEFTIHCQISGIEQPVKGMGTSRR 210


>gi|251772101|gb|EES52671.1| Ribonuclease III [Leptospirillum ferrodiazotrophum]
          Length = 254

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 75/221 (33%), Positives = 122/221 (55%), Gaps = 7/221 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQES-----YERLEFLGDRILGLLISTLLFNHF 63
           LE+R+GY F++   LE+A  H S ++  ++       ERLEFLGD +LGL+++  L   +
Sbjct: 14  LEERLGYRFSSLERLEEATIHKSFTNETKKGGVRRDNERLEFLGDTVLGLVVAEYLMRLW 73

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             + EG LS     +VS  + +Q+AR + L  ++ +             SI +D +E++I
Sbjct: 74  PDSPEGVLSKLKGRIVSEPSLAQIARNIGLGRYLLIGRGEEMTQGREKNSILSDALEAVI 133

Query: 124 AALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           AA+Y DGG++ A  F+ + +++   ++  G+   D KT+LQE+   +    P+Y +T +S
Sbjct: 134 AAIYQDGGLDAARQFILREFRELFESVSRGESVADYKTQLQEYCQRELETLPQYVITGQS 193

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F V V I      +G   SK+ AEQ AA   L+R
Sbjct: 194 GPDHQKVFEVAVRIRDKNWGEGQGHSKKEAEQKAAKSALER 234


>gi|27904735|ref|NP_777861.1| ribonuclease III [Buchnera aphidicola str. Bp (Baizongia
           pistaciae)]
 gi|29427422|sp|P59476|RNC_BUCBP RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|27904132|gb|AAO26966.1| ribonuclease III [Buchnera aphidicola str. Bp (Baizongia
           pistaciae)]
          Length = 226

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 119/220 (54%), Gaps = 6/220 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L+K +GY F  + LL +ALTH S +  + E   RLEFLGD IL  +I+  L++ F    E
Sbjct: 9   LQKILGYTFIKKDLLIQALTHRSANSKHNE---RLEFLGDSILSFVIANALYHCFPHVNE 65

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G++S    +LV   T +++A E DL  ++++     K       SI A+ VE+LI +++L
Sbjct: 66  GDMSRMRATLVRGHTLAKIAYEFDLGDYLQLGQGELKSGGFRRESILANTVEALIGSIFL 125

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  ++     + K++K R  A+     ++D KT LQE+  +K    P Y V    G  H+
Sbjct: 126 DSNLKTIEKLILKWYKNRLKAINPSDTQKDPKTRLQEYLQSKHLPLPSYLVEQVYGEAHN 185

Query: 187 PRFTVVVEISGLAPAQ-GMDCSKRAAEQVAAAEVLKREGI 225
             FT+  EISG+     G+  S+R AEQ AA   L + GI
Sbjct: 186 QLFTIYCEISGINEKTIGIGSSRRKAEQEAAQNALIKLGI 225


>gi|15616869|ref|NP_240082.1| ribonuclease III [Buchnera aphidicola str. APS (Acyrthosiphon
           pisum)]
 gi|219681624|ref|YP_002468010.1| ribonuclease III [Buchnera aphidicola str. 5A (Acyrthosiphon
           pisum)]
 gi|219682181|ref|YP_002468565.1| ribonuclease III [Buchnera aphidicola str. Tuc7 (Acyrthosiphon
           pisum)]
 gi|257471312|ref|ZP_05635311.1| ribonuclease III [Buchnera aphidicola str. LSR1 (Acyrthosiphon
           pisum)]
 gi|11134313|sp|P57346|RNC_BUCAI RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|254807240|sp|B8D951|RNC_BUCA5 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|254807241|sp|B8D7F5|RNC_BUCAT RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|25289216|pir||H84959 ribonuclease III (EC 3.1.26.3) [imported] - Buchnera sp.  (strain
           APS)
 gi|10038933|dbj|BAB12968.1| ribonuclease III [Buchnera aphidicola str. APS (Acyrthosiphon
           pisum)]
 gi|219621914|gb|ACL30070.1| ribonuclease III [Buchnera aphidicola str. Tuc7 (Acyrthosiphon
           pisum)]
 gi|219624467|gb|ACL30622.1| ribonuclease III [Buchnera aphidicola str. 5A (Acyrthosiphon
           pisum)]
 gi|311085996|gb|ADP66078.1| ribonuclease III [Buchnera aphidicola str. LL01 (Acyrthosiphon
           pisum)]
 gi|311086571|gb|ADP66652.1| ribonuclease III [Buchnera aphidicola str. TLW03 (Acyrthosiphon
           pisum)]
 gi|311087152|gb|ADP67232.1| ribonuclease III [Buchnera aphidicola str. JF99 (Acyrthosiphon
           pisum)]
 gi|311087686|gb|ADP67765.1| ribonuclease III [Buchnera aphidicola str. JF98 (Acyrthosiphon
           pisum)]
          Length = 226

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 77/228 (33%), Positives = 125/228 (54%), Gaps = 6/228 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +    ++K +GY F ++ LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNHIVTKKIQKVLGYTFTHKDLLKQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
            HF    EG++S    +LV   T +++A E DL  ++++     K       SI A+ VE
Sbjct: 58  QHFPYIDEGDMSRMRATLVRGNTLAEIAYEFDLGEYLKLGQGELKSGGFRRESILANTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI ++YLD  I+     + K++++R   +  G  ++D KT LQE+  +K    P Y + 
Sbjct: 118 ALIGSIYLDSNIKTVEELILKWYEKRLEKISPGDTQKDPKTRLQEYLQSKHLSLPLYFIV 177

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQ-GMDCSKRAAEQVAAAEVLKREGI 225
              G  H+  FT+  +IS ++    G   S+R AEQ AA + L + G+
Sbjct: 178 EVYGEAHNQLFTIHCKISTISEYLIGTGSSRRKAEQDAAQKALIKLGV 225


>gi|317014083|gb|ADU81519.1| ribonuclease III [Helicobacter pylori Gambia94/24]
          Length = 239

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 81/220 (36%), Positives = 117/220 (53%), Gaps = 6/220 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 18  YLTLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 75

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VSA   +++A+ + L  ++R+SS           SI +   E+L+A 
Sbjct: 76  YDEGKLSKLRASIVSAHGFTKLAKAIALQDYLRISSSEEISKGREKPSILSSAFEALMAG 135

Query: 126 LYLDGGIEVAGTFVDKYWKQRALKSGKFRR---DAKTELQEWAHAKFGVTPEYKVTFRSG 182
           +YL+ G+      + K    RA K         D KT LQE   A+F V P Y++    G
Sbjct: 136 VYLEAGLAKVRKIIQKLL-NRAYKRLDLEHLFMDYKTALQELTQAQFCVIPTYQLLQEKG 194

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           PDH   F + + I     A     SK+ AEQ  A + L++
Sbjct: 195 PDHHKEFEMALYIQDKMYATAKGKSKKEAEQQCAYQALQK 234


>gi|259907677|ref|YP_002648033.1| ribonuclease III [Erwinia pyrifoliae Ep1/96]
 gi|224963299|emb|CAX54784.1| Ribonuclease III [Erwinia pyrifoliae Ep1/96]
 gi|283477528|emb|CAY73444.1| RNase III, ds RNA [Erwinia pyrifoliae DSM 12163]
 gi|310764815|gb|ADP09765.1| ribonuclease III [Erwinia sp. Ejp617]
          Length = 226

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 81/228 (35%), Positives = 123/228 (53%), Gaps = 6/228 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F ++ LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPIVINKLQRKLGYTFTHQELLQQALTHRSASSKHNE---RLEFLGDSILSYVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F    EG++S    +LV   T +++ARE DL   +R+     K       SI AD VE
Sbjct: 58  QRFPRVDEGDMSRMRATLVRGNTLAEMAREFDLGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  ++  R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGVFLDSDIQTVEQLILSWYASRLDQISPGDKQKDPKTRLQEFLQGRHLPLPSYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKREGI 225
              G  HD  FT+  ++SG+A P  G   S+R AEQ AA + L + GI
Sbjct: 178 QVRGEAHDQEFTIHCQVSGMADPVVGTGSSRRKAEQAAAEQALTKLGI 225


>gi|317177479|dbj|BAJ55268.1| ribonuclease III [Helicobacter pylori F16]
          Length = 239

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 122/221 (55%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 18  YITLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 75

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VSA   +++A+ + L  ++RVSS           SI +   E+L+A 
Sbjct: 76  YDEGKLSKLRASIVSAHGFTKLAKVIALQDYLRVSSSEEISKGREKPSILSSAFEALMAG 135

Query: 126 LYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+    ++    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 136 VYLEAGLAKVRKITQNLLNRAYKRLDLEH--LFMDYKTALQELTQAQFCVIPTYQLLKEK 193

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F + + I     A     SK+ AEQ  A + L++
Sbjct: 194 GPDHHKEFEMALYIQDKIYATAKGKSKKEAEQQCAYQALQK 234


>gi|260775208|ref|ZP_05884106.1| ribonuclease III [Vibrio coralliilyticus ATCC BAA-450]
 gi|260608909|gb|EEX35071.1| ribonuclease III [Vibrio coralliilyticus ATCC BAA-450]
          Length = 225

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 116/206 (56%), Gaps = 6/206 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + LEK++GY F +  L+  ALTH S   ++ +  ERLEFLGD IL  +I+  L++ F   
Sbjct: 6   AKLEKKLGYQFNDAELINLALTHRS---AHGKHNERLEFLGDSILSFVIADDLYHRFPKV 62

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG++S    +LV   T +++ RE +L   +++     K       SI AD VE++I A+
Sbjct: 63  NEGDMSRMRATLVRGNTLAELGREFELGDHLKLGPGELKSGGFRRDSILADAVEAIIGAI 122

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLD  IEV    +  ++KQR  A++ G  ++D KT LQE+   +    P Y VT   G  
Sbjct: 123 YLDSDIEVVRGIILSWYKQRLEAIQPGVSQKDPKTRLQEFLQGRRKPLPVYTVTNIKGEA 182

Query: 185 HDPRFTVVVEISGL-APAQGMDCSKR 209
           H+ +FTV  E++G+ +P  G   S+R
Sbjct: 183 HNQQFTVSCEVAGVGSPVIGKGTSRR 208


>gi|332673509|gb|AEE70326.1| ribonuclease III [Helicobacter pylori 83]
          Length = 239

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 122/221 (55%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 18  YITLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 75

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VSA   +++A+ + L  ++RVSS           SI +   E+L+A 
Sbjct: 76  YDEGKLSKLRASIVSAHGFTKLAKVIALQDYLRVSSSEEISKGREKPSILSSAFEALMAG 135

Query: 126 LYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+    ++    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 136 VYLEAGLAKVRKITQNLLNRAYKRLDLEH--LFMDYKTALQELTQAQFCVIPTYQLLKEK 193

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F + + I     A     SK+ AEQ  A + L++
Sbjct: 194 GPDHHKEFEMALYIQDKIYATAKGKSKKEAEQQCAYQALQK 234


>gi|126173439|ref|YP_001049588.1| ribonuclease III [Shewanella baltica OS155]
 gi|160874397|ref|YP_001553713.1| ribonuclease III [Shewanella baltica OS195]
 gi|217974269|ref|YP_002359020.1| ribonuclease III [Shewanella baltica OS223]
 gi|304409362|ref|ZP_07390982.1| ribonuclease III [Shewanella baltica OS183]
 gi|307303720|ref|ZP_07583473.1| ribonuclease III [Shewanella baltica BA175]
 gi|189043346|sp|A3D1V6|RNC_SHEB5 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|189043348|sp|A9L5N6|RNC_SHEB9 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|254807898|sp|B8EBQ2|RNC_SHEB2 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|125996644|gb|ABN60719.1| RNAse III [Shewanella baltica OS155]
 gi|160859919|gb|ABX48453.1| Ribonuclease III [Shewanella baltica OS195]
 gi|217499404|gb|ACK47597.1| Ribonuclease III [Shewanella baltica OS223]
 gi|304351880|gb|EFM16278.1| ribonuclease III [Shewanella baltica OS183]
 gi|306912618|gb|EFN43041.1| ribonuclease III [Shewanella baltica BA175]
 gi|315266632|gb|ADT93485.1| ribonuclease III [Shewanella baltica OS678]
          Length = 226

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 82/216 (37%), Positives = 122/216 (56%), Gaps = 6/216 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L + + Y F N  LL +ALTH S ++ + E   RLEFLGD IL ++IS  L++ F  A E
Sbjct: 10  LCRTLSYEFKNIELLTQALTHRSAANKHNE---RLEFLGDSILSIVISDALYHQFPKATE 66

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV  +T + +A+E  L  ++ +     K       SI AD VE++I A+YL
Sbjct: 67  GDLSRMRATLVRGDTLTIIAQEFKLGDYLYLGPGELKSGGFRRESILADAVEAIIGAVYL 126

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  +EV    + K++ +R   ++ G  ++DAKT LQE         P+Y+V    G  HD
Sbjct: 127 DSDLEVCRALLLKWYAERLAEIQPGISQKDAKTLLQEHLQGFKKPLPDYQVINIEGDAHD 186

Query: 187 PRFTVVVEISGLAPAQ-GMDCSKRAAEQVAAAEVLK 221
             FTV   I  L+ +  G+  S+R AEQ+AAA+VL+
Sbjct: 187 QTFTVECRIEDLSQSVIGVASSRRKAEQIAAAQVLE 222


>gi|145635204|ref|ZP_01790908.1| ribonuclease III [Haemophilus influenzae PittAA]
 gi|229845360|ref|ZP_04465491.1| ribonuclease III [Haemophilus influenzae 6P18H1]
 gi|145267483|gb|EDK07483.1| ribonuclease III [Haemophilus influenzae PittAA]
 gi|229811668|gb|EEP47366.1| ribonuclease III [Haemophilus influenzae 6P18H1]
          Length = 227

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 86/223 (38%), Positives = 122/223 (54%), Gaps = 17/223 (7%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE++IGY F N +LL++ALTH S +  + E   RLEFLGD IL   I+  L++ F    E
Sbjct: 7   LERKIGYCFNNIALLKQALTHRSAATQHNE---RLEFLGDSILNFTIAEALYHQFPRCNE 63

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS    +LV   T + +AR+ +L  ++ + S   K+      SI AD VE++I A+ L
Sbjct: 64  GELSRMRATLVREPTLAILARQFELGDYMSLGSGELKNGGFRRESILADCVEAIIGAMSL 123

Query: 129 DGGIEVAGTFVDKYWKQRAL---KSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           D G+ V  T V + W Q+ L   K G  ++DAKT LQE+   K    P Y+V    G  H
Sbjct: 124 DQGLAVT-TQVIRNWYQQLLAEIKPGDNQKDAKTRLQEYLQGKHLPLPTYEVVNIQGEAH 182

Query: 186 DPRFTVVVEISGLAPAQGMD-------CSKRAAEQVAAAEVLK 221
              FTV  ++     A+ +D        S+R AEQ AA ++LK
Sbjct: 183 CQIFTVKCKVKS---AEKIDRTFVAKGSSRRKAEQAAAEQILK 222


>gi|157415855|ref|YP_001483111.1| ribonuclease III [Campylobacter jejuni subsp. jejuni 81116]
 gi|283957021|ref|ZP_06374493.1| ribonuclease III [Campylobacter jejuni subsp. jejuni 1336]
 gi|189043300|sp|A8FNU7|RNC_CAMJ8 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|157386819|gb|ABV53134.1| ribonuclease III [Campylobacter jejuni subsp. jejuni 81116]
 gi|283791522|gb|EFC30319.1| ribonuclease III [Campylobacter jejuni subsp. jejuni 1336]
 gi|307748491|gb|ADN91761.1| Ribonuclease 3 [Campylobacter jejuni subsp. jejuni M1]
 gi|315931680|gb|EFV10641.1| ribonuclease III [Campylobacter jejuni subsp. jejuni 327]
          Length = 224

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 124/220 (56%), Gaps = 8/220 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE+ + Y F +++LL  ALTH S   SY    ERLEFLGD +L L++   LF+ F    E
Sbjct: 7   LEQSLTYEFKDKNLLIHALTHKSFKKSYNN--ERLEFLGDAVLDLVVGEYLFHKFAKDAE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV+ ++ +++A  L+L  FI +S     +      SI +D +E++I A++L
Sbjct: 65  GDLSKLRAALVNEKSFAKIANSLNLGDFIFMSVAEENNGGKEKPSILSDALEAIIGAIHL 124

Query: 129 DGGIEVAGT----FVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           + G E A T     ++K + Q  + +    +D KT+LQE    K G TP+Y+     GPD
Sbjct: 125 EAGFEFAKTIALRLIEKNFPQ--IDAKILIKDYKTKLQEITQGKIGQTPQYETVRAFGPD 182

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           H  +F + + + G   A+ +  SK+ A+Q+AA   L++ G
Sbjct: 183 HLKQFEIALMLDGKELARAIAGSKKEAQQMAAKIALEKLG 222


>gi|288575033|ref|ZP_06393390.1| ribonuclease III [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288570774|gb|EFC92331.1| ribonuclease III [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 244

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 82/223 (36%), Positives = 121/223 (54%), Gaps = 10/223 (4%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISH--SYQESYERLEFLGDRILGLLISTLLFNHFD 64
           S ++ R+GY+F +  LL +ALTHSS +H    +   ERLEFLGD +L L  ST LF    
Sbjct: 11  SLIQDRLGYSFTDIELLREALTHSSYAHESGLRSWNERLEFLGDAVLELATSTRLFRAMK 70

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRK--DVCSFMTSIQADVVESL 122
              EG L+     LV  E     A  L L+  +RV+  LRK  + C  ++S+ AD +E++
Sbjct: 71  DMDEGGLTRLRARLVRKEALLTWAEALGLSGILRVNRGLRKKGEGCD-LSSMHADAIEAI 129

Query: 123 IAALYLDGGIEVAGTFVDKYW-----KQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKV 177
             A+Y+DGG ++A + V++Y      K   ++ G    D K+ELQ+    K    PEY++
Sbjct: 130 FGAVYMDGGYDMAESVVNRYLDFLFEKGDYIQDGNSSIDPKSELQQILQIKGEPLPEYRI 189

Query: 178 TFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
             R GP H P F V + +SG+  + G   S + AE  AA + L
Sbjct: 190 MSREGPPHSPSFEVELYVSGVLLSSGRGRSIKEAEVQAALDGL 232


>gi|302036171|ref|YP_003796493.1| ribonuclease III [Candidatus Nitrospira defluvii]
 gi|300604235|emb|CBK40567.1| Ribonuclease III [Candidatus Nitrospira defluvii]
          Length = 234

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 117/221 (52%), Gaps = 9/221 (4%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQE----SYERLEFLGDRILGLLISTLLFNHFD 64
           +++ +GY F    LLE+ALTH S S+  +       ERLEFLGD +L L++S  L   F 
Sbjct: 10  VQRLLGYRFHQPRLLEEALTHKSYSNERRSRDRTQNERLEFLGDAVLSLVMSEYLAAEFP 69

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
            + EG LS     LVS  + ++ AR + L   +R+             S+ AD +E+LIA
Sbjct: 70  GSNEGGLSKLKAHLVSEASLAKAARRMKLGRLLRLGKGEELSKGREKHSLLADALEALIA 129

Query: 125 ALYLDGGIEVAGTFV-----DKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTF 179
           A+YLDGG+E +  F      ++    RA ++     D KT+LQE    ++   P+Y+   
Sbjct: 130 AIYLDGGLEASRKFTLQVLEEELLATRAEQARPGMEDYKTQLQEVCQKRYESLPQYETVR 189

Query: 180 RSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
            SGPDH+  F V + I G+    G   SK+ AEQ+AA E L
Sbjct: 190 ESGPDHEKVFEVELTIQGVMRGIGRGRSKKEAEQMAAKEAL 230


>gi|110798679|ref|YP_696405.1| ribonuclease III [Clostridium perfringens ATCC 13124]
 gi|110673326|gb|ABG82313.1| ribonuclease III [Clostridium perfringens ATCC 13124]
          Length = 241

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 84/221 (38%), Positives = 123/221 (55%), Gaps = 6/221 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQES--YERLEFLGDRILGLLISTLLFNHFDSA 66
           +EK IG  F N+ +L  ALTHSS ++ +++    ERLEFLGD +L L ++  LFN++   
Sbjct: 13  VEKLIGIEFENKGVLITALTHSSYANQFKDVKYNERLEFLGDSVLQLCVTKYLFNNYKDK 72

Query: 67  KEGELSVRFNSLVSAE-TCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
            EGEL+ +  +LV  E +  +V++ L L  +IR+S           TSIQAD +E++IAA
Sbjct: 73  SEGELT-KIRALVVCENSLHKVSKNLSLGKYIRMSKGEELTGGRERTSIQADALEAVIAA 131

Query: 126 LYLDGGIEVAGTFVDKYWKQRALK--SGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           +YLD GIEVA  F+ + +K    K  + +   D KT LQE       V   Y +    GP
Sbjct: 132 VYLDKGIEVANDFILRNFKDVIDKAINEEIILDFKTRLQEVLQKNGEVNIVYNLVKHEGP 191

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
            H  +F   + I+     QG+  SK+ +EQ AA   L+R G
Sbjct: 192 PHRRKFFTDLLINNEIMGQGVGFSKKESEQNAAKAALQRLG 232


>gi|296273889|ref|YP_003656520.1| ribonuclease III [Arcobacter nitrofigilis DSM 7299]
 gi|296098063|gb|ADG94013.1| ribonuclease III [Arcobacter nitrofigilis DSM 7299]
          Length = 223

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 77/221 (34%), Positives = 116/221 (52%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y  LEK + Y F N+ L+ +ALTH S    Y    ERLEFLGD +L L++   L+  F  
Sbjct: 4   YVNLEKCLDYQFKNKDLIVEALTHKSFKKPYNN--ERLEFLGDAVLNLIVGEYLYKKFPQ 61

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
           + EG+LS    SLV+    +++A E+ L  +I +S    ++      SI +D  ES++ A
Sbjct: 62  SNEGDLSKIRASLVNETGFTKLANEIKLGDYIYLSIAEERNKGRTKASILSDAFESIMGA 121

Query: 126 LYLDGGIE----VAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+E    +  T ++K + +  L       D KT LQE   A+FG  P+YK+    
Sbjct: 122 IYLESGLETLKPIILTLLEKSYDKINLDV--LFSDYKTALQEITQAEFGSIPDYKIEGSY 179

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F V + I+     Q +  SK+ A+Q  A   L +
Sbjct: 180 GPDHKKEFEVSIWINNQCYGQAIGKSKKLAQQAVAKIALDK 220


>gi|167758292|ref|ZP_02430419.1| hypothetical protein CLOSCI_00630 [Clostridium scindens ATCC 35704]
 gi|167664189|gb|EDS08319.1| hypothetical protein CLOSCI_00630 [Clostridium scindens ATCC 35704]
          Length = 235

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 82/212 (38%), Positives = 112/212 (52%), Gaps = 5/212 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLISTLLFNHFD 64
           LEK+IGY F +  LL+KA+ HSS ++       E  ERLEFLGD +L L+ S  LF   +
Sbjct: 12  LEKKIGYTFKDLQLLKKAMLHSSYANEKHLPKYECNERLEFLGDAVLELVSSEFLFYEHE 71

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EGEL+    S+V     +  AREL L  ++ +             SI +D +E+LI 
Sbjct: 72  KMPEGELTKTRASMVCEPALAFCARELSLGEYLLLGKGEEATGGRKRESITSDAMEALIG 131

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           A+Y+DGG   A  F+ ++  Q  L+  K   D+KT LQE   A F  T  Y++    GPD
Sbjct: 132 AIYIDGGFASAKEFIHRFILQD-LEDKKLFFDSKTILQEIVQANFKETISYRLVREEGPD 190

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           HD  F V+V I       G   +K+AAEQ AA
Sbjct: 191 HDKSFHVMVYIGEEEYGLGKGRTKKAAEQEAA 222


>gi|325677853|ref|ZP_08157495.1| ribonuclease III [Ruminococcus albus 8]
 gi|324110407|gb|EGC04581.1| ribonuclease III [Ruminococcus albus 8]
          Length = 232

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 82/224 (36%), Positives = 122/224 (54%), Gaps = 6/224 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQE---SYERLEFLGDRILGLLISTLLFNHF 63
           +  +KRIGY+F N  LL +AL+HSS ++  ++   S ERLEFLGD +L +++S  +F HF
Sbjct: 8   AEFQKRIGYSFKNDRLLYEALSHSSFANENKKQRHSNERLEFLGDSVLSIVVSDYIFEHF 67

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
               EGEL+    SLV  +   + + + +L  +I +             SI +D +E++I
Sbjct: 68  KHLPEGELTKLRASLVCEKALFEFSHKFELGKYIFLGKGEELTGGRERASIVSDAMEAVI 127

Query: 124 AALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           AA+YLDGG+E A   +  +  +      +  F  D KT LQE          EY +    
Sbjct: 128 AAIYLDGGLEAARKHIMGFLPKDINPAHTETF-HDYKTVLQEVIQRNPEEKIEYFLKGEE 186

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           GPDHD RFTV V+++     +G+  SK++AEQ AA E L   GI
Sbjct: 187 GPDHDKRFTVQVKLNSNVIGEGVGRSKKSAEQNAAKEALDLMGI 230


>gi|307244287|ref|ZP_07526402.1| ribonuclease III [Peptostreptococcus stomatis DSM 17678]
 gi|306492437|gb|EFM64475.1| ribonuclease III [Peptostreptococcus stomatis DSM 17678]
          Length = 235

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 81/220 (36%), Positives = 123/220 (55%), Gaps = 5/220 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQE-SY-ERLEFLGDRILGLLISTLLFNHFDSA 66
            E++IGY F N++ ++ ALTHSS ++ ++E +Y ERLEFLGD +LGL++S  LF   +  
Sbjct: 15  FEEKIGYEFKNKTYIQTALTHSSFANEHKEFNYNERLEFLGDSVLGLVVSDYLFRARNDL 74

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG+L+    ++V  E+ S VAR+++L   + +    +    S   SI AD  E++IAA+
Sbjct: 75  PEGKLTRLRANVVCEESLSAVARKINLGDHLFLGKGEKTSGGSDRDSILADATEAVIAAI 134

Query: 127 YLDGGIEVAGTFVDKYWKQRALKS--GKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLDGG + A  F+    +    K+  G   RD KT LQE      G    YK+   SGPD
Sbjct: 135 YLDGGFDQAKDFILSNLRDTIAKNIDGNIFRDYKTILQEIIQGNNGKIS-YKLVGESGPD 193

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           H+  F + V+        G   +K+ AE+ AA + L + G
Sbjct: 194 HNKEFEMQVKCGQDTIGIGKGKNKKEAEKEAARDALVKMG 233


>gi|315586658|gb|ADU41039.1| ribonuclease III [Helicobacter pylori 35A]
          Length = 238

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 122/221 (55%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 17  YITLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 74

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VSA   +++A+ + L  ++RVSS           SI +   E+L+A 
Sbjct: 75  YDEGKLSKLRASIVSAHGFTKLAKVIALQDYLRVSSSEEISKGREKPSILSSAFEALMAG 134

Query: 126 LYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+    ++    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 135 VYLEAGLAKVCKIIQNLLNRAYKRLDLEH--LFMDYKTALQELTQAQFCVIPTYQLLKEK 192

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F + + I     A     SK+ AEQ  A + L++
Sbjct: 193 GPDHHKEFEMALYIQDKIYATAKGKSKKEAEQQCAYQALQK 233


>gi|328952899|ref|YP_004370233.1| Ribonuclease 3 [Desulfobacca acetoxidans DSM 11109]
 gi|328453223|gb|AEB09052.1| Ribonuclease 3 [Desulfobacca acetoxidans DSM 11109]
          Length = 231

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 81/221 (36%), Positives = 118/221 (53%), Gaps = 5/221 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ---ESYERLEFLGDRILGLLIST 57
           M+ +  + LE+++ Y+F NR  LE+AL HSS ++ +     S ERLEF GD +L L IS 
Sbjct: 1   MTDIHLTELERQLRYSFKNRRWLEQALVHSSYAYEFPLQGPSNERLEFFGDAVLSLFISD 60

Query: 58  LLFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQAD 117
            L  ++  A EG LS    SLV+A   + +AR LDL   +R+     +       S+ AD
Sbjct: 61  FLMEYYPQAGEGLLSRWRASLVNARHLAGIARSLDLGGHLRLGRGEEQQSGRRKPSVLAD 120

Query: 118 VVESLIAALYLDGGIEVAGTFVDKYWKQRA--LKSGKFRRDAKTELQEWAHAKFGVTPEY 175
            +E+++AA+YLDGG   A   V   ++     L+     +D KT LQE+A     VTP Y
Sbjct: 121 ALEAVLAAVYLDGGFAAARGVVKLLFQASLTRLEDKASMQDFKTLLQEYAQKNLKVTPTY 180

Query: 176 KVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           +V   +GP H   F V V ++     +G   SK+ A Q AA
Sbjct: 181 RVVTATGPAHARTFEVEVWLADQPWGRGQGKSKKQAAQEAA 221


>gi|254785337|ref|YP_003072766.1| ribonuclease III [Teredinibacter turnerae T7901]
 gi|237684548|gb|ACR11812.1| ribonuclease III [Teredinibacter turnerae T7901]
          Length = 229

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 85/231 (36%), Positives = 126/231 (54%), Gaps = 12/231 (5%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           +S  + + L K + Y F++ SLLEKAL+H S+  +   + ERLEFLGD +L  LI+  L+
Sbjct: 4   LSKTKLNQLSKALNYTFSDISLLEKALSHRSVGSN---NNERLEFLGDSLLNFLIAENLY 60

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F  A+EG+LS    SLV  ET +++A++ DL  F+ +     K       SI AD VE
Sbjct: 61  QRFPKAREGDLSRLRASLVKGETLAELAKDFDLGEFLYLGEGELKSGGFRRASILADAVE 120

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI A+YL+ G++     V  ++ +R  A+      +D KT LQE+        P Y V 
Sbjct: 121 ALIGAIYLESGMDRCRDTVLHWFGERLDAIDLNSSVKDPKTRLQEYLQELRQPLPVYTVE 180

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQG----MDCSKRAAEQVAAAEVLKREGI 225
            + G  H P F V  +I     +QG       SKR AE++AAA +LK+ G+
Sbjct: 181 SQLGQAHSPEFQVSCDI---GRSQGKTVATSSSKRNAEKLAAAAMLKQLGV 228


>gi|226951500|ref|ZP_03821964.1| ds RNA ribonuclease III [Acinetobacter sp. ATCC 27244]
 gi|294651022|ref|ZP_06728362.1| ribonuclease III [Acinetobacter haemolyticus ATCC 19194]
 gi|226837793|gb|EEH70176.1| ds RNA ribonuclease III [Acinetobacter sp. ATCC 27244]
 gi|292823123|gb|EFF81986.1| ribonuclease III [Acinetobacter haemolyticus ATCC 19194]
          Length = 231

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 79/223 (35%), Positives = 123/223 (55%), Gaps = 5/223 (2%)

Query: 2   SALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFN 61
           + L  + L+ RIGY F    LL+ ALTH S+SH +  +YERLEFLGD +LG++I+  L++
Sbjct: 7   NKLNDTRLQARIGYQFQQIDLLKLALTHRSVSHKH--NYERLEFLGDSLLGMIIANYLYH 64

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVES 121
            + +  EG L+    +LV  E   ++A +L L+  + +S+   K       SI AD VE+
Sbjct: 65  TYPTENEGRLTRMRATLVRQEALGKIANDLQLSRSLILSTGELKSGGHHRESILADTVEA 124

Query: 122 LIAALYLDGG-IEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +I A+Y+D   + +    V K+++     ++     +D K+ LQE+  A+    P Y+V 
Sbjct: 125 IIGAIYIDSNDLNLLQGIVLKWYEPYFDHIEPTDQLKDPKSRLQEYLQARKKPLPVYEVV 184

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
              G   +  F V   + GL   QG   S+R AEQ AAAE+LK
Sbjct: 185 DIQGDAPNQHFKVECLVDGLPKIQGEGSSRRFAEQTAAAEILK 227


>gi|327394842|dbj|BAK12264.1| ribonuclease III Rnc [Pantoea ananatis AJ13355]
          Length = 226

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 125/228 (54%), Gaps = 6/228 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F +  LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPILINKLQRKLGYTFTHSELLQQALTHRSASSKHNE---RLEFLGDSILSYVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE DL   +R+     K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAEMAREFDLGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  +++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGVFLDSDIQTVEKLILDWYQTRLDEISPGDKQKDPKTRLQEYLQGRHLPLPSYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKREGI 225
              G  HD  FT+  ++SG+A P  G+  S+R AEQ AA + L + G+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGMAEPVVGVGSSRRKAEQAAAEQALIKLGL 225


>gi|295094866|emb|CBK83957.1| RNAse III [Coprococcus sp. ART55/1]
          Length = 229

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 83/219 (37%), Positives = 120/219 (54%), Gaps = 6/219 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLISTLLFN 61
           Y  LEKRIGY F +  LL  ALTH+S ++  +    ESYERLEFLGD IL  ++S  LF 
Sbjct: 5   YGELEKRIGYEFKDIRLLITALTHTSFANELKVNKTESYERLEFLGDAILEYIVSDYLFR 64

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVES 121
                +EG+L+    SLV   T SQ++  L    F+ +S    +       SI  D+ ES
Sbjct: 65  KKREYEEGKLTKLRASLVCEFTLSQISESLGYGKFVLLSKGEAQTGGRTRKSILCDLFES 124

Query: 122 LIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           ++ A+YLDGG++VA  FV ++          F  DAK+ LQE+   K G   +Y++    
Sbjct: 125 VLGAMYLDGGMDVAKKFVHQFLLDDVETKSLF-YDAKSTLQEFCQ-KNGKELKYELIEEK 182

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
           GP+H+  F     I G A A+G   +++ +EQ+AA + L
Sbjct: 183 GPEHNKIFVSDALIDGQATARGEGSNRKNSEQMAAYKTL 221


>gi|219870402|ref|YP_002474777.1| ribonuclease III [Haemophilus parasuis SH0165]
 gi|254807496|sp|B8F3C7|RNC_HAEPS RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|219690606|gb|ACL31829.1| ribonuclease III/dsRNA-specific ribonuclease [Haemophilus parasuis
           SH0165]
          Length = 223

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 82/225 (36%), Positives = 125/225 (55%), Gaps = 6/225 (2%)

Query: 4   LRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           ++   L+K++GY FAN   L +ALTH S +    ++ ERLEFLGD IL   I   L+  F
Sbjct: 1   MQLERLQKKLGYQFANLDYLTQALTHRSAAS---KNNERLEFLGDSILNFAIGKALYEKF 57

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             A EGELS    +LV  +T + VAR+ +L  ++++ +   K       SI +D VE++I
Sbjct: 58  PKANEGELSRMRAALVKEQTLAVVARQFELGEYMKLGAGELKSGGYRRESILSDCVEAII 117

Query: 124 AALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           AA+YLD GI+ A   V  +++Q    ++ G+ ++D KT LQE+   +    P Y+V    
Sbjct: 118 AAVYLDAGIDRAMERVHCWYQQLLNDMQLGEAQKDPKTRLQEYLQGRKLPLPTYEVIDIK 177

Query: 182 GPDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLKREGI 225
           G  H+  F V  ++  +     G   S+R AEQ AA +V+K  GI
Sbjct: 178 GEAHNQTFKVSCKVEKVDEIFIGNGTSRRKAEQDAALQVIKVLGI 222


>gi|153810622|ref|ZP_01963290.1| hypothetical protein RUMOBE_01006 [Ruminococcus obeum ATCC 29174]
 gi|149833018|gb|EDM88100.1| hypothetical protein RUMOBE_01006 [Ruminococcus obeum ATCC 29174]
          Length = 223

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 114/206 (55%), Gaps = 7/206 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLISTLLFNHFD 64
           LE+ IGY F N+ LL++ALTHSS ++  +       ERLEFLGD +L L+ S  L+  F 
Sbjct: 4   LEQIIGYTFQNKKLLKQALTHSSYANEKKLGKLGCNERLEFLGDAVLELISSDFLYAKFT 63

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EGEL+ +  SLV   + +  AR+  L  ++ +             SI +D  E+L+ 
Sbjct: 64  QVPEGELTKKRASLVCEPSLAYCARQFGLPQYLLLGKGENMTGGRNRDSIVSDATEALLG 123

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTP-EYKVTFRSGP 183
           A+YLDGG E A  FV K+     ++  +   D+KT LQE    K G+ P EY +T  SGP
Sbjct: 124 AIYLDGGFEPAKDFVLKFI-LNDIEHKQLFYDSKTILQEIVQEK-GIQPVEYILTGESGP 181

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKR 209
           DHD +FTV V+++G     G   +K+
Sbjct: 182 DHDKQFTVSVQVNGQVVGNGTGHTKK 207


>gi|188533138|ref|YP_001906935.1| ribonuclease III [Erwinia tasmaniensis Et1/99]
 gi|238691985|sp|B2VI46|RNC_ERWT9 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|188028180|emb|CAO96038.1| Ribonuclease III [Erwinia tasmaniensis Et1/99]
          Length = 226

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 81/228 (35%), Positives = 123/228 (53%), Gaps = 6/228 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F ++ LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPIVINKLQRKLGYTFTHQELLQQALTHRSASSKHNE---RLEFLGDSILSYVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F    EG++S    +LV   T +++ARE DL   +R+     K       SI AD VE
Sbjct: 58  QRFPRVDEGDMSRMRATLVRGNTLAEMAREFDLGECLRLGPGELKSGGYRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  ++  R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGVFLDSDIQAVEQLILSWYASRLDQISPGDKQKDPKTRLQEFLQGRHLPLPSYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKREGI 225
              G  HD  FT+  ++SG+A P  G   S+R AEQ AA + L + GI
Sbjct: 178 QVRGEAHDQEFTIHCQVSGMAEPVVGTGSSRRKAEQAAAEQALIKLGI 225


>gi|153951733|ref|YP_001398912.1| ribonuclease III [Campylobacter jejuni subsp. doylei 269.97]
 gi|189043301|sp|A7H5Y2|RNC_CAMJD RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|152939179|gb|ABS43920.1| ribonuclease III [Campylobacter jejuni subsp. doylei 269.97]
          Length = 225

 Score =  125 bits (313), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 125/220 (56%), Gaps = 8/220 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE+ + Y F +++LL  ALTH S   SY  + ERLEFLGD +L L++   LF+ F    E
Sbjct: 7   LEQSLTYEFKDKNLLIHALTHKSFKKSY--NNERLEFLGDAVLDLVVGEYLFHKFTKDAE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV+ ++ +++A  L+L  FI +S     +      SI +D +E++I A++L
Sbjct: 65  GDLSKLRAALVNEKSFAKIANSLNLGDFIFMSVAEENNGGKEKPSILSDALEAIIGAIHL 124

Query: 129 DGGIEVAGT----FVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           + G E A T     ++K + Q  + +    +D KT+LQE    K G TP+Y+     GPD
Sbjct: 125 EAGFEFAKTIALRLMEKNFPQ--IDAKILIKDYKTKLQEITQGKIGQTPQYETVRAFGPD 182

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           H  +F + + + G   A+ +  SK+ A+Q+AA   L++ G
Sbjct: 183 HLKQFEIALMLDGKELARAIAGSKKEAQQMAAKIALEKLG 222


>gi|124265843|ref|YP_001019847.1| ribonuclease III [Methylibium petroleiphilum PM1]
 gi|124258618|gb|ABM93612.1| Ribonuclease III [Methylibium petroleiphilum PM1]
          Length = 248

 Score =  125 bits (313), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 75/193 (38%), Positives = 106/193 (54%), Gaps = 5/193 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           + +L+ R+G+ FA   LL +ALTH S      ++ ERLEFLGD +L   IS LLF HF  
Sbjct: 23  FDSLQVRLGHRFAQVGLLGRALTHKSFG---ADNNERLEFLGDAVLSAAISGLLFEHFGQ 79

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
           + EG+L+     LV  E   ++A +L L + +R+S    +   +   SI AD VE+LIAA
Sbjct: 80  SGEGDLTRVRAHLVREEMLHRLALDLGLPALLRLSEGEARSGGARRPSILADAVEALIAA 139

Query: 126 LYLDGGIEVAGTFVDKYWKQRALKSG--KFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           +YLDGG   A   V++ +      +    + RD KTELQEW  A+    P Y++    G 
Sbjct: 140 VYLDGGFASAQALVERLFTPLVASTAAEAWTRDPKTELQEWLQARRQPVPGYRIESTRGR 199

Query: 184 DHDPRFTVVVEIS 196
            H+  FTVV  I 
Sbjct: 200 QHEQMFTVVCSIP 212


>gi|20807916|ref|NP_623087.1| dsRNA-specific ribonuclease [Thermoanaerobacter tengcongensis MB4]
 gi|22654052|sp|Q8R9W3|RNC_THETN RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|20516484|gb|AAM24691.1| dsRNA-specific ribonuclease [Thermoanaerobacter tengcongensis MB4]
          Length = 228

 Score =  125 bits (313), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 83/223 (37%), Positives = 122/223 (54%), Gaps = 7/223 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQE---SYERLEFLGDRILGLLISTLLFNHFDS 65
           LE++I Y F +++LL +ALTHSS +H  +    S ERLEFLGD +L L+IS  L+ +   
Sbjct: 5   LEQKINYEFKDKTLLLEALTHSSWAHEGKNEKVSNERLEFLGDSVLSLVISEYLYKNRKD 64

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
            +EG LS     +V   + ++ AR+++L SF+R+             SI AD +E+L+AA
Sbjct: 65  LEEGSLSKYRAEIVCEPSLARCARKIELGSFLRMGKGEEISGGRDRDSILADAMEALLAA 124

Query: 126 LYLDGGIEVAGTFVDKYWKQ---RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           +YLDGG+E     +   +K+     LK G   RD KT LQE   +       Y++    G
Sbjct: 125 VYLDGGLEAVRRVILDLFKEIIDEVLK-GIIYRDYKTRLQEVVQSMEVGKITYELVEEIG 183

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           PDH+  F   V+I  +    G   SK+ +EQ AA E L + GI
Sbjct: 184 PDHNKTFVTQVKIGDVVLGIGQGKSKKESEQAAAMEALSKLGI 226


>gi|170719010|ref|YP_001784170.1| ribonuclease III [Haemophilus somnus 2336]
 gi|189043321|sp|B0USS1|RNC_HAES2 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|168827139|gb|ACA32510.1| Ribonuclease III [Haemophilus somnus 2336]
          Length = 223

 Score =  125 bits (313), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 79/222 (35%), Positives = 125/222 (56%), Gaps = 6/222 (2%)

Query: 4   LRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           ++   L+K++G+ F N   L++ALTH S +     + ERLEFLGD IL   I   L+  F
Sbjct: 1   MQLEKLQKKLGHQFTNLDYLKQALTHRSAAAF---NNERLEFLGDSILNFAIGKALYEKF 57

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             + EGELS    +LV  +T + VAR+++L  ++++ +   K       SI +D VE+LI
Sbjct: 58  PKSNEGELSRMRATLVKEQTLAVVARQVELGDYLKLGAGELKSGGFRRESILSDCVEALI 117

Query: 124 AALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           AA+YLD GI+VA   V +++++    +K G+ ++D KT LQE+        PEY+V    
Sbjct: 118 AAIYLDAGIDVALARVYQWYQELLEQIKPGEAQKDPKTRLQEFLQGHRLKLPEYEVIEIK 177

Query: 182 GPDHDPRFTVVVEISGLAPAQ-GMDCSKRAAEQVAAAEVLKR 222
           G  H+  F V  ++  L     G   S+R AEQ AA + +++
Sbjct: 178 GDAHNQSFRVSCKVETLTDVVFGQGTSRRKAEQHAAQQAIEK 219


>gi|86158075|ref|YP_464860.1| ribonuclease III [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85774586|gb|ABC81423.1| RNAse III [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 385

 Score =  125 bits (313), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 77/214 (35%), Positives = 117/214 (54%), Gaps = 8/214 (3%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQES----YERLEFLGDRILGLLISTLLFNH 62
             LE R+G A A+R     ALTH S  + ++E      ERLEFLGD ++ L +S  L   
Sbjct: 26  GALEARLGLAVADREAALAALTHKSYVNEHREDGLQDNERLEFLGDAVIDLAVSHRLMER 85

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           F SA+EG+LS    ++V  +  +++AR LDL + +R+            +S+ AD +E++
Sbjct: 86  FPSAREGDLSKMRAAVVDEQGLAEMARTLDLGALLRLGRGEELTGGRQKSSLLADAMEAV 145

Query: 123 IAALYLDGGIEVAGTFVDKYWKQ---RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTF 179
           IAA+Y   G+    +FVD++  +   RA  +G   RD KT+LQE + ++   TP Y+V  
Sbjct: 146 IAAIYRGQGLPAVLSFVDRFLGEAFARA-AAGTLDRDFKTQLQELSQSRLRATPRYRVVA 204

Query: 180 RSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQ 213
             GPDH   F V  ++ G    +G   SK+ AEQ
Sbjct: 205 EHGPDHSKTFEVETDLRGEVMGRGAGRSKKDAEQ 238


>gi|113461383|ref|YP_719452.1| ribonuclease III [Haemophilus somnus 129PT]
 gi|112823426|gb|ABI25515.1| RNAse III [Haemophilus somnus 129PT]
          Length = 227

 Score =  125 bits (313), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 79/222 (35%), Positives = 125/222 (56%), Gaps = 6/222 (2%)

Query: 4   LRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           ++   L+K++G+ F N   L++ALTH S +     + ERLEFLGD IL   I   L+  F
Sbjct: 5   MQLEKLQKKLGHQFTNLDYLKQALTHRSAAAF---NNERLEFLGDSILNFAIGKALYEKF 61

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             + EGELS    +LV  +T + VAR+++L  ++++ +   K       SI +D VE+LI
Sbjct: 62  PKSNEGELSRMRATLVKEQTLAVVARQVELGDYLKLGAGELKSGGFRRESILSDCVEALI 121

Query: 124 AALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           AA+YLD GI+VA   V +++++    +K G+ ++D KT LQE+        PEY+V    
Sbjct: 122 AAIYLDAGIDVALARVYQWYQELLEQIKPGEAQKDPKTRLQEFLQGHRLKLPEYEVIEIK 181

Query: 182 GPDHDPRFTVVVEISGLAPAQ-GMDCSKRAAEQVAAAEVLKR 222
           G  H+  F V  ++  L     G   S+R AEQ AA + +++
Sbjct: 182 GDAHNQSFRVSCKVETLTDVVFGQGTSRRKAEQHAAQQAIEK 223


>gi|320536816|ref|ZP_08036812.1| ribonuclease III [Treponema phagedenis F0421]
 gi|320146325|gb|EFW37945.1| ribonuclease III [Treponema phagedenis F0421]
          Length = 243

 Score =  125 bits (313), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 81/215 (37%), Positives = 112/215 (52%), Gaps = 8/215 (3%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSISHSYQESY---ERLEFLGDRILGLLISTLLFNHFD 64
             +K+ G+ F N  LL  A  H S SH ++ S+   ERLEFLGD +LGL+ ++ L+N   
Sbjct: 18  NFQKKAGFKFKNLKLLNLAFHHRSFSHIHEASFQNNERLEFLGDSVLGLVTASCLYNLLS 77

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EGEL+     LVS ET S +A  LD+  +I +             +I AD +E++I 
Sbjct: 78  DCSEGELAKTKAVLVSEETLSDIALSLDVDKYIMLGRGEEMSGGRRKKAILADAMEAIIG 137

Query: 125 ALYLDGGIEVAGTFVDKYWKQRA--LKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           ALYLD G +VA  FV +    +   +++     D K+ LQE +  KF + P Y V    G
Sbjct: 138 ALYLDSGFKVAEKFVLRIITPKIPLVRNENLHMDYKSALQELSQKKFQILPLYTVVKAQG 197

Query: 183 PDHDPRFTVVVEI--SGLAPAQGMDCSKRAAEQVA 215
           PDHD  F V V+I      PA G    K AA+ VA
Sbjct: 198 PDHDRTFWVEVQIHTKKYGPATG-KSKKEAAQAVA 231


>gi|297379862|gb|ADI34749.1| ribonuclease III [Helicobacter pylori v225d]
          Length = 238

 Score =  125 bits (313), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 79/221 (35%), Positives = 122/221 (55%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y+TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 17  YATLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 74

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VS    +++A+ + L  ++RVSS           SI +   E+L+A 
Sbjct: 75  YDEGKLSKLRASIVSTHGFTKLAKVIALQDYLRVSSSEEISNGREKPSILSSAFEALMAG 134

Query: 126 LYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+    ++    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 135 VYLEAGLAKVRKIIQNLLNRAYKRLDLEH--LFMDYKTALQELTQAQFCVIPTYQLLKEK 192

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F + + I     A     SK+ AEQ  A + L++
Sbjct: 193 GPDHHKEFEMALYIQDKIYATAKGKSKKEAEQQCAYQALQK 233


>gi|292489090|ref|YP_003531977.1| RNase III, ds RNA [Erwinia amylovora CFBP1430]
 gi|292900214|ref|YP_003539583.1| Ribonuclease III [Erwinia amylovora ATCC 49946]
 gi|291200062|emb|CBJ47188.1| Ribonuclease III [Erwinia amylovora ATCC 49946]
 gi|291554524|emb|CBA22094.1| RNase III, ds RNA [Erwinia amylovora CFBP1430]
 gi|312173248|emb|CBX81503.1| RNase III, ds RNA [Erwinia amylovora ATCC BAA-2158]
          Length = 226

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 81/228 (35%), Positives = 123/228 (53%), Gaps = 6/228 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F ++ LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPIVINKLQRKLGYTFTHQELLQQALTHRSASSKHNE---RLEFLGDSILSYVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F    EG++S    +LV   T +++ARE DL   +R+     K       SI AD VE
Sbjct: 58  QRFPRVDEGDMSRMRATLVRGNTLAEMAREFDLGECLRLGPGELKSGGYRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  ++  R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGVFLDSDIQRVEQLILSWYASRLDQISPGDKQKDPKTRLQEFLQGRHLPLPSYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKREGI 225
              G  HD  FT+  ++SG+A P  G   S+R AEQ AA + L + GI
Sbjct: 178 QVRGEAHDQEFTIHCQVSGMADPVVGTGSSRRKAEQAAAEQALTKLGI 225


>gi|57168805|ref|ZP_00367936.1| ribonuclease III Cj1635c [Campylobacter coli RM2228]
 gi|57019852|gb|EAL56535.1| ribonuclease III Cj1635c [Campylobacter coli RM2228]
          Length = 224

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 126/220 (57%), Gaps = 8/220 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE+++ Y F ++ LL  ALTH S    Y    ERLEFLGD +L L++   LF+ F    E
Sbjct: 7   LEQKLAYKFKDKDLLIHALTHKSFKKPYNN--ERLEFLGDAVLDLVVGEYLFHKFAKDAE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV+ ++ +++A  L+L  FI +S+    +      SI +D +E+++ A++L
Sbjct: 65  GDLSKLRAALVNEKSFAKIANSLNLGDFIFMSAAEENNGGKEKPSILSDALEAIMGAIHL 124

Query: 129 DGGIE----VAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           + G +    +A   ++K + Q  + +    +D KT+LQE   AK G TP+Y+     GPD
Sbjct: 125 EAGFDFARNIALKLIEKNFPQ--IDAKNLIKDYKTKLQEITQAKLGQTPQYETVRAFGPD 182

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           H  +F + + ++G   A+ +  +K+ A+Q+AA   L++ G
Sbjct: 183 HLKQFEIALFLNGQELARAIAGNKKEAQQMAAKITLEKLG 222


>gi|33152642|ref|NP_873995.1| ribonuclease III [Haemophilus ducreyi 35000HP]
 gi|73917578|sp|Q7VL75|RNC_HAEDU RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|33148866|gb|AAP96384.1| ribonuclease III [Haemophilus ducreyi 35000HP]
          Length = 222

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 81/215 (37%), Positives = 119/215 (55%), Gaps = 6/215 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L+K+IGY FAN   L +ALTH S +    ++ ERLEFLGD IL   I   LF  F  A E
Sbjct: 6   LQKKIGYQFANLDYLLQALTHRSAAA---KNNERLEFLGDSILNYAIGQALFERFPQANE 62

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS    +LV  +T + +AR+ DL  ++++ +   K       SI +D VE++IAA+YL
Sbjct: 63  GELSRMRATLVREQTLAILARQFDLGEYMKLGAGELKSGGYRRESILSDCVEAIIAAIYL 122

Query: 129 DGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D G++ A   +  +++     +K G  ++D KT LQE+   +    PEY+V    G  H+
Sbjct: 123 DAGMDKASERIYAWYQTLLDEMKPGDAQKDPKTRLQEFLQGRRLKLPEYEVLDIKGEAHN 182

Query: 187 PRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVL 220
             F V  +I        G+  S+R AEQ AA ++L
Sbjct: 183 QIFKVSCKIETFTDIFIGIGTSRRKAEQNAAEQIL 217


>gi|208434584|ref|YP_002266250.1| ribonuclease III [Helicobacter pylori G27]
 gi|226741372|sp|B5Z735|RNC_HELPG RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|208432513|gb|ACI27384.1| ribonuclease III [Helicobacter pylori G27]
          Length = 239

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 79/221 (35%), Positives = 122/221 (55%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y+TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 18  YTTLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 75

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    ++VSA   +++A+ + L  ++RVSS           SI +   E+L+A 
Sbjct: 76  YDEGKLSKLRAAIVSAHGFTKLAKAIALQDYLRVSSSEEISKGREKPSILSSAFEALMAG 135

Query: 126 LYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+    ++    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 136 VYLEAGLAKVRKIIQNLLNRAYKRLDLEH--LFMDYKTALQELTQAQFCVIPTYQLLQEK 193

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F + + I     A     SK+ AEQ  A   L++
Sbjct: 194 GPDHHKEFEMALYIQDKMYATAKGKSKKEAEQQCAYYALQK 234


>gi|317049180|ref|YP_004116828.1| ribonuclease III [Pantoea sp. At-9b]
 gi|316950797|gb|ADU70272.1| ribonuclease III [Pantoea sp. At-9b]
          Length = 226

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 125/228 (54%), Gaps = 6/228 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F +  LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPILINKLQRKLGYTFTHPELLQQALTHRSASSKHNE---RLEFLGDSILSYVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE DL   +R+     K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAEMAREFDLGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  +++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGIFLDSNIQNVEKLILDWYQTRLEQISPGDKQKDPKTRLQEFLQGRHLPLPSYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKREGI 225
              G  HD  FT+  ++SG+A P  G+  S+R AEQ AA + L + G+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGMAEPVVGVGSSRRKAEQAAAEQALIKLGL 225


>gi|305432452|ref|ZP_07401614.1| ribonuclease III [Campylobacter coli JV20]
 gi|304444491|gb|EFM37142.1| ribonuclease III [Campylobacter coli JV20]
          Length = 225

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 126/220 (57%), Gaps = 8/220 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE+++ Y F ++ LL  ALTH S    Y    ERLEFLGD +L L++   LF+ F    E
Sbjct: 8   LEQKLAYKFKDKDLLIHALTHKSFKKPYNN--ERLEFLGDAVLDLVVGEYLFHKFAKDAE 65

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV+ ++ +++A  L+L  FI +S+    +      SI +D +E+++ A++L
Sbjct: 66  GDLSKLRAALVNEKSFAKIANSLNLGDFIFMSAAEENNGGKEKPSILSDALEAIMGAIHL 125

Query: 129 DGGIE----VAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           + G +    +A   ++K + Q  + +    +D KT+LQE   AK G TP+Y+     GPD
Sbjct: 126 EAGFDFARNIALKLIEKNFPQ--IDAKNLIKDYKTKLQEITQAKLGQTPQYETVRAFGPD 183

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           H  +F + + ++G   A+ +  +K+ A+Q+AA   L++ G
Sbjct: 184 HLKQFEIALFLNGQELARAIAGNKKEAQQMAAKITLEKLG 223


>gi|254507535|ref|ZP_05119669.1| ribonuclease III [Vibrio parahaemolyticus 16]
 gi|219549605|gb|EED26596.1| ribonuclease III [Vibrio parahaemolyticus 16]
          Length = 225

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 113/206 (54%), Gaps = 6/206 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + LEK++GY F +  L+  ALTH S +  + E   RLEFLGD IL  +I+  L++ F   
Sbjct: 6   AKLEKKVGYQFNDAELINLALTHRSANGKHNE---RLEFLGDSILSFVIADDLYHRFPKV 62

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG++S    +LV   T +++ RE +L   +++     K       SI AD VE++I A+
Sbjct: 63  NEGDMSRMRATLVRGNTLAELGREFELGDHLKLGPGELKSGGFRRDSILADAVEAIIGAI 122

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLD  IEV  + +  +++ R  A+K G  ++D KT LQE+   +    P Y VT   G  
Sbjct: 123 YLDSDIEVVRSIILSWYQSRLDAIKPGVSQKDPKTRLQEFLQGRRKPLPAYTVTNIKGEA 182

Query: 185 HDPRFTVVVEISGLA-PAQGMDCSKR 209
           H+  FTV  E++G+  P  G   S+R
Sbjct: 183 HNQEFTVSCEVAGIGQPVIGKGTSRR 208


>gi|168184661|ref|ZP_02619325.1| ribonuclease III [Clostridium botulinum Bf]
 gi|237795890|ref|YP_002863442.1| ribonuclease III [Clostridium botulinum Ba4 str. 657]
 gi|182672267|gb|EDT84228.1| ribonuclease III [Clostridium botulinum Bf]
 gi|229262399|gb|ACQ53432.1| ribonuclease III [Clostridium botulinum Ba4 str. 657]
          Length = 234

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 83/221 (37%), Positives = 122/221 (55%), Gaps = 6/221 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHFDSA 66
           L+ ++   F N  LL+ ALTHSS ++  +  + YERLEFLGD +L L+IS  L+  ++  
Sbjct: 11  LQYKLKVYFKNEKLLDVALTHSSYANGKKNIKYYERLEFLGDSVLQLIISEHLYQKYEDK 70

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           KEGEL+ +   +V   +  ++A+  DL  ++++S            SI AD VES+IAA+
Sbjct: 71  KEGELTRKRAIIVCENSLYEIAKRWDLGLYLQMSKGEELTGGRERVSILADCVESIIAAI 130

Query: 127 YLDGGIEVAGTFVDKYWK---QRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           YLD G++ A  FV K +K   ++A+K  +   D KT LQE       +T  Y++  + GP
Sbjct: 131 YLDKGLDHAREFVMKNFKEIIEKAMKD-EIILDYKTTLQEIVQQNNDLTINYELLKQEGP 189

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
            H  RF   V I       G+  SK+ AEQ AA E LK  G
Sbjct: 190 PHRRRFFTNVTIDNEVRGTGIGYSKKEAEQNAAREALKNLG 230


>gi|260598950|ref|YP_003211521.1| ribonuclease III [Cronobacter turicensis z3032]
 gi|260218127|emb|CBA32925.1| Ribonuclease 3 [Cronobacter turicensis z3032]
          Length = 236

 Score =  124 bits (312), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 79/225 (35%), Positives = 124/225 (55%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F ++ LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 11  MNPIVINRLQRKLGYTFHHQDLLQQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 67

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE +L   +R+     K       SI AD VE
Sbjct: 68  HRFPRVDEGDMSRMRATLVRGNTLAEIAREFELGECLRLGPGELKSGGFRRESILADTVE 127

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  +++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 128 ALIGGIFLDSDIQTVERLILTWYQTRLDEISPGDKQKDPKTRLQEYLQGRHLPLPSYLVV 187

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SGL+ P  G   S+R AEQ AA + LK+
Sbjct: 188 QVRGEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAAAEQALKK 232


>gi|167854942|ref|ZP_02477717.1| GTP-binding protein LepA [Haemophilus parasuis 29755]
 gi|167853899|gb|EDS25138.1| GTP-binding protein LepA [Haemophilus parasuis 29755]
          Length = 223

 Score =  124 bits (312), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 82/225 (36%), Positives = 125/225 (55%), Gaps = 6/225 (2%)

Query: 4   LRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           ++   L+K++GY FAN   L +ALTH S +    ++ ERLEFLGD IL   I   L+  F
Sbjct: 1   MQLERLQKKLGYQFANLDYLTQALTHRSAAS---KNNERLEFLGDSILNFAIGKALYEKF 57

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             A EGELS    +LV  +T + VAR+ +L  ++++ +   K       SI +D VE++I
Sbjct: 58  PKADEGELSRMRAALVKEQTLAVVARQFELGEYMKLGAGELKSGGYRRESILSDCVEAII 117

Query: 124 AALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           AA+YLD GI+ A   V  +++Q    ++ G+ ++D KT LQE+   +    P Y+V    
Sbjct: 118 AAVYLDAGIDRAMERVHCWYQQLLNDMQLGEAQKDPKTRLQEYLQGRKLPLPTYEVIDIK 177

Query: 182 GPDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLKREGI 225
           G  H+  F V  ++  +     G   S+R AEQ AA +V+K  GI
Sbjct: 178 GEAHNQTFKVSCKVEKVDEIFIGNGTSRRKAEQDAALQVIKVLGI 222


>gi|148380412|ref|YP_001254953.1| ribonuclease III [Clostridium botulinum A str. ATCC 3502]
 gi|148289896|emb|CAL84004.1| putative ribonuclease III [Clostridium botulinum A str. ATCC 3502]
          Length = 237

 Score =  124 bits (312), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 83/221 (37%), Positives = 122/221 (55%), Gaps = 6/221 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHFDSA 66
           L+ ++   F N  LL+ ALTHSS ++  +  + YERLEFLGD +L L+IS  L+  ++  
Sbjct: 14  LQYKLKVYFKNEKLLDVALTHSSYANGKKNIKYYERLEFLGDSVLQLIISEHLYQKYEDK 73

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           KEGEL+ +   +V   +  ++A+  DL  ++++S            SI AD VES+IAA+
Sbjct: 74  KEGELTRKRAIIVCENSLYEIAKRWDLGFYLQMSKGEELTGGRERVSILADCVESIIAAI 133

Query: 127 YLDGGIEVAGTFVDKYWK---QRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           YLD G++ A  FV K +K   ++A+K  +   D KT LQE       +T  Y++  + GP
Sbjct: 134 YLDKGLDHAREFVMKNFKEIIEKAMKD-EIILDYKTTLQEIVQQNNDLTINYELLKQEGP 192

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
            H  RF   V I       G+  SK+ AEQ AA E LK  G
Sbjct: 193 PHRRRFFTNVTIDNEVRGTGIGYSKKEAEQNAAREALKNLG 233


>gi|224372163|ref|YP_002606535.1| ribonuclease III [Nautilia profundicola AmH]
 gi|223589278|gb|ACM93014.1| ribonuclease III [Nautilia profundicola AmH]
          Length = 226

 Score =  124 bits (312), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 78/225 (34%), Positives = 125/225 (55%), Gaps = 7/225 (3%)

Query: 4   LRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           ++ S LEK +GY F N+ L+ +ALTH S  +  + + ERLEFLGD ++ L++   LF+ F
Sbjct: 1   MQISELEKSLGYQFKNKKLITEALTHRS--YKKEVNNERLEFLGDAVMDLIVGEYLFHLF 58

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             A+EG LS    +LV+ ++ +++A+ L+L  ++ +S     +      SI +   E++I
Sbjct: 59  PKAEEGILSKLRAALVNEDSFTRLAKRLNLGKYLYLSPAEENNNGREKPSILSSAFEAVI 118

Query: 124 AALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
            A+YL+ G E A     +  K+    +   +  +D KT LQE   A FGV PEY++   S
Sbjct: 119 GAIYLEAGFEKAKDVALRLLKEEFPIITPEELLKDYKTTLQEITQAHFGVVPEYRLISAS 178

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA---AEVLKRE 223
           GPDH   F + V I     A+    SK+ A+Q  A    ++LK+E
Sbjct: 179 GPDHKKEFEIGVFIQDKEYARAKGKSKKTAQQEGARLTIDMLKKE 223


>gi|295097900|emb|CBK86990.1| RNAse III [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 226

 Score =  124 bits (312), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 123/224 (54%), Gaps = 6/224 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F ++ LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPIVINRLQRKLGYTFHHQELLQQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE +L   +R+     K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAEIAREFELGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  +++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGVFLDSDIQTVEKLILNWYQTRLDEISPGDKQKDPKTRLQEYLQGRHLPLPSYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLK 221
              G  HD  FT+  ++SGL+ P  G   S+R AEQ AA + LK
Sbjct: 178 QVRGEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAAAEQALK 221


>gi|77165916|ref|YP_344441.1| ribonuclease III [Nitrosococcus oceani ATCC 19707]
 gi|254434280|ref|ZP_05047788.1| ribonuclease III [Nitrosococcus oceani AFC27]
 gi|90101630|sp|Q3J8D5|RNC_NITOC RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|76884230|gb|ABA58911.1| RNAse III [Nitrosococcus oceani ATCC 19707]
 gi|207090613|gb|EDZ67884.1| ribonuclease III [Nitrosococcus oceani AFC27]
          Length = 233

 Score =  124 bits (312), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 82/211 (38%), Positives = 119/211 (56%), Gaps = 14/211 (6%)

Query: 11  KRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGE 70
           +++GY FA  +LL  A+TH S +   +E+ ERLEFLGD IL  LI+  L++ F  A+EGE
Sbjct: 10  RKLGYRFAEPALLRHAITHRSAT---KENNERLEFLGDSILNFLIADFLYSGFPRAQEGE 66

Query: 71  LSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDG 130
           LS    +LV  ET +++AREL++   + +     K      TSI AD  E++I A+YLDG
Sbjct: 67  LSRLRATLVKGETLAELARELEIGDHLILGLGELKSGGYRRTSILADAFEAVIGAVYLDG 126

Query: 131 GIEVAGTFVDKYWKQR-------ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           G+E     V   ++ R       AL + K   D KT LQE+  A+    P+Y+V+  SG 
Sbjct: 127 GLEACRKLVSSLYRDRLETLTNEALLNLK---DPKTRLQEYLQARQFPLPDYRVSAVSGE 183

Query: 184 DHDPRFTVVVEISGLAPAQ-GMDCSKRAAEQ 213
            HD  F V   ++   P+  G+  S+R AEQ
Sbjct: 184 AHDQVFQVECTLNNTFPSVIGIGRSRRKAEQ 214


>gi|317057716|ref|YP_004106183.1| ribonuclease III [Ruminococcus albus 7]
 gi|315449985|gb|ADU23549.1| ribonuclease III [Ruminococcus albus 7]
          Length = 232

 Score =  124 bits (312), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 80/222 (36%), Positives = 120/222 (54%), Gaps = 6/222 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQE---SYERLEFLGDRILGLLISTLLFNHFDS 65
            +K+IGY F N  LL +AL+HSS ++  ++   S ERLEFLGD +L +++S  +F HF  
Sbjct: 10  FQKKIGYHFKNEKLLYEALSHSSFANENKKQRHSNERLEFLGDSVLSIVVSDHIFEHFKH 69

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EGEL+    SLV  +   + + +++L  +I +             SI +D +E++IAA
Sbjct: 70  LPEGELTKLRASLVCEKALFEFSHKIELGKYIFLGKGEELTGGRERASIVSDAMEAVIAA 129

Query: 126 LYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           +YLDGG+E A   +  +  +      +  F  D KT LQE          EY +    GP
Sbjct: 130 IYLDGGLEAARKHIMNFLPKDLNPAHTDTF-HDYKTVLQEIIQRNPEEKVEYFLKGEDGP 188

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           DHD RFTV V+++     +G+  SK+ AEQ AA E L   G+
Sbjct: 189 DHDKRFTVQVKLNNNVIGEGIGRSKKNAEQNAAKEALALMGV 230


>gi|153930813|ref|YP_001384630.1| ribonuclease III [Clostridium botulinum A str. ATCC 19397]
 gi|153937224|ref|YP_001388147.1| ribonuclease III [Clostridium botulinum A str. Hall]
 gi|153940610|ref|YP_001391753.1| ribonuclease III [Clostridium botulinum F str. Langeland]
 gi|168180664|ref|ZP_02615328.1| ribonuclease III [Clostridium botulinum NCTC 2916]
 gi|226949808|ref|YP_002804899.1| ribonuclease III [Clostridium botulinum A2 str. Kyoto]
 gi|152926857|gb|ABS32357.1| ribonuclease III [Clostridium botulinum A str. ATCC 19397]
 gi|152933138|gb|ABS38637.1| ribonuclease III [Clostridium botulinum A str. Hall]
 gi|152936506|gb|ABS42004.1| ribonuclease III [Clostridium botulinum F str. Langeland]
 gi|182668630|gb|EDT80609.1| ribonuclease III [Clostridium botulinum NCTC 2916]
 gi|226841844|gb|ACO84510.1| ribonuclease III [Clostridium botulinum A2 str. Kyoto]
 gi|295319777|gb|ADG00155.1| ribonuclease III [Clostridium botulinum F str. 230613]
 gi|322806720|emb|CBZ04289.1| ribonuclease III [Clostridium botulinum H04402 065]
          Length = 234

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 83/221 (37%), Positives = 122/221 (55%), Gaps = 6/221 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHFDSA 66
           L+ ++   F N  LL+ ALTHSS ++  +  + YERLEFLGD +L L+IS  L+  ++  
Sbjct: 11  LQYKLKVYFKNEKLLDVALTHSSYANGKKNIKYYERLEFLGDSVLQLIISEHLYQKYEDK 70

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           KEGEL+ +   +V   +  ++A+  DL  ++++S            SI AD VES+IAA+
Sbjct: 71  KEGELTRKRAIIVCENSLYEIAKRWDLGFYLQMSKGEELTGGRERVSILADCVESIIAAI 130

Query: 127 YLDGGIEVAGTFVDKYWK---QRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           YLD G++ A  FV K +K   ++A+K  +   D KT LQE       +T  Y++  + GP
Sbjct: 131 YLDKGLDHAREFVMKNFKEIIEKAMKD-EIILDYKTTLQEIVQQNNDLTINYELLKQEGP 189

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
            H  RF   V I       G+  SK+ AEQ AA E LK  G
Sbjct: 190 PHRRRFFTNVTIDNEVRGTGIGYSKKEAEQNAAREALKNLG 230


>gi|116515099|ref|YP_802728.1| hypothetical protein BCc_163 [Buchnera aphidicola str. Cc (Cinara
           cedri)]
 gi|122285505|sp|Q057R4|RNC_BUCCC RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|116256953|gb|ABJ90635.1| ribonuclease III [Buchnera aphidicola str. Cc (Cinara cedri)]
          Length = 226

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 119/225 (52%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +    L+K IGY F N +LL+ ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPIVMKKLQKFIGYTFTNITLLKHALTHRSASSQHNE---RLEFLGDSILSFIIAKALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           +HF    EG +S    +LV   T +++A E  L  ++++    +K       SI A+ +E
Sbjct: 58  HHFPKMNEGGMSRMRATLVRGNTLAEIATEFSLGKYLQLGQGEKKSGGFKRESILANAIE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           ++IA+++LD  I      +  ++K R   +     ++D KT LQE+  +K    P Y + 
Sbjct: 118 AIIASIFLDSNIYTVERIILYWYKNRFKKMNPTGTKKDPKTRLQEYLQSKHFSLPIYSIG 177

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQ-GMDCSKRAAEQVAAAEVLKR 222
              G  H+  FT+  +I GL+    G+  S+R AEQ AA   L R
Sbjct: 178 QIYGEAHNQIFTIYCKIDGLSELLIGIGASRRKAEQDAAQNALIR 222


>gi|119944412|ref|YP_942092.1| ribonuclease III [Psychromonas ingrahamii 37]
 gi|189043334|sp|A1SSM8|RNC_PSYIN RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|119863016|gb|ABM02493.1| RNAse III [Psychromonas ingrahamii 37]
          Length = 228

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 116/214 (54%), Gaps = 5/214 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE+R+ Y F++ SLL++ALTH S   ++ E   RLEFLGD IL   IST L+  F    E
Sbjct: 11  LERRVDYTFSDFSLLQQALTHRSALGNHNE---RLEFLGDSILSYAISTDLYARFPKVDE 67

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV  +  +++ RE  L   + +     K       SI AD VE++I A +L
Sbjct: 68  GDLSRMRATLVCGKMLAEIGREFQLGDCLILGPGELKSGGFRRDSIIADGVEAIIGAAFL 127

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  I+     + K++  R   ++ G  ++D KT LQE   ++    P Y+V    G  H+
Sbjct: 128 DSDIDTVKKLILKWFDSRLNTIEPGISQKDPKTRLQEHLQSRKQPLPIYEVLEIKGEAHN 187

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
            RFT+   I GL   QG   S+R AEQ+AA ++L
Sbjct: 188 QRFTMSCSIDGLKSVQGQGTSRRKAEQIAANKML 221


>gi|328955642|ref|YP_004372975.1| RNAse III [Coriobacterium glomerans PW2]
 gi|328455966|gb|AEB07160.1| RNAse III [Coriobacterium glomerans PW2]
          Length = 241

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 85/218 (38%), Positives = 113/218 (51%), Gaps = 3/218 (1%)

Query: 10  EKRIGYAFANRSLLEKALTHSSI--SHSYQESYERLEFLGDRILGLLISTLLFNHFDSAK 67
           E+   + FA+R LL  ALTH S         SYERLEFLGD ILG +++  LFN + S  
Sbjct: 11  EQICHHRFADRQLLRCALTHPSAVEGQPVCASYERLEFLGDSILGAIVAVALFNSYPSID 70

Query: 68  EGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALY 127
           EG L+    SLVS    S V  EL +   I   +         M S   +V ESL+AA+Y
Sbjct: 71  EGRLTRLKVSLVSGAMLSDVGLELGIDRCIIFGASETGTGARGMHSALENVYESLVAAMY 130

Query: 128 LDGGIEVAGTFVDKYWKQR-ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           LDGG +VA  F+ +  +   A    +   + K+ LQE      G  P YK+   SGP H+
Sbjct: 131 LDGGWDVAEAFILRTLEPHLADDRPESVSNPKSILQERVQEDHGEPPCYKLVGMSGPAHE 190

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           P FT VV + G+   +G   SK+ AE  AA + L+R G
Sbjct: 191 PTFTAVVLVDGVRCGRGTGSSKKEAEASAARDALERMG 228


>gi|311278500|ref|YP_003940731.1| ribonuclease III [Enterobacter cloacae SCF1]
 gi|308747695|gb|ADO47447.1| ribonuclease III [Enterobacter cloacae SCF1]
          Length = 226

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 79/225 (35%), Positives = 124/225 (55%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F ++ LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPIVINRLQRKLGYTFHHQELLQQALTHRSASSKHNE---RLEFLGDSILSYVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE +L   +R+     K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAEIAREFELGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  +++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGVFLDSDIQTVEQLILSWYQSRLDEISPGDKQKDPKTRLQEYLQGRHLPLPSYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SGL+ P  G   S+R AEQ AA + LK+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAAAEQALKK 222


>gi|157825292|ref|YP_001493012.1| ribonuclease III [Rickettsia akari str. Hartford]
 gi|189043339|sp|A8GM79|RNC_RICAH RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|157799250|gb|ABV74504.1| ribonuclease III [Rickettsia akari str. Hartford]
          Length = 227

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 79/221 (35%), Positives = 117/221 (52%), Gaps = 5/221 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSI----SHSYQESYERLEFLGDRILGLLISTLLFN 61
           + TLEK +GY+F N+ LL +AL+H S+     + Y + YERLEFLGD +L L+++ +LF 
Sbjct: 4   FETLEKLLGYSFKNQELLIEALSHPSLRQHHEYKYDKDYERLEFLGDAVLNLVVTEILFR 63

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVES 121
           +F S  EG L+   + LV  ET   V  +L L  +I ++            +   + +E+
Sbjct: 64  NFASYNEGNLAKIRSYLVCKETICVVGTKLTLKDYIIMTYGEEVAGGRDNPNNIENAMEA 123

Query: 122 LIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           LIAA+YLD  IE     + K W++          D KT LQEWA A     P Y++  R 
Sbjct: 124 LIAAIYLDSNIETTRNIIGKLWEEFIKIQNLTDYDPKTALQEWAQASSHHLPIYRLIKRE 183

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           G  H   FTV+V++       G   S + AE+ AA ++L R
Sbjct: 184 GAAHSSTFTVLVKVKDYEQT-GTGHSIKEAEKNAARDLLHR 223


>gi|217032489|ref|ZP_03437981.1| hypothetical protein HPB128_156g19 [Helicobacter pylori B128]
 gi|298736360|ref|YP_003728886.1| ribonuclease 3 [Helicobacter pylori B8]
 gi|216945835|gb|EEC24456.1| hypothetical protein HPB128_156g19 [Helicobacter pylori B128]
 gi|298355550|emb|CBI66422.1| ribonuclease 3 [Helicobacter pylori B8]
          Length = 239

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 121/221 (54%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 18  YLTLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 75

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VSA   +++A+ + L  ++RVSS           SI +   E+L+A 
Sbjct: 76  YDEGKLSKLRASIVSAHGFTKLAKAIALQDYLRVSSSEEISNGREKPSILSSAFEALMAG 135

Query: 126 LYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+    ++    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 136 VYLEAGLAKVRKIIQNLLNRAYKRLDLEH--LFMDYKTALQELTQAQFCVIPTYQLLQEK 193

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F + + I     A     SK+ AEQ  A   L++
Sbjct: 194 GPDHHKEFEMALYIQDKMYATAKGKSKKEAEQQCAYYALQK 234


>gi|299769157|ref|YP_003731183.1| ribonuclease III [Acinetobacter sp. DR1]
 gi|298699245|gb|ADI89810.1| ribonuclease III [Acinetobacter sp. DR1]
          Length = 230

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 117/213 (54%), Gaps = 5/213 (2%)

Query: 12  RIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGEL 71
           RIGY F    LL+ ALTH S+SH Y  +YERLEFLGD +LG++I+  L++ + +  EG L
Sbjct: 16  RIGYQFKQLELLQLALTHRSVSHKY--NYERLEFLGDSLLGMIIANYLYHAYPNENEGRL 73

Query: 72  SVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGG 131
           +    +LV  E   ++A +L L+  + +S+   K       SI AD VE++I A+Y+D G
Sbjct: 74  TRMRATLVRQEALGKIATDLQLSRCLILSTGELKSGGHHRESILADTVEAIIGAIYIDSG 133

Query: 132 -IEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
            + +    V K++      ++     +D K+ LQE+  A+    P Y+V    G      
Sbjct: 134 DLNLLTDIVLKWYVPYLDHIEPTDQLKDPKSRLQEYLQARKKPLPVYEVVDIQGDAPHQH 193

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           F V   I GL+   G   S+R AEQ AAAE+LK
Sbjct: 194 FKVECLIDGLSKIHGEGSSRRFAEQAAAAEILK 226


>gi|238920905|ref|YP_002934420.1| ribonuclease III [Edwardsiella ictaluri 93-146]
 gi|259491900|sp|C5B8Y2|RNC_EDWI9 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|238870474|gb|ACR70185.1| ribonuclease III, putative [Edwardsiella ictaluri 93-146]
          Length = 226

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 122/225 (54%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F    LL +ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPIVINRLQRKLGYTFRQHDLLMQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE DL   +R+     K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAEMAREFDLGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  +++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGIFLDSDIQTIERLILDWYRSRLEEISPGDKQKDPKTRLQEFLQGRHLPLPSYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SGL AP  G+  S+R AEQ AA + LK+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGLSAPVVGVGSSRRKAEQAAAEQALKQ 222


>gi|242309254|ref|ZP_04808409.1| ribonuclease 3 [Helicobacter pullorum MIT 98-5489]
 gi|239524295|gb|EEQ64161.1| ribonuclease 3 [Helicobacter pullorum MIT 98-5489]
          Length = 224

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/223 (35%), Positives = 119/223 (53%), Gaps = 7/223 (3%)

Query: 4   LRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           + ++  ++ +GY F N++LL++ALTH S   S     ERLEFLGD +L L+I   L+  F
Sbjct: 1   MDFNHFQQTLGYHFKNQNLLKEALTHKSAKKSTHN--ERLEFLGDAVLDLIIGEFLYKKF 58

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
            S+ EGELS    S+V+ +  +++AR L +  ++ +S    ++      SI ++  E++I
Sbjct: 59  PSSPEGELSKMRASMVNEKAFAKIARYLGIGEYLFISHSEEQNHGRDKDSILSNAFEAII 118

Query: 124 AALYLDGGIEVAGTFVDKYWK--QRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
            A+YL+ G+E     V K  +     +       D KT LQE   A FGV PEY V    
Sbjct: 119 GAIYLESGLEKVQKIVLKILEILYPKIDIQHLFYDHKTSLQELTQALFGVIPEYVVLDSK 178

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAA---EVLK 221
           GPDH+  F + V I G   A     SK+ A+Q  A    E+LK
Sbjct: 179 GPDHNKEFLIGVFIQGKEYAHASGKSKKEAQQNCAKIALEILK 221


>gi|261253900|ref|ZP_05946473.1| ribonuclease III [Vibrio orientalis CIP 102891]
 gi|260937291|gb|EEX93280.1| ribonuclease III [Vibrio orientalis CIP 102891]
          Length = 225

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 111/204 (54%), Gaps = 6/204 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LEK++GY F +  L+  ALTH S +  + E   RLEFLGD IL  +I+  L++ F    E
Sbjct: 8   LEKKLGYQFNDAELISLALTHRSANGKHNE---RLEFLGDSILSFVIADDLYHRFPKVNE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G++S    +LV   T +++ RE +L   +++     K       SI AD VE++I A+YL
Sbjct: 65  GDMSRMRATLVRGNTLAELGREFELGDHLKLGPGELKSGGFRRDSILADAVEAIIGAIYL 124

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  IEV    +  ++K R  A+K G  ++D KT LQE+   +    P Y VT   G  H+
Sbjct: 125 DSDIEVVRGIILSWYKTRLDAIKPGVSQKDPKTRLQEFLQGRRKPLPAYTVTNIKGEAHN 184

Query: 187 PRFTVVVEISGLA-PAQGMDCSKR 209
             FTV  E++G+  P  G   S+R
Sbjct: 185 QEFTVSCEVAGIGQPVIGKGTSRR 208


>gi|306819680|ref|ZP_07453341.1| ribonuclease III [Eubacterium yurii subsp. margaretiae ATCC 43715]
 gi|304552246|gb|EFM40176.1| ribonuclease III [Eubacterium yurii subsp. margaretiae ATCC 43715]
          Length = 233

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 120/219 (54%), Gaps = 6/219 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSI--SHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           +E  IGY F N++ L+ ALTHSS    H   +  ERLEFLGD +LGL++S  +F +  S 
Sbjct: 12  VENTIGYKFKNKNYLQIALTHSSYVNEHKLTKDNERLEFLGDSVLGLIVSNYIFAYKSSL 71

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           KEGEL+   +++V  ++   +A +L +  +I++    +    +   SI AD VE++IAA+
Sbjct: 72  KEGELTKIRSTIVCEKSLMHIAEKLKIGQYIKLGKGEKISGGAKRASILADAVEAMIAAI 131

Query: 127 YLDGGIEVAGTFVDKYWKQRALKS---GKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           YLD   +    +V   W    +K+    K   D K++LQE      G T +Y++    GP
Sbjct: 132 YLDSDFDNVSKYVLD-WLGDTIKNALDNKKNDDYKSKLQEEVQKVRGRTLKYELIAMKGP 190

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           DH+  FT+ V         G   SK+ AEQ+AA + L++
Sbjct: 191 DHERTFTIGVYCDNKLIGTGKGHSKKEAEQLAAKDALEK 229


>gi|315179118|gb|ADT86032.1| ribonuclease III [Vibrio furnissii NCTC 11218]
          Length = 202

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 77/200 (38%), Positives = 111/200 (55%), Gaps = 6/200 (3%)

Query: 26  ALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELSVRFNSLVSAETCS 85
           ALTH S +  + E   RLEFLGD IL  +I+  L++ F    EG++S    +LV   T +
Sbjct: 2   ALTHRSANGKHNE---RLEFLGDSILSFVIADDLYHRFPKVNEGDMSRMRATLVRGNTLA 58

Query: 86  QVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIEVAGTFVDKYWKQ 145
           ++ RE DL  ++++     K       SI AD VE++I A+YLD  IEVA   V  +++ 
Sbjct: 59  ELGREFDLGDYLKLGPGELKSGGFRRDSILADAVEAIIGAIYLDSDIEVARATVLSWYQS 118

Query: 146 R--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVVVEISGL-APAQ 202
           R  A+K G  ++D KT LQE+   +    P Y VT   G  H+  FTV  +I+G+ AP  
Sbjct: 119 RLEAIKPGVSQKDPKTRLQEFLQGRRKPLPVYTVTNIKGEAHNQEFTVACDIAGIGAPVI 178

Query: 203 GMDCSKRAAEQVAAAEVLKR 222
           G   S+R AEQ AA   L++
Sbjct: 179 GKGTSRRKAEQAAAETALEQ 198


>gi|242240203|ref|YP_002988384.1| ribonuclease III [Dickeya dadantii Ech703]
 gi|242132260|gb|ACS86562.1| ribonuclease III [Dickeya dadantii Ech703]
          Length = 226

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 122/225 (54%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L+K++GY F    LL +ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPILINRLQKKLGYTFQQYDLLLQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE +L   +R+     K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAEIAREFELGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     + K+++ R  A+  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGVFLDSDIQAVERLILKWYQSRLDAISPGDKQKDPKTRLQEFLQGRHLPLPTYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SG + P  G   S+R AEQ AA + LK+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGFSEPVVGTGSSRRKAEQAAAEQALKK 222


>gi|170754285|ref|YP_001781997.1| ribonuclease III [Clostridium botulinum B1 str. Okra]
 gi|169119497|gb|ACA43333.1| ribonuclease III [Clostridium botulinum B1 str. Okra]
          Length = 234

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 83/221 (37%), Positives = 122/221 (55%), Gaps = 6/221 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHFDSA 66
           L+ ++   F N  LL+ ALTHSS ++  +  + YERLEFLGD +L L+IS  L+  ++  
Sbjct: 11  LQYKLKVYFKNEKLLDVALTHSSYANGKRNIKYYERLEFLGDSVLQLIISEHLYQKYEDK 70

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           KEGEL+ +   +V   +  ++A+  DL  ++++S            SI AD VES+IAA+
Sbjct: 71  KEGELTRKRAIIVCENSLYEIAKRWDLGFYLQMSKGEELTGGRERVSILADCVESIIAAI 130

Query: 127 YLDGGIEVAGTFVDKYWK---QRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           YLD G++ A  FV K +K   ++A+K  +   D KT LQE       +T  Y++  + GP
Sbjct: 131 YLDKGLDHAREFVMKNFKEIIEKAMKD-EIILDYKTTLQEIVQQNNDLTINYELLKQEGP 189

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
            H  RF   V I       G+  SK+ AEQ AA E LK  G
Sbjct: 190 PHRRRFFTNVTIDNEVRGTGIGYSKKEAEQNAAREALKNLG 230


>gi|309789990|ref|ZP_07684566.1| ribonuclease III [Oscillochloris trichoides DG6]
 gi|308228010|gb|EFO81662.1| ribonuclease III [Oscillochloris trichoides DG6]
          Length = 235

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 80/222 (36%), Positives = 120/222 (54%), Gaps = 8/222 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSY------QESYERLEFLGDRILGLLISTLLFNH 62
           L++++G  F +  L  +A  H S  H +      +ES ERLEFLGD +L  L +  L+ +
Sbjct: 4   LQRQLGIRFNDEELFTRAFVHRSFIHEHPERNRPRESNERLEFLGDAVLNFLSAAWLYAN 63

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           F    EGEL+    +LV   T +  AR LDL   I++S      +     ++ ADV E+L
Sbjct: 64  FPDRTEGELTHLRAALVKTNTLAGFARSLDLGRHIKISRGEDTPIARNRPALLADVFEAL 123

Query: 123 IAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           + A+YLD G++   TF+  +++ +   + SG    D +T LQE A ++F  TP Y++   
Sbjct: 124 LGAIYLDQGLDAVRTFITPFFEHQIVVVLSGSDEVDYRTRLQEQAQSRFNRTPTYRMVDV 183

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           SGPDH   FT+ V I  +    G+  SK+AA Q AA E L R
Sbjct: 184 SGPDHQREFTMEVVIDEVRYGVGVGTSKQAAAQAAAREALNR 225


>gi|188527489|ref|YP_001910176.1| ribonuclease III [Helicobacter pylori Shi470]
 gi|238691923|sp|B2UTG4|RNC_HELPS RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|188143729|gb|ACD48146.1| ribonuclease III [Helicobacter pylori Shi470]
          Length = 238

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 122/221 (55%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y+TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 17  YATLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 74

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VSA   +++A+ + L  ++ +SS           SI +   E+L+A 
Sbjct: 75  YDEGKLSKLRASIVSAHGFTKLAKVIALQDYLHISSSEEISNGREKPSILSSAFEALMAG 134

Query: 126 LYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+    ++    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 135 VYLEAGLAKVQKIIQNLLNRAYKRLDLEH--LFMDYKTALQELTQAQFCVIPTYQLLKEK 192

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F + + I     A     SK+ AEQ  A + L++
Sbjct: 193 GPDHHKEFEMALYIQDKIYATAKGKSKKEAEQQCAYQALQK 233


>gi|300717987|ref|YP_003742790.1| ribonuclease III [Erwinia billingiae Eb661]
 gi|299063823|emb|CAX60943.1| Ribonuclease III [Erwinia billingiae Eb661]
          Length = 226

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 124/228 (54%), Gaps = 6/228 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F ++ LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPIVITRLQRKLGYTFTHQELLQQALTHRSASSKHNE---RLEFLGDSILSYVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F    EG++S    +LV   T +++ARE DL   +R+     K       SI AD VE
Sbjct: 58  QRFPRVDEGDMSRMRATLVRGNTLAEMAREFDLGECLRLGPGELKSGGYRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     + +++  R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGVFLDSDIQNVEKLILEWYASRLEQISPGDKQKDPKTRLQEYLQGRHLPLPSYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKREGI 225
              G  HD  FT+  ++SG+A P  G   S+R AEQ AA + L + G+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGMAEPVVGTGSSRRKAEQAAAEQALIKLGL 225


>gi|78485079|ref|YP_391004.1| ribonuclease III [Thiomicrospira crunogena XCL-2]
 gi|78363365|gb|ABB41330.1| RNAse III [Thiomicrospira crunogena XCL-2]
          Length = 233

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 118/219 (53%), Gaps = 6/219 (2%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFD 64
           + + L K +GY + N   L++ALTH S+     ++ ERLEFLGD ++  +I+  LF+ F 
Sbjct: 9   KLNRLSKSLGYQYKNIEFLQRALTHRSMG---AKNNERLEFLGDSLVNFMIADALFHQFH 65

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EG+LS     LV  ET +++ +E  L+ ++ +     K       SI AD VE++IA
Sbjct: 66  KISEGDLSRIRAFLVKGETLAKIGKEYQLSDYLMLGPGELKSGGYRRESIIADTVEAIIA 125

Query: 125 ALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           ++Y DGG++    FV + ++ R   L   K  +D KT LQE+  +     PEY V   +G
Sbjct: 126 SVYEDGGLDACRAFVMRLYENRLKELDPSKIGKDPKTRLQEFLQSNREQLPEYSVMTVNG 185

Query: 183 PDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVL 220
           P H   FTV   ++ L    +    ++R AEQVAA E L
Sbjct: 186 PAHAQEFTVSCYVAKLNRKFEATATNRRKAEQVAAQEAL 224


>gi|308184450|ref|YP_003928583.1| ribonuclease III [Helicobacter pylori SJM180]
 gi|308060370|gb|ADO02266.1| ribonuclease III [Helicobacter pylori SJM180]
          Length = 239

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 81/220 (36%), Positives = 116/220 (52%), Gaps = 6/220 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 18  YLTLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 75

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VSA   +++A+ + L  ++ VSS           SI +   E+L+A 
Sbjct: 76  YDEGKLSKLRASIVSAHGFTKLAKAISLQDYLHVSSSEEISKGREKPSILSSAFEALMAG 135

Query: 126 LYLDGGIEVAGTFVDKYWKQRALKSGKFRR---DAKTELQEWAHAKFGVTPEYKVTFRSG 182
           +YL+ G+      + K    RA K         D KT LQE   A+F V P Y++    G
Sbjct: 136 VYLEAGLAKVRKIIQKLL-NRAYKRLDLEHLFMDYKTALQELTQAQFCVIPTYQLLKEKG 194

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           PDH   F + + I     A     SK+ AEQ  A + L++
Sbjct: 195 PDHHKEFEMALYIQDKIYATAKGKSKKEAEQQCAYQALQK 234


>gi|296120504|ref|YP_003628282.1| ribonuclease III [Planctomyces limnophilus DSM 3776]
 gi|296012844|gb|ADG66083.1| ribonuclease III [Planctomyces limnophilus DSM 3776]
          Length = 263

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 117/216 (54%), Gaps = 9/216 (4%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           E R+GY F +  LL +AL+H+S + +  ES ERLEFLGD ILG  +  LLF  +  + EG
Sbjct: 14  EARLGYHFRSPELLMQALSHASAAKTRLESNERLEFLGDAILGAAVCDLLFRKYPKSTEG 73

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVC---SFMTSIQADVVESLIAAL 126
           EL+   + +VS   C  +A+EL L  F+ +     K +C   +   SI +   ES+IAA+
Sbjct: 74  ELTRIKSFVVSRHVCGLLAKELHLDQFVIIG----KGLCGTPNVPVSILSATFESVIAAV 129

Query: 127 YLDGGIEVAGTFVDKYWKQRA--LKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           +LDGG + A  F+ +  +     +   ++ R+ K+ LQ++A    G TP Y +    GPD
Sbjct: 130 FLDGGFDAAKEFIIRLIEPHVEQMVGAEYGRNYKSVLQQYAQKTLGETPRYDLLKEYGPD 189

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
           H   F V   +  +  A     +K+ AEQ AAA  L
Sbjct: 190 HLKYFKVSAALGEVVYAAAWGINKKEAEQKAAANAL 225


>gi|224532223|ref|ZP_03672855.1| ribonuclease III [Borrelia valaisiana VS116]
 gi|224511688|gb|EEF82094.1| ribonuclease III [Borrelia valaisiana VS116]
          Length = 245

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 114/212 (53%), Gaps = 9/212 (4%)

Query: 17  FANRSLLEKALTHSSISHSYQE---SYERLEFLGDRILGLLISTLLFNHFDSAKEGELSV 73
           F N  LL  AL+HSS S+   +   + ERLEFLGD +L L+I+  L+  + +  EGELS 
Sbjct: 29  FNNFDLLNTALSHSSYSNELDQKSGNNERLEFLGDSVLNLIITDHLYKTYPNKSEGELSK 88

Query: 74  RFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIE 133
             + +VS ++ S +ARE+DL S+I +      +       I AD +E+ + A+YLD G  
Sbjct: 89  ARSYIVSEDSLSNIAREIDLGSYILLGRGEESNDGRNKKGILADAIEAFVGAIYLDSGFS 148

Query: 134 VAGTFV----DKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
           VA  FV    D Y +      G F +D K+ LQE+   K+ ++P YK+    GPDHD  F
Sbjct: 149 VATEFVVGLFDMYIR-LMFNRGDF-KDYKSLLQEYIQKKYKISPSYKLDKEIGPDHDKVF 206

Query: 190 TVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
            V + +     + G   SK+ AE  AA   LK
Sbjct: 207 CVELYVGEKFISNGKGKSKKEAEMRAAEVALK 238


>gi|296104242|ref|YP_003614388.1| ribonuclease III [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|295058701|gb|ADF63439.1| ribonuclease III [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 239

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 123/224 (54%), Gaps = 6/224 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F ++ LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 14  MNPIVINRLQRKLGYTFHHQELLQQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 70

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE +L   +R+     K       SI AD VE
Sbjct: 71  HRFPRVDEGDMSRMRATLVRGNTLAEIAREFELGECLRLGPGELKSGGFRRESILADTVE 130

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  +++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 131 ALIGGVFLDSDIQTVEKLILNWYQTRLDEISPGDKQKDPKTRLQEYLQGRHLPLPSYLVV 190

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLK 221
              G  HD  FT+  ++SGL+ P  G   S+R AEQ AA + LK
Sbjct: 191 QVRGEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAAAEQALK 234


>gi|170761820|ref|YP_001787766.1| ribonuclease III [Clostridium botulinum A3 str. Loch Maree]
 gi|169408809|gb|ACA57220.1| ribonuclease III [Clostridium botulinum A3 str. Loch Maree]
          Length = 234

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 83/221 (37%), Positives = 122/221 (55%), Gaps = 6/221 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHFDSA 66
           L+ ++   F N  LL+ ALTHSS ++  +  + YERLEFLGD +L L+IS  L+  ++  
Sbjct: 11  LQYKLKVYFKNEKLLDVALTHSSYANGKKNIKYYERLEFLGDSVLQLIISEHLYQKYEDK 70

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           KEGEL+ +   +V   +  ++A+  DL  ++++S            SI AD VES+IAA+
Sbjct: 71  KEGELTRKRAIIVCENSLYEIAKRWDLGFYLQMSKGEELTGGRERVSILADCVESIIAAI 130

Query: 127 YLDGGIEVAGTFVDKYWK---QRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           YLD G++ A  FV K +K   ++A+K  +   D KT LQE       +T  Y++  + GP
Sbjct: 131 YLDKGLDHAREFVMKNFKEIIEKAMKD-EIILDYKTTLQEIVQQNNDLTINYELLKQEGP 189

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
            H  RF   V I       G+  SK+ AEQ AA E LK  G
Sbjct: 190 PHRRRFFTNVTIDNEIRGTGIGYSKKEAEQNAAREALKNLG 230


>gi|92113755|ref|YP_573683.1| ribonuclease III [Chromohalobacter salexigens DSM 3043]
 gi|91796845|gb|ABE58984.1| RNAse III [Chromohalobacter salexigens DSM 3043]
          Length = 226

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 83/216 (38%), Positives = 117/216 (54%), Gaps = 6/216 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L +RIGY F + S LE ALTH S      ++ ERLEFLGD I+  +I   LF  F  A+E
Sbjct: 4   LSRRIGYQFRDTSRLELALTHRSYGG---KNNERLEFLGDSIVNFVIGEALFQRFPQARE 60

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS     LV  +T +++ARE +L   +R+ S   K       SI AD VE+LI A+YL
Sbjct: 61  GQLSRLRARLVKGQTLAELAREFELGECLRLGSGEMKSGGYRRDSILADGVEALIGAIYL 120

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D G++VA   V  ++  R  A+     ++D KT LQE+  ++    P Y+V    G  H 
Sbjct: 121 DAGMDVAKARVLSWYATRLEAIDLQDNQKDPKTRLQEFLQSRQAALPRYEVVSVEGEAHA 180

Query: 187 PRFTVVVEISGLAPAQ-GMDCSKRAAEQVAAAEVLK 221
             FT+   +  L     G+  S+R AEQ AA + L+
Sbjct: 181 QVFTIECHVEMLEDHTLGVGSSRRHAEQQAAEKALE 216


>gi|57238646|ref|YP_179777.1| ribonuclease III [Campylobacter jejuni RM1221]
 gi|81353160|sp|Q5HSF8|RNC_CAMJR RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|57167450|gb|AAW36229.1| ribonuclease III [Campylobacter jejuni RM1221]
 gi|315059085|gb|ADT73414.1| Ribonuclease III [Campylobacter jejuni subsp. jejuni S3]
          Length = 224

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 76/220 (34%), Positives = 123/220 (55%), Gaps = 8/220 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE+ + Y F +++LL  ALTH S   SY    ERLEFLGD +L L++   LF+ F    E
Sbjct: 7   LERSLTYEFKDKNLLIHALTHKSFKKSYNN--ERLEFLGDAVLDLVVGEYLFHKFAKDAE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV+ ++ +++A  L+L  FI +S     +      SI +D +E++I A++L
Sbjct: 65  GDLSKLRAALVNEKSFAKIANSLNLGDFIFMSVAEENNGGREKPSILSDALEAIIGAIHL 124

Query: 129 DGGIEVAGT----FVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           + G E   T     ++K + Q  + +    +D KT+LQE    K G TP+Y+     GPD
Sbjct: 125 EAGFEFTKTIALRLIEKNFPQ--IDAKILIKDYKTKLQEITQGKIGQTPQYETVRAFGPD 182

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           H  +F + + + G   A+ +  SK+ A+Q+AA   L++ G
Sbjct: 183 HLKQFEIALMLDGKELARAIAGSKKEAQQMAAKIALEKLG 222


>gi|15803093|ref|NP_289124.1| ribonuclease III [Escherichia coli O157:H7 EDL933]
 gi|15832687|ref|NP_311460.1| ribonuclease III [Escherichia coli O157:H7 str. Sakai]
 gi|16130492|ref|NP_417062.1| RNase III [Escherichia coli str. K-12 substr. MG1655]
 gi|24113909|ref|NP_708419.1| ribonuclease III [Shigella flexneri 2a str. 301]
 gi|26248932|ref|NP_754972.1| ribonuclease III [Escherichia coli CFT073]
 gi|30063969|ref|NP_838140.1| ribonuclease III [Shigella flexneri 2a str. 2457T]
 gi|74313129|ref|YP_311548.1| ribonuclease III [Shigella sonnei Ss046]
 gi|82545019|ref|YP_408966.1| ribonuclease III [Shigella boydii Sb227]
 gi|82777993|ref|YP_404342.1| ribonuclease III [Shigella dysenteriae Sd197]
 gi|89109373|ref|AP_003153.1| RNase III [Escherichia coli str. K-12 substr. W3110]
 gi|91211893|ref|YP_541879.1| ribonuclease III [Escherichia coli UTI89]
 gi|110642729|ref|YP_670459.1| ribonuclease III [Escherichia coli 536]
 gi|110806512|ref|YP_690032.1| ribonuclease III [Shigella flexneri 5 str. 8401]
 gi|117624788|ref|YP_853701.1| ribonuclease III [Escherichia coli APEC O1]
 gi|157157389|ref|YP_001463890.1| ribonuclease III [Escherichia coli E24377A]
 gi|157162046|ref|YP_001459364.1| ribonuclease III [Escherichia coli HS]
 gi|168748363|ref|ZP_02773385.1| ribonuclease III [Escherichia coli O157:H7 str. EC4113]
 gi|168761188|ref|ZP_02786195.1| ribonuclease III [Escherichia coli O157:H7 str. EC4501]
 gi|168778544|ref|ZP_02803551.1| ribonuclease III [Escherichia coli O157:H7 str. EC4076]
 gi|168787927|ref|ZP_02812934.1| ribonuclease III [Escherichia coli O157:H7 str. EC869]
 gi|170019150|ref|YP_001724104.1| ribonuclease III [Escherichia coli ATCC 8739]
 gi|170082176|ref|YP_001731496.1| RNase III [Escherichia coli str. K-12 substr. DH10B]
 gi|170680897|ref|YP_001744756.1| ribonuclease III [Escherichia coli SMS-3-5]
 gi|170767161|ref|ZP_02901614.1| ribonuclease III [Escherichia albertii TW07627]
 gi|187732795|ref|YP_001881346.1| ribonuclease III [Shigella boydii CDC 3083-94]
 gi|187775820|ref|ZP_02992726.1| ribonuclease III [Escherichia coli O157:H7 str. EC4196]
 gi|188492722|ref|ZP_02999992.1| ribonuclease III [Escherichia coli 53638]
 gi|189402493|ref|ZP_03006738.1| ribonuclease III [Escherichia coli O157:H7 str. EC4401]
 gi|189403151|ref|ZP_03006973.1| ribonuclease III [Escherichia coli O157:H7 str. EC4486]
 gi|189405744|ref|ZP_02823956.2| ribonuclease III [Escherichia coli O157:H7 str. EC508]
 gi|191167987|ref|ZP_03029789.1| ribonuclease III [Escherichia coli B7A]
 gi|191174016|ref|ZP_03035533.1| ribonuclease III [Escherichia coli F11]
 gi|193064102|ref|ZP_03045187.1| ribonuclease III [Escherichia coli E22]
 gi|193068346|ref|ZP_03049309.1| ribonuclease III [Escherichia coli E110019]
 gi|194429263|ref|ZP_03061790.1| ribonuclease III [Escherichia coli B171]
 gi|194432095|ref|ZP_03064384.1| ribonuclease III [Shigella dysenteriae 1012]
 gi|194437570|ref|ZP_03069666.1| ribonuclease III [Escherichia coli 101-1]
 gi|195936714|ref|ZP_03082096.1| ribonuclease III [Escherichia coli O157:H7 str. EC4024]
 gi|208807620|ref|ZP_03249957.1| ribonuclease III [Escherichia coli O157:H7 str. EC4206]
 gi|208811958|ref|ZP_03253287.1| ribonuclease III [Escherichia coli O157:H7 str. EC4045]
 gi|208820348|ref|ZP_03260668.1| ribonuclease III [Escherichia coli O157:H7 str. EC4042]
 gi|209400787|ref|YP_002272042.1| ribonuclease III [Escherichia coli O157:H7 str. EC4115]
 gi|209920046|ref|YP_002294130.1| ribonuclease III [Escherichia coli SE11]
 gi|215487911|ref|YP_002330342.1| ribonuclease III [Escherichia coli O127:H6 str. E2348/69]
 gi|217327524|ref|ZP_03443607.1| ribonuclease III [Escherichia coli O157:H7 str. TW14588]
 gi|218547905|ref|YP_002381696.1| ribonuclease III [Escherichia fergusonii ATCC 35469]
 gi|218555148|ref|YP_002388061.1| ribonuclease III [Escherichia coli IAI1]
 gi|218559488|ref|YP_002392401.1| ribonuclease III [Escherichia coli S88]
 gi|218690683|ref|YP_002398895.1| ribonuclease III [Escherichia coli ED1a]
 gi|218696195|ref|YP_002403862.1| ribonuclease III [Escherichia coli 55989]
 gi|218701081|ref|YP_002408710.1| ribonuclease III [Escherichia coli IAI39]
 gi|218706071|ref|YP_002413590.1| ribonuclease III [Escherichia coli UMN026]
 gi|237705077|ref|ZP_04535558.1| ribonuclease III [Escherichia sp. 3_2_53FAA]
 gi|238901732|ref|YP_002927528.1| RNase III [Escherichia coli BW2952]
 gi|253772534|ref|YP_003035365.1| ribonuclease III [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254162542|ref|YP_003045650.1| ribonuclease III [Escherichia coli B str. REL606]
 gi|254794517|ref|YP_003079354.1| ribonuclease III [Escherichia coli O157:H7 str. TW14359]
 gi|256017284|ref|ZP_05431149.1| ribonuclease III [Shigella sp. D9]
 gi|256021747|ref|ZP_05435612.1| ribonuclease III [Escherichia sp. 4_1_40B]
 gi|260845252|ref|YP_003223030.1| RNase III [Escherichia coli O103:H2 str. 12009]
 gi|260856661|ref|YP_003230552.1| RNase III [Escherichia coli O26:H11 str. 11368]
 gi|260869254|ref|YP_003235656.1| RNase III [Escherichia coli O111:H- str. 11128]
 gi|261222997|ref|ZP_05937278.1| RNase III [Escherichia coli O157:H7 str. FRIK2000]
 gi|261259452|ref|ZP_05951985.1| RNase III [Escherichia coli O157:H7 str. FRIK966]
 gi|291283842|ref|YP_003500660.1| Ribonuclease 3 [Escherichia coli O55:H7 str. CB9615]
 gi|297516306|ref|ZP_06934692.1| ribonuclease III [Escherichia coli OP50]
 gi|307139203|ref|ZP_07498559.1| ribonuclease III [Escherichia coli H736]
 gi|307313862|ref|ZP_07593478.1| ribonuclease III [Escherichia coli W]
 gi|309784618|ref|ZP_07679253.1| ribonuclease III [Shigella dysenteriae 1617]
 gi|312965483|ref|ZP_07779715.1| ribonuclease III [Escherichia coli 2362-75]
 gi|312973187|ref|ZP_07787359.1| ribonuclease III [Escherichia coli 1827-70]
 gi|331643191|ref|ZP_08344326.1| ribonuclease III [Escherichia coli H736]
 gi|331648313|ref|ZP_08349402.1| ribonuclease III [Escherichia coli M605]
 gi|331654029|ref|ZP_08355030.1| ribonuclease III [Escherichia coli M718]
 gi|331658711|ref|ZP_08359655.1| ribonuclease III [Escherichia coli TA206]
 gi|331664135|ref|ZP_08365045.1| ribonuclease III [Escherichia coli TA143]
 gi|331669317|ref|ZP_08370165.1| ribonuclease III [Escherichia coli TA271]
 gi|331674016|ref|ZP_08374779.1| ribonuclease III [Escherichia coli TA280]
 gi|331678563|ref|ZP_08379238.1| ribonuclease III [Escherichia coli H591]
 gi|331684217|ref|ZP_08384813.1| ribonuclease III [Escherichia coli H299]
 gi|332278275|ref|ZP_08390688.1| ribonuclease III [Shigella sp. D9]
 gi|67472282|sp|P0A7Y0|RNC_ECOLI RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|67472283|sp|P0A7Y1|RNC_ECOL6 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|67472284|sp|P0A7Y2|RNC_ECO57 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|67472285|sp|P0A7Y3|RNC_SHIFL RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|90101643|sp|Q31XS0|RNC_SHIBS RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|90101644|sp|Q32CV4|RNC_SHIDS RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|90101645|sp|Q3YYU9|RNC_SHISS RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|122422869|sp|Q1R8G6|RNC_ECOUT RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|122958122|sp|Q0TES1|RNC_ECOL5 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|123048003|sp|Q0T1T8|RNC_SHIF8 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|189043309|sp|A7ZQ11|RNC_ECO24 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|189043310|sp|A8A377|RNC_ECOHS RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|189043311|sp|A1AE97|RNC_ECOK1 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|189043312|sp|B1IVR0|RNC_ECOLC RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|226735371|sp|B7MIQ2|RNC_ECO45 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|226735372|sp|B7NRM0|RNC_ECO7I RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|226735373|sp|B7M8I0|RNC_ECO8A RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|226735374|sp|B7N6F5|RNC_ECOLU RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|226735375|sp|B1LP80|RNC_ECOSM RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|226735376|sp|B7LUZ7|RNC_ESCF3 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|226741369|sp|B5Z141|RNC_ECO5E RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|226741370|sp|B6I5E1|RNC_ECOSE RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|229564359|sp|B1XB41|RNC_ECODH RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|238691723|sp|B2TXY0|RNC_SHIB3 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|254807247|sp|B7UH07|RNC_ECO27 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|254807248|sp|B7LDG0|RNC_ECO55 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|254807249|sp|B7MYJ8|RNC_ECO81 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|259491899|sp|C4ZYJ0|RNC_ECOBW RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|12516984|gb|AAG57682.1|AE005487_6 RNase III, ds RNA [Escherichia coli O157:H7 str. EDL933]
 gi|26109338|gb|AAN81540.1|AE016764_222 Ribonuclease III [Escherichia coli CFT073]
 gi|42769|emb|CAA26692.1| unnamed protein product [Escherichia coli]
 gi|987642|dbj|BAA10914.1| ribonuclease III [Escherichia coli K-12]
 gi|1033156|gb|AAA79829.1| RNase III [Escherichia coli str. K-12 substr. MG1655]
 gi|1788920|gb|AAC75620.1| RNase III [Escherichia coli str. K-12 substr. MG1655]
 gi|13362904|dbj|BAB36856.1| RNase III [Escherichia coli O157:H7 str. Sakai]
 gi|24053010|gb|AAN44126.1| RNase III [Shigella flexneri 2a str. 301]
 gi|30042225|gb|AAP17950.1| RNase III [Shigella flexneri 2a str. 2457T]
 gi|73856606|gb|AAZ89313.1| RNase III [Shigella sonnei Ss046]
 gi|81242141|gb|ABB62851.1| RNase III, ds RNA [Shigella dysenteriae Sd197]
 gi|81246430|gb|ABB67138.1| RNase III [Shigella boydii Sb227]
 gi|85675458|dbj|BAE76743.1| RNase III [Escherichia coli str. K12 substr. W3110]
 gi|91073467|gb|ABE08348.1| RNase III, ds RNA [Escherichia coli UTI89]
 gi|110344321|gb|ABG70558.1| ribonuclease III [Escherichia coli 536]
 gi|110616060|gb|ABF04727.1| RNase III, ds RNA [Shigella flexneri 5 str. 8401]
 gi|115513912|gb|ABJ01987.1| RNase III [Escherichia coli APEC O1]
 gi|157067726|gb|ABV06981.1| ribonuclease III [Escherichia coli HS]
 gi|157079419|gb|ABV19127.1| ribonuclease III [Escherichia coli E24377A]
 gi|169754078|gb|ACA76777.1| Ribonuclease III [Escherichia coli ATCC 8739]
 gi|169890011|gb|ACB03718.1| RNase III [Escherichia coli str. K-12 substr. DH10B]
 gi|170123495|gb|EDS92426.1| ribonuclease III [Escherichia albertii TW07627]
 gi|170518615|gb|ACB16793.1| ribonuclease III [Escherichia coli SMS-3-5]
 gi|187429787|gb|ACD09061.1| ribonuclease III [Shigella boydii CDC 3083-94]
 gi|187770609|gb|EDU34453.1| ribonuclease III [Escherichia coli O157:H7 str. EC4196]
 gi|188017132|gb|EDU55254.1| ribonuclease III [Escherichia coli O157:H7 str. EC4113]
 gi|188487921|gb|EDU63024.1| ribonuclease III [Escherichia coli 53638]
 gi|189003491|gb|EDU72477.1| ribonuclease III [Escherichia coli O157:H7 str. EC4076]
 gi|189355317|gb|EDU73736.1| ribonuclease III [Escherichia coli O157:H7 str. EC4401]
 gi|189362280|gb|EDU80699.1| ribonuclease III [Escherichia coli O157:H7 str. EC4486]
 gi|189368381|gb|EDU86797.1| ribonuclease III [Escherichia coli O157:H7 str. EC4501]
 gi|189372250|gb|EDU90666.1| ribonuclease III [Escherichia coli O157:H7 str. EC869]
 gi|189378654|gb|EDU97070.1| ribonuclease III [Escherichia coli O157:H7 str. EC508]
 gi|190901994|gb|EDV61741.1| ribonuclease III [Escherichia coli B7A]
 gi|190905707|gb|EDV65329.1| ribonuclease III [Escherichia coli F11]
 gi|192929337|gb|EDV82946.1| ribonuclease III [Escherichia coli E22]
 gi|192958298|gb|EDV88738.1| ribonuclease III [Escherichia coli E110019]
 gi|194412671|gb|EDX28966.1| ribonuclease III [Escherichia coli B171]
 gi|194419624|gb|EDX35704.1| ribonuclease III [Shigella dysenteriae 1012]
 gi|194423376|gb|EDX39367.1| ribonuclease III [Escherichia coli 101-1]
 gi|208727421|gb|EDZ77022.1| ribonuclease III [Escherichia coli O157:H7 str. EC4206]
 gi|208733235|gb|EDZ81922.1| ribonuclease III [Escherichia coli O157:H7 str. EC4045]
 gi|208740471|gb|EDZ88153.1| ribonuclease III [Escherichia coli O157:H7 str. EC4042]
 gi|209162187|gb|ACI39620.1| ribonuclease III [Escherichia coli O157:H7 str. EC4115]
 gi|209762878|gb|ACI79751.1| RNase III [Escherichia coli]
 gi|209762880|gb|ACI79752.1| RNase III [Escherichia coli]
 gi|209762882|gb|ACI79753.1| RNase III [Escherichia coli]
 gi|209762884|gb|ACI79754.1| RNase III [Escherichia coli]
 gi|209762886|gb|ACI79755.1| RNase III [Escherichia coli]
 gi|209913305|dbj|BAG78379.1| ribonuclease III [Escherichia coli SE11]
 gi|215265983|emb|CAS10392.1| RNase III [Escherichia coli O127:H6 str. E2348/69]
 gi|217319891|gb|EEC28316.1| ribonuclease III [Escherichia coli O157:H7 str. TW14588]
 gi|218352927|emb|CAU98726.1| RNase III [Escherichia coli 55989]
 gi|218355446|emb|CAQ88055.1| RNase III [Escherichia fergusonii ATCC 35469]
 gi|218361916|emb|CAQ99516.1| RNase III [Escherichia coli IAI1]
 gi|218366257|emb|CAR04004.1| RNase III [Escherichia coli S88]
 gi|218371067|emb|CAR18894.1| RNase III [Escherichia coli IAI39]
 gi|218428247|emb|CAR09164.2| RNase III [Escherichia coli ED1a]
 gi|218433168|emb|CAR14064.1| RNase III [Escherichia coli UMN026]
 gi|222034272|emb|CAP77013.1| ribonuclease 3 [Escherichia coli LF82]
 gi|226901443|gb|EEH87702.1| ribonuclease III [Escherichia sp. 3_2_53FAA]
 gi|238863504|gb|ACR65502.1| RNase III [Escherichia coli BW2952]
 gi|242378168|emb|CAQ32942.1| RNase III [Escherichia coli BL21(DE3)]
 gi|253323578|gb|ACT28180.1| ribonuclease III [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253974443|gb|ACT40114.1| ribonuclease III [Escherichia coli B str. REL606]
 gi|253978610|gb|ACT44280.1| ribonuclease III [Escherichia coli BL21(DE3)]
 gi|254593917|gb|ACT73278.1| RNase III [Escherichia coli O157:H7 str. TW14359]
 gi|257755310|dbj|BAI26812.1| RNase III [Escherichia coli O26:H11 str. 11368]
 gi|257760399|dbj|BAI31896.1| RNase III [Escherichia coli O103:H2 str. 12009]
 gi|257765610|dbj|BAI37105.1| RNase III [Escherichia coli O111:H- str. 11128]
 gi|260448353|gb|ACX38775.1| Ribonuclease III [Escherichia coli DH1]
 gi|281179616|dbj|BAI55946.1| ribonuclease III [Escherichia coli SE15]
 gi|281601980|gb|ADA74964.1| Ribonuclease 3 [Shigella flexneri 2002017]
 gi|284922517|emb|CBG35604.1| Ribonuclease III [Escherichia coli 042]
 gi|290763715|gb|ADD57676.1| Ribonuclease 3 [Escherichia coli O55:H7 str. CB9615]
 gi|294490667|gb|ADE89423.1| ribonuclease III [Escherichia coli IHE3034]
 gi|306906363|gb|EFN36878.1| ribonuclease III [Escherichia coli W]
 gi|307554586|gb|ADN47361.1| ribonuclease III [Escherichia coli ABU 83972]
 gi|307625885|gb|ADN70189.1| ribonuclease III [Escherichia coli UM146]
 gi|308927515|gb|EFP72987.1| ribonuclease III [Shigella dysenteriae 1617]
 gi|309702953|emb|CBJ02284.1| Ribonuclease III [Escherichia coli ETEC H10407]
 gi|310331782|gb|EFP99017.1| ribonuclease III [Escherichia coli 1827-70]
 gi|312289903|gb|EFR17791.1| ribonuclease III [Escherichia coli 2362-75]
 gi|312947138|gb|ADR27965.1| ribonuclease III [Escherichia coli O83:H1 str. NRG 857C]
 gi|315061886|gb|ADT76213.1| RNase III [Escherichia coli W]
 gi|315137191|dbj|BAJ44350.1| RNase III [Escherichia coli DH1]
 gi|315615829|gb|EFU96461.1| ribonuclease III [Escherichia coli 3431]
 gi|320182108|gb|EFW57012.1| Ribonuclease III [Shigella boydii ATCC 9905]
 gi|320186366|gb|EFW61100.1| Ribonuclease III [Shigella flexneri CDC 796-83]
 gi|320188908|gb|EFW63567.1| Ribonuclease III [Escherichia coli O157:H7 str. EC1212]
 gi|320196403|gb|EFW71027.1| Ribonuclease III [Escherichia coli WV_060327]
 gi|320200131|gb|EFW74720.1| Ribonuclease III [Escherichia coli EC4100B]
 gi|320640816|gb|EFX10310.1| ribonuclease III [Escherichia coli O157:H7 str. G5101]
 gi|320646162|gb|EFX15102.1| ribonuclease III [Escherichia coli O157:H- str. 493-89]
 gi|320651457|gb|EFX19853.1| ribonuclease III [Escherichia coli O157:H- str. H 2687]
 gi|320657058|gb|EFX24877.1| ribonuclease III [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320667543|gb|EFX34463.1| ribonuclease III [Escherichia coli O157:H7 str. LSU-61]
 gi|323159224|gb|EFZ45214.1| ribonuclease III [Escherichia coli E128010]
 gi|323167799|gb|EFZ53494.1| ribonuclease III [Shigella sonnei 53G]
 gi|323184553|gb|EFZ69927.1| ribonuclease III [Escherichia coli 1357]
 gi|323188318|gb|EFZ73610.1| ribonuclease III [Escherichia coli RN587/1]
 gi|323377533|gb|ADX49801.1| ribonuclease III [Escherichia coli KO11]
 gi|323936307|gb|EGB32598.1| ribonuclease III [Escherichia coli E1520]
 gi|323941170|gb|EGB37355.1| ribonuclease III [Escherichia coli E482]
 gi|323944624|gb|EGB40692.1| ribonuclease III [Escherichia coli H120]
 gi|323949221|gb|EGB45112.1| ribonuclease III [Escherichia coli H252]
 gi|323955803|gb|EGB51561.1| ribonuclease III [Escherichia coli H263]
 gi|323961182|gb|EGB56795.1| ribonuclease III [Escherichia coli H489]
 gi|323968015|gb|EGB63427.1| ribonuclease III [Escherichia coli M863]
 gi|323971107|gb|EGB66354.1| ribonuclease III [Escherichia coli TA007]
 gi|323978403|gb|EGB73488.1| ribonuclease III [Escherichia coli TW10509]
 gi|324113094|gb|EGC07070.1| ribonuclease III [Escherichia fergusonii B253]
 gi|324118223|gb|EGC12119.1| ribonuclease III [Escherichia coli E1167]
 gi|325496353|gb|EGC94212.1| ribonuclease III [Escherichia fergusonii ECD227]
 gi|326340373|gb|EGD64177.1| Ribonuclease III [Escherichia coli O157:H7 str. 1125]
 gi|327252277|gb|EGE63949.1| ribonuclease III [Escherichia coli STEC_7v]
 gi|330912336|gb|EGH40846.1| ribonuclease 3 [Escherichia coli AA86]
 gi|331039989|gb|EGI12209.1| ribonuclease III [Escherichia coli H736]
 gi|331042862|gb|EGI15003.1| ribonuclease III [Escherichia coli M605]
 gi|331048878|gb|EGI20954.1| ribonuclease III [Escherichia coli M718]
 gi|331054376|gb|EGI26403.1| ribonuclease III [Escherichia coli TA206]
 gi|331059934|gb|EGI31911.1| ribonuclease III [Escherichia coli TA143]
 gi|331064511|gb|EGI36422.1| ribonuclease III [Escherichia coli TA271]
 gi|331069289|gb|EGI40681.1| ribonuclease III [Escherichia coli TA280]
 gi|331075023|gb|EGI46343.1| ribonuclease III [Escherichia coli H591]
 gi|331079169|gb|EGI50371.1| ribonuclease III [Escherichia coli H299]
 gi|332088079|gb|EGI93204.1| ribonuclease III [Shigella boydii 5216-82]
 gi|332089189|gb|EGI94296.1| ribonuclease III [Shigella dysenteriae 155-74]
 gi|332100627|gb|EGJ03973.1| ribonuclease III [Shigella sp. D9]
 gi|332344442|gb|AEE57776.1| ribonuclease III [Escherichia coli UMNK88]
 gi|332753976|gb|EGJ84350.1| ribonuclease III [Shigella flexneri 4343-70]
 gi|332755808|gb|EGJ86166.1| ribonuclease III [Shigella flexneri 2747-71]
 gi|332761960|gb|EGJ92233.1| ribonuclease III [Shigella flexneri K-671]
 gi|332766568|gb|EGJ96773.1| ribonuclease III [Shigella flexneri 2930-71]
          Length = 226

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/225 (35%), Positives = 124/225 (55%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F ++ LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPIVINRLQRKLGYTFNHQELLQQALTHRSASSKHNE---RLEFLGDSILSYVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE +L   +R+     K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAELAREFELGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  +++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGVFLDSDIQTVEKLILNWYQTRLDEISPGDKQKDPKTRLQEYLQGRHLPLPTYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SGL+ P  G   S+R AEQ AA + LK+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAAAEQALKK 222


>gi|152978261|ref|YP_001343890.1| ribonuclease III [Actinobacillus succinogenes 130Z]
 gi|189043288|sp|A6VLV8|RNC_ACTSZ RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|150839984|gb|ABR73955.1| Ribonuclease III [Actinobacillus succinogenes 130Z]
          Length = 224

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 119/216 (55%), Gaps = 6/216 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L+ +IGY F+N +LL++ALTH S +  + E   RLEFLGD IL L I   L+  F    E
Sbjct: 7   LQHKIGYEFSNLTLLKQALTHRSAAKVHNE---RLEFLGDAILNLTIGEALYLQFPHCNE 63

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS    +LV  +T +++A + DL +++ + +   K       SI AD VE++I A+ L
Sbjct: 64  GELSRMRATLVREKTLAELAHQFDLGNYMALGAGELKSGGFRRASILADCVEAIIGAMSL 123

Query: 129 DGGIEVAGTFVDKYWK--QRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  +      V ++++   R ++ G+ ++D KT LQE+   K    P Y VT   G  H 
Sbjct: 124 DSNLPKTMEIVRRWYEVLLRDIQPGENQKDPKTRLQEYLQGKRLALPAYNVTDIQGEAHC 183

Query: 187 PRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLK 221
             FTV   +  L     G+  S+R AEQVAA ++LK
Sbjct: 184 QTFTVECHVENLDRTFVGVAGSRRKAEQVAAEQILK 219


>gi|261839511|gb|ACX99276.1| ribonuclease III [Helicobacter pylori 52]
          Length = 239

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/221 (35%), Positives = 122/221 (55%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 18  YITLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 75

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    ++VSA   +++A+ + L  ++RVSS           SI +   E+L+A 
Sbjct: 76  YDEGKLSKLRAAIVSAHGFTKLAKIIALQDYLRVSSSEEISNGREKPSILSSAFEALMAG 135

Query: 126 LYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+    ++    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 136 VYLEAGLAKVRKIIQNLLNRAYKRLDLEH--LFMDYKTALQELTQAQFCVIPTYQLLKEK 193

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F + + I     A     SK+ AEQ  A + L++
Sbjct: 194 GPDHHKEFEMALYIQDKIYATAKGKSKKEAEQQCAYQALQK 234


>gi|119953483|ref|YP_945692.1| ribonuclease III [Borrelia turicatae 91E135]
 gi|119862254|gb|AAX18022.1| ribonuclease III [Borrelia turicatae 91E135]
          Length = 244

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 116/212 (54%), Gaps = 7/212 (3%)

Query: 17  FANRSLLEKALTHSSISHSYQESY---ERLEFLGDRILGLLISTLLFNHFDSAKEGELSV 73
           F +  LL  +L+HSS ++ + + Y   ERLEFLGD +L L+I+  L+  +    EGELS 
Sbjct: 28  FNDIDLLNMSLSHSSYANEFDQKYANNERLEFLGDSVLNLIITDYLYRFYPEKSEGELSK 87

Query: 74  RFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIE 133
             + +VS E+ S +AREL+L ++I +      +       I AD +E+ + ALYLDGG  
Sbjct: 88  ARSYIVSEESLSSIARELNLGNYILLGRGEENNDGRNKKGILADAIEAFVGALYLDGGFL 147

Query: 134 VAGTFVDKYWK---QRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFT 190
               FV + ++   +     G F +D K+ LQE+   K+ ++P YK+    GPDH+  F 
Sbjct: 148 KTLDFVIELFEVHIRLMFNRGDF-KDYKSLLQEYVQKKYKISPTYKLAKELGPDHNKVFC 206

Query: 191 VVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           V + ++    + G   SK+ AE +AA   LK 
Sbjct: 207 VELYVNDKFISNGKGKSKKEAEMIAAEMALKN 238


>gi|15606266|ref|NP_213645.1| RNase III [Aquifex aeolicus VF5]
 gi|7531189|sp|O67082|RNC_AQUAE RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|83753752|pdb|1YYK|A Chain A, Crystal Structure Of Rnase Iii From Aquifex Aeolicus
           Complexed With Double-Stranded Rna At 2.5-Angstrom
           Resolution
 gi|83753753|pdb|1YYK|B Chain B, Crystal Structure Of Rnase Iii From Aquifex Aeolicus
           Complexed With Double-Stranded Rna At 2.5-Angstrom
           Resolution
 gi|83753764|pdb|1YYW|A Chain A, Crystal Structure Of Rnase Iii From Aquifex Aeolicus
           Complexed With Double Stranded Rna At 2.8-Angstrom
           Resolution
 gi|83753765|pdb|1YYW|B Chain B, Crystal Structure Of Rnase Iii From Aquifex Aeolicus
           Complexed With Double Stranded Rna At 2.8-Angstrom
           Resolution
 gi|83753766|pdb|1YYW|C Chain C, Crystal Structure Of Rnase Iii From Aquifex Aeolicus
           Complexed With Double Stranded Rna At 2.8-Angstrom
           Resolution
 gi|83753767|pdb|1YYW|D Chain D, Crystal Structure Of Rnase Iii From Aquifex Aeolicus
           Complexed With Double Stranded Rna At 2.8-Angstrom
           Resolution
 gi|160877674|pdb|2NUE|A Chain A, Crystal Structure Of Rnase Iii From Aquifex Aeolicus
           Complexed With Ds-Rna At 2.9-Angstrom Resolution
 gi|160877675|pdb|2NUE|B Chain B, Crystal Structure Of Rnase Iii From Aquifex Aeolicus
           Complexed With Ds-Rna At 2.9-Angstrom Resolution
 gi|160877678|pdb|2NUF|A Chain A, Crystal Structure Of Rnase Iii From Aquifex Aeolicus
           Complexed With Ds-Rna At 2.5-Angstrom Resolution
 gi|160877679|pdb|2NUF|B Chain B, Crystal Structure Of Rnase Iii From Aquifex Aeolicus
           Complexed With Ds-Rna At 2.5-Angstrom Resolution
 gi|160877684|pdb|2NUG|A Chain A, Crystal Structure Of Rnase Iii From Aquifex Aeolicus
           Complexed With Ds-Rna At 1.7-Angstrom Resolution
 gi|160877685|pdb|2NUG|B Chain B, Crystal Structure Of Rnase Iii From Aquifex Aeolicus
           Complexed With Ds-Rna At 1.7-Angstrom Resolution
 gi|2983469|gb|AAC07049.1| RNase III [Aquifex aeolicus VF5]
          Length = 221

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 83/218 (38%), Positives = 122/218 (55%), Gaps = 14/218 (6%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LEK++GY F ++SLLEKALTH  +S+S +E YE LEFLGD ++   I  LL  +  + +E
Sbjct: 7   LEKKLGYTFKDKSLLEKALTH--VSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKRE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G LS     L+S E  + +A++L+L  FIR+             +I  DV E+L AA+Y+
Sbjct: 65  GFLSPLKAYLISEEFFNLLAQKLELHKFIRIKR------GKINETIIGDVFEALWAAVYI 118

Query: 129 DGGIEVAGT--FVDKYWKQ---RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           D G +   T     K +K+    A+K G+ ++D KT LQE    ++   PEY++    GP
Sbjct: 119 DSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGP 178

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
            H  +F V  +I       G   SK+ AEQ AA E++K
Sbjct: 179 HHKKKFIVEAKIKEYRTL-GEGKSKKEAEQRAAEELIK 215


>gi|146312695|ref|YP_001177769.1| ribonuclease III [Enterobacter sp. 638]
 gi|189043313|sp|A4WDD8|RNC_ENT38 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|145319571|gb|ABP61718.1| RNAse III [Enterobacter sp. 638]
          Length = 226

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 122/224 (54%), Gaps = 6/224 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F +  LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPIVINRLQRKLGYTFQHHELLQQALTHRSASSKHNE---RLEFLGDSILSYVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE +L   +R+     K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAEIAREFELGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  +++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGVFLDSDIQTVEQLILNWYQTRLDEISPGDKQKDPKTRLQEYLQGRHLPLPSYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLK 221
              G  HD  FT+  ++SGL+ P  G   S+R AEQ AA + LK
Sbjct: 178 QVRGEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAAAEQALK 221


>gi|126698844|ref|YP_001087741.1| ribonuclease III [Clostridium difficile 630]
 gi|254974792|ref|ZP_05271264.1| ribonuclease III [Clostridium difficile QCD-66c26]
 gi|255092180|ref|ZP_05321658.1| ribonuclease III [Clostridium difficile CIP 107932]
 gi|255100264|ref|ZP_05329241.1| ribonuclease III [Clostridium difficile QCD-63q42]
 gi|255306204|ref|ZP_05350376.1| ribonuclease III [Clostridium difficile ATCC 43255]
 gi|255313919|ref|ZP_05355502.1| ribonuclease III [Clostridium difficile QCD-76w55]
 gi|255516598|ref|ZP_05384274.1| ribonuclease III [Clostridium difficile QCD-97b34]
 gi|255649698|ref|ZP_05396600.1| ribonuclease III [Clostridium difficile QCD-37x79]
 gi|260682854|ref|YP_003214139.1| ribonuclease III [Clostridium difficile CD196]
 gi|260686452|ref|YP_003217585.1| ribonuclease III [Clostridium difficile R20291]
 gi|306519814|ref|ZP_07406161.1| ribonuclease III [Clostridium difficile QCD-32g58]
 gi|115250281|emb|CAJ68103.1| ribonuclease III [Clostridium difficile]
 gi|260209017|emb|CBA62108.1| putative ribonuclease III [Clostridium difficile CD196]
 gi|260212468|emb|CBE03371.1| putative ribonuclease III [Clostridium difficile R20291]
          Length = 236

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 82/222 (36%), Positives = 119/222 (53%), Gaps = 5/222 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESY--ERLEFLGDRILGLLISTLLFNHFDSA 66
            E  I Y F N+  + +ALTHSS S+  ++    ERLEFLGD +LG++IS  LFN   + 
Sbjct: 14  FENVINYKFKNKEYILEALTHSSYSNENKKYNFNERLEFLGDSVLGIVISDYLFNEEANL 73

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EGEL+    ++V  ++ S+VA +++L   + +            TSI AD  E++IAA+
Sbjct: 74  PEGELTKLRANIVCEDSLSEVANDINLGIHMLLGRGEEATGGRHRTSILADAFEAVIAAI 133

Query: 127 YLDGGIEVAGTFVDKYWKQRALKS--GKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLDGG E A  F+  + +     S  G   RD KT LQE           Y++    GPD
Sbjct: 134 YLDGGFESARQFILHHMENIIYDSRKGNIFRDYKTHLQEVLQGNGENNIWYRLIEEKGPD 193

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           H+ RF + V I+      G   SK+ AEQ+AA   LK++ +W
Sbjct: 194 HNKRFVMEVGINDDVLGIGEGKSKKEAEQLAAKIALKKK-LW 234


>gi|116327694|ref|YP_797414.1| ribonuclease III [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|122284510|sp|Q053L4|RNC_LEPBL RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|116120438|gb|ABJ78481.1| Ribonuclease III [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
          Length = 247

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/222 (35%), Positives = 113/222 (50%), Gaps = 5/222 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQE---SYERLEFLGDRILGLLISTLLFNH 62
           +  L K+IG  F+       A  HSS  +   E     ERLEFLGD +LGL+ +  LF  
Sbjct: 21  FKKLSKKIGIKFSKIEYYNTAFIHSSYKNENPEILEDNERLEFLGDSVLGLVAARSLFQK 80

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           +  A EGELS   + +VS    + +A +L+L  ++ +    +         I A++ ESL
Sbjct: 81  YPKASEGELSRIKSKIVSTPILNSIAEKLNLGEYLLLGKGEKNSQGKGRRKIAANLFESL 140

Query: 123 IAALYLDGGIEVAGTFVDKYWKQRALKSG--KFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           + A+YLD G EVA  F+ ++  + A      +  RD KT+LQE++   F   P Y++   
Sbjct: 141 VGAIYLDRGFEVAEKFIVQHLLEFAENPDMEESVRDYKTQLQEYSQKHFKTLPVYRMKGE 200

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           SGPDH   F V V I     A G   SK+ AEQ AA E+  R
Sbjct: 201 SGPDHSKMFQVSVRIRDQWEASGYGASKKIAEQNAAKELYIR 242


>gi|311898536|dbj|BAJ30944.1| putative ribonuclease 3 [Kitasatospora setae KM-6054]
          Length = 269

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 116/215 (53%), Gaps = 6/215 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHF 63
           Y  LE R+GY+   R+LL +ALTH S ++      + ERLEFLGD +LGL+++  L+   
Sbjct: 28  YDVLEGRLGYSL-ERALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTLYRLH 86

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
               EG L+    ++V++   ++V R LDL +FIR+            +SI AD VE++I
Sbjct: 87  PEVAEGTLAKLRAAVVNSRALAEVGRGLDLGAFIRLGKGEEGTGGRDKSSILADTVEAVI 146

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKVTFRS 181
            A YLD G++ A  FV + +     +S +     D KT LQE   A     PEY VT  S
Sbjct: 147 GATYLDQGLDAATEFVHRLFDPLIAESAQLGAGLDWKTSLQELTAAVGLGVPEYVVT-ES 205

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           GPDH+  FT    ++G     G   SK+ AEQ AA
Sbjct: 206 GPDHEKTFTAAARVAGQDHGSGSGRSKKEAEQKAA 240


>gi|216263528|ref|ZP_03435523.1| ribonuclease III [Borrelia afzelii ACA-1]
 gi|215980372|gb|EEC21193.1| ribonuclease III [Borrelia afzelii ACA-1]
          Length = 245

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/212 (36%), Positives = 114/212 (53%), Gaps = 9/212 (4%)

Query: 17  FANRSLLEKALTHSSISHSYQE---SYERLEFLGDRILGLLISTLLFNHFDSAKEGELSV 73
           F N  LL  AL+HSS S+   +   + ERLEFLGD +L L+I+  L+  + +  EGELS 
Sbjct: 29  FNNFDLLNTALSHSSYSNELDQKSDNNERLEFLGDSVLNLIITDHLYKTYPNKSEGELSK 88

Query: 74  RFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIE 133
             + +VS ++ S +ARE+DL S+I +      +       I AD +E+ + A+YLD G  
Sbjct: 89  ARSYIVSEDSLSSIAREIDLGSYILLGRGEESNDGRNKKGILADAIEAFVGAIYLDSGFS 148

Query: 134 VAGTFV----DKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
           +A  FV    D Y +      G F +D K+ LQE+   K+ ++P YK+    GPDHD  F
Sbjct: 149 IATEFVVGLFDMYIR-LMFNRGDF-KDYKSLLQEYVQKKYKISPNYKLDKEIGPDHDKVF 206

Query: 190 TVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
            V + +     + G   SK+ AE  AA   LK
Sbjct: 207 CVELYVGEKFISNGKGKSKKEAEMRAAEVALK 238


>gi|116331646|ref|YP_801364.1| ribonuclease III [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
 gi|122280610|sp|Q04R64|RNC_LEPBJ RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|116125335|gb|ABJ76606.1| Ribonuclease III [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
          Length = 247

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/222 (35%), Positives = 113/222 (50%), Gaps = 5/222 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQE---SYERLEFLGDRILGLLISTLLFNH 62
           +  L K+IG  F+       A  HSS  +   E     ERLEFLGD +LGL+ +  LF  
Sbjct: 21  FKKLSKKIGIKFSKIEYYNTAFIHSSYKNENPEILEDNERLEFLGDSVLGLVAARSLFQK 80

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           +  A EGELS   + +VS    + +A +L+L  ++ +    +         I A++ ESL
Sbjct: 81  YPKASEGELSRIKSKIVSTPILNSIAEKLNLGEYLLLGKGEKNSQGKGRRKIAANLFESL 140

Query: 123 IAALYLDGGIEVAGTFVDKYWKQRALKSG--KFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           + A+YLD G EVA  F+ ++  + A      +  RD KT+LQE++   F   P Y++   
Sbjct: 141 VGAIYLDRGFEVAEKFIVQHLLEFAENPDMEESVRDYKTQLQEYSQKHFKTLPVYRMKGE 200

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           SGPDH   F V V I     A G   SK+ AEQ AA E+  R
Sbjct: 201 SGPDHSKTFQVSVRIRDQWEASGYGASKKIAEQNAAKELYIR 242


>gi|52842090|ref|YP_095889.1| ribonuclease III [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|81377263|sp|Q5ZUD5|RNC_LEGPH RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|52629201|gb|AAU27942.1| ribonuclease III [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
          Length = 224

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 80/217 (36%), Positives = 120/217 (55%), Gaps = 6/217 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L +R+ Y F N + L++ALTH S      ++YER EFLGD IL  +I+  LFN F    E
Sbjct: 8   LCRRLNYHFNNIAYLKQALTHCSAG---SDNYERFEFLGDSILSFVIANELFNRFPLHSE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS   + LV  E  +++ARE+DL  ++ +     +      TSI AD +E+++AA+YL
Sbjct: 65  GQLSRLRSFLVKGEMLAEIAREIDLGDYLFLGQGELRSGGFRRTSILADALEAILAAIYL 124

Query: 129 DGGIEVAGTFVDKYWKQRALKS--GKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           DGG+  A   +   +  R          +DAKT+LQE+  A     PEY +T   G +H 
Sbjct: 125 DGGMIAAKQIILMLYSSRLDDPDLNHCLKDAKTQLQEFLQASKFALPEYVLTKIEGDEHA 184

Query: 187 PRFTVVVEISGLAP-AQGMDCSKRAAEQVAAAEVLKR 222
             F V   I G++  A G   ++R AEQ+AA  +L++
Sbjct: 185 QIFHVTCTIEGVSQVAYGTGPNRRKAEQLAAKAMLEQ 221


>gi|317178975|dbj|BAJ56763.1| ribonuclease III [Helicobacter pylori F30]
          Length = 232

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/221 (35%), Positives = 121/221 (54%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 11  YITLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 68

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VS    +++A+ + L  ++RVSS           SI +   E+L+A 
Sbjct: 69  YDEGKLSKLRASIVSTHGFTKLAKVIALQDYLRVSSSEEISKGREKPSILSSAFEALMAG 128

Query: 126 LYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+    ++    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 129 VYLEAGLAKVRKIIQNLLNRAYKRLDLEH--LFMDYKTALQELTQAQFCVIPTYQLLKEK 186

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F + + I     A     SK+ AEQ  A + L++
Sbjct: 187 GPDHHKEFEMALYIQDKIYATAKGKSKKEAEQQCAYQALQK 227


>gi|313673188|ref|YP_004051299.1| rnase iii [Calditerrivibrio nitroreducens DSM 19672]
 gi|312939944|gb|ADR19136.1| RNAse III [Calditerrivibrio nitroreducens DSM 19672]
          Length = 229

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 81/218 (37%), Positives = 115/218 (52%), Gaps = 16/218 (7%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHFDSA 66
           L + + Y F N+ LL +ALTHSS S+  +   +YERLEFLGD +L L++S  L   +   
Sbjct: 6   LNEILNYNFENKELLIEALTHSSYSYENKLCRNYERLEFLGDAVLQLIVSEYLIFKYKDF 65

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG LS      VS E  S++A+++DL +FIR+             SI  D+ ES++AA+
Sbjct: 66  DEGMLSRYRAYFVSEEFISELAKQIDLGNFIRLGKGELNSGGKDRPSILCDIFESIVAAM 125

Query: 127 YLDGG--------IEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           YLDGG        I +A   +D+  +Q          D K+ELQ+     F   P+YKV 
Sbjct: 126 YLDGGYNEARRFIITIASDKIDEVIQQNIFT------DYKSELQKLTQKIFESLPDYKVK 179

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
             +GP+HD  F V + I+      G   SK+ AEQ AA
Sbjct: 180 DETGPEHDKTFIVDLYINDRYYCSGSGKSKKKAEQDAA 217


>gi|307637352|gb|ADN79802.1| Ribonuclease III [Helicobacter pylori 908]
 gi|325995944|gb|ADZ51349.1| Ribonuclease III [Helicobacter pylori 2018]
 gi|325997538|gb|ADZ49746.1| Ribonuclease III [Helicobacter pylori 2017]
          Length = 239

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 81/220 (36%), Positives = 116/220 (52%), Gaps = 6/220 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y TLEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 18  YLTLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 75

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VSA   +++A+ + L  ++ VSS           SI +   E+L+A 
Sbjct: 76  YDEGKLSKLRASIVSAHGFTKLAKAIALQDYLHVSSSEEISKGREKPSILSSAFEALMAG 135

Query: 126 LYLDGGIEVAGTFVDKYWKQRALKSGKFRR---DAKTELQEWAHAKFGVTPEYKVTFRSG 182
           +YL+ G+      + K    RA K         D KT LQE   A+F V P Y++    G
Sbjct: 136 VYLEAGLAKVRKIIQKLL-NRAYKRLDLEHLFMDYKTALQELTQAQFCVIPTYQLLQEKG 194

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           PDH   F + + I     A     SK+ AEQ  A + L++
Sbjct: 195 PDHHKEFEMALYIQDKMYATAKGKSKKEAEQQCAYQALQK 234


>gi|152971423|ref|YP_001336532.1| ribonuclease III [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|206580271|ref|YP_002237090.1| ribonuclease III [Klebsiella pneumoniae 342]
 gi|288934052|ref|YP_003438111.1| ribonuclease III [Klebsiella variicola At-22]
 gi|189043322|sp|A6TCI1|RNC_KLEP7 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|226741374|sp|B5XNH0|RNC_KLEP3 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|150956272|gb|ABR78302.1| ribonuclease III [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|206569329|gb|ACI11105.1| ribonuclease III [Klebsiella pneumoniae 342]
 gi|288888781|gb|ADC57099.1| ribonuclease III [Klebsiella variicola At-22]
          Length = 226

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/225 (35%), Positives = 124/225 (55%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F ++ LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPIVINRLQRKLGYTFHHQELLQQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE +L   +R+     K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAEIAREFELGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  +++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGVFLDSDIQNVERLILSWYQTRLDEISPGDKQKDPKTRLQEYLQGRHLPLPSYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SGL+ P  G   S+R AEQ AA + LK+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAAAEQALKK 222


>gi|312881718|ref|ZP_07741495.1| ribonuclease III [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309370608|gb|EFP98083.1| ribonuclease III [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 225

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 112/205 (54%), Gaps = 6/205 (2%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAK 67
           TLEK++GY F +  L+  ALTH S +  + E   RLEFLGD IL  +I+  L+  F    
Sbjct: 7   TLEKKLGYQFDDAELISLALTHRSANSKHNE---RLEFLGDSILSFVIADDLYQRFPQIN 63

Query: 68  EGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALY 127
           EG++S    +LV  +T +++ RE  L  ++++     K       SI AD VE++I A+Y
Sbjct: 64  EGDMSRMRATLVRGKTLAELGREFQLGDYLKLGPGELKSGGFRRDSILADAVEAIIGAIY 123

Query: 128 LDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           +D  IEV    +  +++ R  A++ G  ++D KT LQE+   +    P Y VT   G  H
Sbjct: 124 MDSNIEVVRGIILAWYQGRLEAIEPGASQKDPKTRLQEFLQGRRKPLPAYTVTNIKGEAH 183

Query: 186 DPRFTVVVEISGL-APAQGMDCSKR 209
           +  FTV  E++G+  P  G   S+R
Sbjct: 184 NQEFTVSCEVAGINQPVVGKGTSRR 208


>gi|269140067|ref|YP_003296768.1| ribonuclease III [Edwardsiella tarda EIB202]
 gi|267985728|gb|ACY85557.1| ribonuclease III [Edwardsiella tarda EIB202]
 gi|304559895|gb|ADM42559.1| Ribonuclease III [Edwardsiella tarda FL6-60]
          Length = 226

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 122/225 (54%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F  + LL +ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPIVINRLQRKLGYTFRQQDLLMQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE DL   +R+     K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAEMAREFDLGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  ++  R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGIFLDSDIQTIERLILDWYHSRLEEISPGDKQKDPKTRLQEFLQGRHLPLPSYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SGL AP  G+  S+R AEQ AA + LK+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGLSAPVVGVGSSRRKAEQAAAEQALKQ 222


>gi|160871765|ref|ZP_02061897.1| ribonuclease III [Rickettsiella grylli]
 gi|159120564|gb|EDP45902.1| ribonuclease III [Rickettsiella grylli]
          Length = 230

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 122/217 (56%), Gaps = 5/217 (2%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAK 67
           +L +++ Y F N  LLE AL+H S   +  ++ ERLE+LGD +L  +I+  LF     A+
Sbjct: 7   SLCEKLNYQFKNPELLEDALSHRSFRGN--KNNERLEYLGDAVLNFVIAAALFRQNIKAR 64

Query: 68  EGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALY 127
           EGELS    +LV  ET + +A+  +L  ++R+ +   K   +   SI AD +E+++ A+Y
Sbjct: 65  EGELSRLRANLVRGETLTDLAQGFELGKYLRLGAGELKTGGAQRKSILADGMEAVVGAIY 124

Query: 128 LDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           LDGG +   T + +++  R   ++     +D KT+LQE+  AK    P Y +    GP H
Sbjct: 125 LDGGFQACETCILRWYANRLENIEMIPDLKDPKTQLQEYLQAKKLALPVYTILALEGPAH 184

Query: 186 DPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLK 221
              F V  +I GL   A G+  S+R AEQ AA ++L+
Sbjct: 185 QQSFKVECQIQGLPHKAIGLGSSRRRAEQKAAEKILE 221


>gi|229828999|ref|ZP_04455068.1| hypothetical protein GCWU000342_01084 [Shuttleworthia satelles DSM
           14600]
 gi|229792162|gb|EEP28276.1| hypothetical protein GCWU000342_01084 [Shuttleworthia satelles DSM
           14600]
          Length = 230

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/221 (35%), Positives = 119/221 (53%), Gaps = 5/221 (2%)

Query: 4   LRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLISTLL 59
           +R  TLE +IGY F ++SLL +ALTHSS ++          ERLEFLGD +L ++ S  L
Sbjct: 1   MRNETLEAKIGYQFQDKSLLRQALTHSSFANERHMKAHSDNERLEFLGDAVLEVVSSEFL 60

Query: 60  FNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVV 119
           + ++    EG L+    SLV   T +  ARE+ L + +R++    +       SI +D +
Sbjct: 61  YLNYPDLPEGRLTPLRASLVCEPTLAIAAREIGLGACLRLARGEDQSGGRERDSILSDAL 120

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTF 179
           E++I A++LDGGIE A   + +Y     ++  K   D+KT LQE   A    + +Y +  
Sbjct: 121 EAVIGAVFLDGGIEPAKALIIRYILT-DIEHKKLYHDSKTRLQEMVQAMEEASLDYVLVR 179

Query: 180 RSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
             GPDH  RF     + G    +G   SK+A+EQ AA + L
Sbjct: 180 EEGPDHAKRFVTEARLDGRTIGRGEGGSKKASEQEAAYQGL 220


>gi|255655258|ref|ZP_05400667.1| ribonuclease III [Clostridium difficile QCD-23m63]
 gi|296451243|ref|ZP_06892983.1| ribonuclease III [Clostridium difficile NAP08]
 gi|296880405|ref|ZP_06904368.1| ribonuclease III [Clostridium difficile NAP07]
 gi|296259849|gb|EFH06704.1| ribonuclease III [Clostridium difficile NAP08]
 gi|296428646|gb|EFH14530.1| ribonuclease III [Clostridium difficile NAP07]
          Length = 236

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 82/222 (36%), Positives = 119/222 (53%), Gaps = 5/222 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESY--ERLEFLGDRILGLLISTLLFNHFDSA 66
            E  I Y F N+  + +ALTHSS S+  ++    ERLEFLGD +LG++IS  LFN   + 
Sbjct: 14  FENVINYKFKNKEYILEALTHSSYSNENKKYNFNERLEFLGDSVLGIVISDYLFNEEANL 73

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EGEL+    ++V  ++ S+VA +++L   + +            TSI AD  E++IAA+
Sbjct: 74  PEGELTKLRANIVCEDSLSEVANDINLGVHMLLGRGEEATGGRHRTSILADAFEAVIAAI 133

Query: 127 YLDGGIEVAGTFVDKYWKQRALKS--GKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLDGG E A  F+  + +     S  G   RD KT LQE           Y++    GPD
Sbjct: 134 YLDGGFESARQFILHHMENIIYDSRKGNIFRDYKTHLQEVLQGNGENNIWYRLIEEKGPD 193

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
           H+ RF + V I+      G   SK+ AEQ+AA   LK++ +W
Sbjct: 194 HNKRFVMEVGINEDVLGIGEGKSKKEAEQLAAKIALKKK-LW 234


>gi|289547872|ref|YP_003472860.1| ribonuclease III [Thermocrinis albus DSM 14484]
 gi|289181489|gb|ADC88733.1| ribonuclease III [Thermocrinis albus DSM 14484]
          Length = 237

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 127/217 (58%), Gaps = 11/217 (5%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAK 67
            +EK +GY+F + SLLE+ALTH S++   + SYE LEFLGD ++ L +  LL  +F  ++
Sbjct: 11  VIEKVLGYSFRDPSLLEEALTHRSVAVG-RRSYEVLEFLGDALINLFVVDLLLQNFPQSR 69

Query: 68  EGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALY 127
           EG+L++     VS +  SQ+++EL L S I++    RK++ S   SI ADV E+L  A+Y
Sbjct: 70  EGQLAIMKAFFVSEDFLSQLSQELGLESLIKMERR-RKNISS---SILADVFEALWGAIY 125

Query: 128 LDGGIEVAGT---FVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           +D G ++  T   F   Y ++  + +K G +R+D KT LQE     +   P Y++    G
Sbjct: 126 MDTGRDLNTTRDLFFKNYGERILQVVKEGSYRKDYKTLLQELTQHLWKTRPTYRLIGTEG 185

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEV 219
           P H+  F V  ++ G   A G   SK+ AEQ +A ++
Sbjct: 186 PHHNRIFEVECQV-GSYRAVGKGKSKKEAEQESAKKL 221


>gi|224534577|ref|ZP_03675153.1| ribonuclease III [Borrelia spielmanii A14S]
 gi|224514254|gb|EEF84572.1| ribonuclease III [Borrelia spielmanii A14S]
          Length = 245

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/212 (36%), Positives = 114/212 (53%), Gaps = 9/212 (4%)

Query: 17  FANRSLLEKALTHSSISHSYQE---SYERLEFLGDRILGLLISTLLFNHFDSAKEGELSV 73
           F N  LL  AL+HSS S+   +   + ERLEFLGD +L L+I+  L+  + +  EGELS 
Sbjct: 29  FNNFDLLNTALSHSSYSNELDQKSGNNERLEFLGDSVLNLIITDHLYKTYPNKSEGELSK 88

Query: 74  RFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIE 133
             + +VS ++ S +ARE+DL S+I +      +       I AD +E+ + A+YLD G  
Sbjct: 89  ARSYIVSEDSLSSIAREIDLGSYILLGRGEESNDGRNKKGILADAIEAFVGAIYLDSGFS 148

Query: 134 VAGTFV----DKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
           +A  FV    D Y +      G F +D K+ LQE+   K+ ++P YK+    GPDHD  F
Sbjct: 149 IATEFVVGLFDMYIR-LMFNRGDF-KDYKSLLQEYVQKKYKISPSYKLDKEIGPDHDKVF 206

Query: 190 TVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
            V + +     + G   SK+ AE  AA   LK
Sbjct: 207 CVELYVGEKFISNGKGKSKKEAEMRAAEVALK 238


>gi|150016054|ref|YP_001308308.1| ribonuclease III [Clostridium beijerinckii NCIMB 8052]
 gi|189043303|sp|A6LSM2|RNC_CLOB8 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|149902519|gb|ABR33352.1| Ribonuclease III [Clostridium beijerinckii NCIMB 8052]
          Length = 232

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 80/224 (35%), Positives = 123/224 (54%), Gaps = 4/224 (1%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTL 58
           M+      +E+ +G  F N +LL+ ALTHSS  + ++  E  ERLEFLGD +L L I+  
Sbjct: 1   MNRYTLKEIEENLGVFFNNHTLLKTALTHSSFGNQFKDAEYNERLEFLGDSVLQLCITEY 60

Query: 59  LFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADV 118
           LFN++    EGEL+   + +V   +  ++A++++L S+IR+S            SIQAD 
Sbjct: 61  LFNNYKHKTEGELTKIRSLIVCENSLYEIAKKINLGSYIRMSKGEEITGGRERISIQADA 120

Query: 119 VESLIAALYLDGGIEVAGTFVDKYWKQRALK--SGKFRRDAKTELQEWAHAKFGVTPEYK 176
           VE++IAA+YLD GI     F+  ++++   K  + +   D KT+LQE       V  +Y+
Sbjct: 121 VEAIIAAVYLDKGIGFVRDFILLHFEEIINKAINNEIVLDFKTKLQELLQKDGEVVIQYE 180

Query: 177 VTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
           +T   GP H  +F   V I      +G   SK+ AEQ AA + L
Sbjct: 181 LTKFEGPPHRRKFFTNVVIDKKLMGEGSGYSKKEAEQNAAKQAL 224


>gi|25010800|ref|NP_735195.1| ribonuclease III [Streptococcus agalactiae NEM316]
 gi|76788414|ref|YP_329471.1| ribonuclease III [Streptococcus agalactiae A909]
 gi|76798198|ref|ZP_00780449.1| ribonuclease III [Streptococcus agalactiae 18RS21]
 gi|77406421|ref|ZP_00783480.1| ribonuclease III [Streptococcus agalactiae H36B]
 gi|77408361|ref|ZP_00785102.1| ribonuclease III [Streptococcus agalactiae COH1]
 gi|77410795|ref|ZP_00787153.1| ribonuclease III [Streptococcus agalactiae CJB111]
 gi|77413080|ref|ZP_00789281.1| ribonuclease III [Streptococcus agalactiae 515]
 gi|81457210|sp|Q8E680|RNC_STRA3 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|90101649|sp|Q3K1Y2|RNC_STRA1 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|90101650|sp|Q8E0K7|RNC_STRA5 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|23095154|emb|CAD46389.1| Unknown [Streptococcus agalactiae NEM316]
 gi|76563471|gb|ABA46055.1| ribonuclease III [Streptococcus agalactiae A909]
 gi|76586461|gb|EAO62968.1| ribonuclease III [Streptococcus agalactiae 18RS21]
 gi|77160873|gb|EAO71983.1| ribonuclease III [Streptococcus agalactiae 515]
 gi|77163174|gb|EAO74127.1| ribonuclease III [Streptococcus agalactiae CJB111]
 gi|77173042|gb|EAO76170.1| ribonuclease III [Streptococcus agalactiae COH1]
 gi|77174985|gb|EAO77795.1| ribonuclease III [Streptococcus agalactiae H36B]
          Length = 228

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 85/226 (37%), Positives = 118/226 (52%), Gaps = 8/226 (3%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLIS 56
           M  LR S LEK  G  FAN+ LL+ A TH+S ++ ++       ERLEFLGD +L LLIS
Sbjct: 1   MKELR-SKLEKDYGIVFANQELLDTAFTHTSYANEHRLLNISHNERLEFLGDAVLQLLIS 59

Query: 57  TLLFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA 116
             LF  +    EG+LS   + +V  E+ +  +R      +I++     K       +I  
Sbjct: 60  QYLFTKYPQKAEGDLSKLRSMIVREESLAGFSRLCGFDHYIKLGKGEEKSGGRNRDTILG 119

Query: 117 DVVESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPE 174
           D+ E+ + AL LD G+EV   FV+K       K G + R  D KT LQE   +   V  +
Sbjct: 120 DLFEAFLGALLLDKGVEVVHAFVNKVMIPHVEK-GTYERVKDYKTSLQELLQSHGDVKID 178

Query: 175 YKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
           Y+VT  SGP H   F V V ++    +QG+  SK+AAEQ AA   L
Sbjct: 179 YQVTNESGPAHAKEFEVTVSVNQENLSQGIGRSKKAAEQDAAKNAL 224


>gi|293609826|ref|ZP_06692128.1| ribonuclease 3 [Acinetobacter sp. SH024]
 gi|292828278|gb|EFF86641.1| ribonuclease 3 [Acinetobacter sp. SH024]
          Length = 230

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 116/213 (54%), Gaps = 5/213 (2%)

Query: 12  RIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGEL 71
           RIGY F    LL+ ALTH S+SH Y  +YERLEFLGD +LG++I+  L++ + +  EG L
Sbjct: 16  RIGYQFKQLELLQLALTHRSVSHKY--NYERLEFLGDSLLGMIIANYLYHAYPNENEGRL 73

Query: 72  SVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGG 131
           +    +LV  E   ++A +L L+  + +S+   K       SI AD VE++I A+YLD G
Sbjct: 74  TRMRATLVRQEALGKIATDLQLSRCLILSTGELKSGGHHRESILADTVEAIIGAIYLDSG 133

Query: 132 -IEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
            + +    V K++      ++     +D K+ LQE+  A+    P Y+V    G      
Sbjct: 134 DLNLLKDIVLKWYIPYLDHIEPTDQLKDPKSRLQEYLQARKKPLPVYEVVDIQGDAPHQH 193

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           F V   + GL    G   S+R AEQ AAAE+LK
Sbjct: 194 FKVECVVDGLPKIYGEGSSRRFAEQAAAAEILK 226


>gi|301168615|emb|CBW28205.1| RNase III [Haemophilus influenzae 10810]
          Length = 227

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 121/222 (54%), Gaps = 15/222 (6%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE++IGY F + +LL++ALTH S +  + E   RLEFLGD IL   I+  L++ F    E
Sbjct: 7   LERKIGYCFNDITLLKQALTHRSAATQHNE---RLEFLGDSILNFTIAEALYHQFPRCNE 63

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS    +LV   T + +AR+ +L  ++ + S   K+      SI AD VE++I A+ L
Sbjct: 64  GELSRMRATLVREPTLAILARQFELGDYMSLGSGELKNGGFRRESILADCVEAIIGAMSL 123

Query: 129 DGGIEVAGTFVDKYWKQRAL---KSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           D G+ V  T V + W Q+ L   K G  ++DAKT LQE+   K    P Y+V    G  H
Sbjct: 124 DQGLAVT-TQVIRNWYQQLLAEIKPGDNQKDAKTRLQEYLQGKHLPLPTYEVVNIQGEAH 182

Query: 186 DPRFTVVVEISGLAP------AQGMDCSKRAAEQVAAAEVLK 221
              FTV  ++           A+G   S+R AEQ AA ++LK
Sbjct: 183 CQIFTVECKVKSAGKIDRTFVAKG--SSRRKAEQAAAEQILK 222


>gi|22536887|ref|NP_687738.1| ribonuclease III [Streptococcus agalactiae 2603V/R]
 gi|22533737|gb|AAM99610.1|AE014224_13 ribonuclease III [Streptococcus agalactiae 2603V/R]
 gi|319744744|gb|EFV97086.1| ribonuclease III [Streptococcus agalactiae ATCC 13813]
          Length = 236

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 85/226 (37%), Positives = 118/226 (52%), Gaps = 8/226 (3%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLIS 56
           M  LR S LEK  G  FAN+ LL+ A TH+S ++ ++       ERLEFLGD +L LLIS
Sbjct: 9   MKELR-SKLEKDYGIVFANQELLDTAFTHTSYANEHRLLNISHNERLEFLGDAVLQLLIS 67

Query: 57  TLLFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA 116
             LF  +    EG+LS   + +V  E+ +  +R      +I++     K       +I  
Sbjct: 68  QYLFTKYPQKAEGDLSKLRSMIVREESLAGFSRLCGFDHYIKLGKGEEKSGGRNRDTILG 127

Query: 117 DVVESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPE 174
           D+ E+ + AL LD G+EV   FV+K       K G + R  D KT LQE   +   V  +
Sbjct: 128 DLFEAFLGALLLDKGVEVVHAFVNKVMIPHVEK-GTYERVKDYKTSLQELLQSHGDVKID 186

Query: 175 YKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
           Y+VT  SGP H   F V V ++    +QG+  SK+AAEQ AA   L
Sbjct: 187 YQVTNESGPAHAKEFEVTVSVNQENLSQGIGRSKKAAEQDAAKNAL 232


>gi|51473232|ref|YP_066989.1| ribonuclease III [Rickettsia typhi str. Wilmington]
 gi|81390308|sp|Q68XY5|RNC_RICTY RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|51459544|gb|AAU03507.1| RNase D [Rickettsia typhi str. Wilmington]
          Length = 227

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 106/194 (54%), Gaps = 4/194 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSI----SHSYQESYERLEFLGDRILGLLISTLLFN 61
           +  LE  +GY+F N+ LL +AL+H S+     + Y + YERLEFLGD +L LLI+ +LF 
Sbjct: 4   FEKLETLLGYSFKNKELLIEALSHPSLRQYHEYKYDKDYERLEFLGDAVLNLLITEILFK 63

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVES 121
           +F++ KEG L+   + LV  ET   V  +L L  +I ++            +   +V E+
Sbjct: 64  NFENYKEGNLAKIRSYLVCKETICIVGTKLALKDYIIMTHGEEVAGGRDNPNNIENVTEA 123

Query: 122 LIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           LIAA+YLD  IE+    ++K W +          D KT LQEWA A     P Y++  R 
Sbjct: 124 LIAAIYLDSNIEITHNIIEKLWAEFMKVQNLTDYDPKTALQEWAQASSNHLPIYRLIKRE 183

Query: 182 GPDHDPRFTVVVEI 195
           G  H   FTV+V++
Sbjct: 184 GAAHSSIFTVLVKV 197


>gi|90416440|ref|ZP_01224371.1| ribonuclease III [marine gamma proteobacterium HTCC2207]
 gi|90331639|gb|EAS46867.1| ribonuclease III [marine gamma proteobacterium HTCC2207]
          Length = 225

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 80/218 (36%), Positives = 122/218 (55%), Gaps = 8/218 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L+ R+ Y F++  LL  AL+H S   +   + ERLEFLGD +LG+ IS+ LF  F  A+E
Sbjct: 8   LQDRLQYQFSDPQLLTLALSHRSCGSN---NNERLEFLGDAVLGMAISSFLFQRFPEARE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS   + +V AE+ +++AR+LDL   + +     K       SI  D VE+L+ A++L
Sbjct: 65  GDLSRIRSQVVRAESLAEIARKLDLGPELLLGPGEMKSGGHRRDSILGDTVEALLGAVFL 124

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFR---RDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           D G+ VA     + W   +L +       +DAKT LQEW  A+    PEY+V    G DH
Sbjct: 125 DQGL-VAVEACVQNWFGASLNTLTLDTPVKDAKTALQEWLQARGKPLPEYRVVKTEGEDH 183

Query: 186 DPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
              FT+  +I  +   A+    S+R AEQ+ A +++K+
Sbjct: 184 SRLFTMSCKIDAVDETAEATASSRRKAEQLVAEKLVKK 221


>gi|297202624|ref|ZP_06920021.1| ribonuclease III [Streptomyces sviceus ATCC 29083]
 gi|197713199|gb|EDY57233.1| ribonuclease III [Streptomyces sviceus ATCC 29083]
          Length = 272

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/215 (36%), Positives = 117/215 (54%), Gaps = 6/215 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHF 63
           ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L+N  
Sbjct: 16  HTLLEGRLGYKLES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTLYNTH 74

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
               EG+L+    ++V++   ++V R LDL SFIR+             SI AD +E++I
Sbjct: 75  PDLPEGQLAKLRAAVVNSRALAEVGRGLDLGSFIRLGRGEEGTGGRDKASILADTLEAVI 134

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKVTFRS 181
            A+YLD G++ A   V + +     KS       D KT LQE    +    PEY VT  +
Sbjct: 135 GAVYLDQGLKAASELVHRLFDPLIEKSSNLGAGLDWKTSLQELTATEGLGVPEYLVT-ET 193

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 194 GPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 228


>gi|323491198|ref|ZP_08096384.1| ribonuclease III [Vibrio brasiliensis LMG 20546]
 gi|323314566|gb|EGA67644.1| ribonuclease III [Vibrio brasiliensis LMG 20546]
          Length = 225

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 113/206 (54%), Gaps = 6/206 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + LEK++GY F +  L+  ALTH S   ++ +  ERLEFLGD IL  +I+  L++ F   
Sbjct: 6   AKLEKKLGYQFNDAELISLALTHRS---AHGKHNERLEFLGDSILSFVIADDLYHRFPKV 62

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG++S    +LV   T +++ RE +L   +++     K       SI AD VE++I A+
Sbjct: 63  NEGDMSRMRATLVRGNTLAELGREFELGDHLKLGPGELKSGGFRRDSILADAVEAIIGAI 122

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLD  IEV    +  ++K R  A+K G  ++D KT LQE+   +    P Y VT   G  
Sbjct: 123 YLDSDIEVVRGIILSWYKTRLDAIKPGVSQKDPKTRLQEFLQGRRKPLPAYTVTNIKGEA 182

Query: 185 HDPRFTVVVEISGLA-PAQGMDCSKR 209
           H+  FTV  +++G+  P  G   S+R
Sbjct: 183 HNQEFTVSCDVAGIGQPVIGKGTSRR 208


>gi|29829207|ref|NP_823841.1| ribonuclease III [Streptomyces avermitilis MA-4680]
 gi|81719920|sp|Q82JT9|RNC_STRAW RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|29606313|dbj|BAC70376.1| putative ribonuclease III [Streptomyces avermitilis MA-4680]
          Length = 276

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 80/219 (36%), Positives = 119/219 (54%), Gaps = 6/219 (2%)

Query: 2   SALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLL 59
           +A  ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L
Sbjct: 17  TASSHTLLEGRLGYKLES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTL 75

Query: 60  FNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVV 119
           +       EG+L+    ++V++   ++V R L+L SFIR+             SI AD +
Sbjct: 76  YRTHPDLPEGQLAKLRAAVVNSRALAEVGRGLELGSFIRLGRGEEGTGGRDKASILADTL 135

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKV 177
           E++I A+YLD G+E AG  V + +     KS       D KT LQE    +    PEY V
Sbjct: 136 EAVIGAVYLDQGLEAAGELVHRLFDPLIEKSSNLGAGLDWKTSLQELTATEGLGVPEYLV 195

Query: 178 TFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           T  +GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 196 T-ETGPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 233


>gi|68248565|ref|YP_247677.1| ribonuclease III [Haemophilus influenzae 86-028NP]
 gi|145629132|ref|ZP_01784931.1| ribonuclease III [Haemophilus influenzae 22.1-21]
 gi|145633429|ref|ZP_01789159.1| ribonuclease III [Haemophilus influenzae 3655]
 gi|145636782|ref|ZP_01792448.1| ribonuclease III [Haemophilus influenzae PittHH]
 gi|145639697|ref|ZP_01795300.1| ribonuclease III [Haemophilus influenzae PittII]
 gi|148825705|ref|YP_001290458.1| ribonuclease III [Haemophilus influenzae PittEE]
 gi|229846933|ref|ZP_04467039.1| ribonuclease III [Haemophilus influenzae 7P49H1]
 gi|260582072|ref|ZP_05849867.1| ribonuclease III [Haemophilus influenzae NT127]
 gi|81337008|sp|Q4QPN0|RNC_HAEI8 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|189043319|sp|A5UBC4|RNC_HAEIE RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|68056764|gb|AAX87017.1| ribonuclease III [Haemophilus influenzae 86-028NP]
 gi|144978635|gb|EDJ88358.1| ribonuclease III [Haemophilus influenzae 22.1-21]
 gi|144985992|gb|EDJ92594.1| ribonuclease III [Haemophilus influenzae 3655]
 gi|145270080|gb|EDK10017.1| ribonuclease III [Haemophilus influenzae PittHH]
 gi|145271254|gb|EDK11168.1| ribonuclease III [Haemophilus influenzae PittII]
 gi|148715865|gb|ABQ98075.1| ribonuclease III [Haemophilus influenzae PittEE]
 gi|229810017|gb|EEP45737.1| ribonuclease III [Haemophilus influenzae 7P49H1]
 gi|260094962|gb|EEW78855.1| ribonuclease III [Haemophilus influenzae NT127]
 gi|309750667|gb|ADO80651.1| RNase III, dsRNA [Haemophilus influenzae R2866]
          Length = 227

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 121/222 (54%), Gaps = 15/222 (6%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE++IGY F + +LL++ALTH S +  + E   RLEFLGD IL   I+  L++ F    E
Sbjct: 7   LERKIGYCFNDIALLKQALTHRSAATQHNE---RLEFLGDSILNFTIAEALYHQFPRCNE 63

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS    +LV   T + +AR+ +L  ++ + S   K+      SI AD VE++I A+ L
Sbjct: 64  GELSRMRATLVREPTLAILARQFELGDYMSLGSGELKNGGFRRESILADCVEAIIGAMSL 123

Query: 129 DGGIEVAGTFVDKYWKQRAL---KSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           D G+ V  T V + W Q+ L   K G  ++DAKT LQE+   K    P Y+V    G  H
Sbjct: 124 DQGLAVT-TQVIRNWYQQLLAEIKPGDNQKDAKTRLQEYLQGKHLPLPTYEVVNIQGEAH 182

Query: 186 DPRFTVVVEISGLAP------AQGMDCSKRAAEQVAAAEVLK 221
              FTV  ++           A+G   S+R AEQ AA ++LK
Sbjct: 183 CQIFTVECKVKSAGKIDRTFVAKG--SSRRKAEQAAAEQILK 222


>gi|116748321|ref|YP_845008.1| ribonuclease III [Syntrophobacter fumaroxidans MPOB]
 gi|189043370|sp|A0LGM1|RNC_SYNFM RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|116697385|gb|ABK16573.1| RNAse III [Syntrophobacter fumaroxidans MPOB]
          Length = 242

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 76/225 (33%), Positives = 119/225 (52%), Gaps = 14/225 (6%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSY----QESYERLEFLGDRILGLLISTLLFNHFD 64
           L+  +GY F +  LL +AL H S  H      ++  E LEFLGD +LGL IS  L   F 
Sbjct: 10  LQNLLGYRFGDEGLLHRALVHRSYLHENPHLDEKDNETLEFLGDAVLGLAISHFLLEQFP 69

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EGELS   +++V+    +++A EL+L  ++ +             S+ AD +E+L+A
Sbjct: 70  DYNEGELSRLRSAIVNERELTRIAVELNLGEYLLLGKGEEMTGGRRKASLLADSLEALLA 129

Query: 125 ALYLDGGIEVAGTFVDKYW--------KQRALKSGKFRRDAKTELQEWAHAKFGVTPEYK 176
           ++YLDGG++     + K +        ++  LK+    +D KT+LQE   A++ +TP Y 
Sbjct: 130 SIYLDGGLDAVLGVIKKLFDVYLRFEKREHVLKA--LDKDYKTQLQELTQARYKLTPVYV 187

Query: 177 VTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           +    GPDHD  F + V + G   A G   SK+ A+Q AA + L+
Sbjct: 188 LDREEGPDHDKTFHMNVVLEGQVLAGGSGKSKKDAQQAAAEKALQ 232


>gi|295100361|emb|CBK97906.1| RNAse III [Faecalibacterium prausnitzii L2-6]
          Length = 224

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 87/227 (38%), Positives = 126/227 (55%), Gaps = 21/227 (9%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ---ESYERLEFLGDRILGLLISTLLFNHFDS 65
           LE  IGY F +  LLE ALTH+S ++  +   +  ERLEFLGD +L ++ +  LF+ +  
Sbjct: 5   LETIIGYKFKHPELLETALTHTSYANETRPPVKHNERLEFLGDSVLQIVSADYLFHAYAD 64

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMT--SIQADVVESLI 123
             EG+L+   +SLVS     Q A+E++L  ++R+     ++ C   T  S+ +D  E+LI
Sbjct: 65  RPEGDLTRIRSSLVSEGALFQFAQEINLGDYLRLGRG--EEHCGGRTRPSVVSDAFEALI 122

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKF-RRDAKTELQEWAHAKFGVTPEYKVTF--- 179
           AALYLDGG+EVA  F+  +     +  GK    D KT LQE         PE K+++   
Sbjct: 123 AALYLDGGMEVAKNFILPF-----ITEGKHAEADYKTRLQEIVQQ----NPEEKLSYVVE 173

Query: 180 -RSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
             +GPDH+  F V V  +    A+G   SK+ AEQ AA E LK  G+
Sbjct: 174 QETGPDHNKHFVVAVRFNSDCVARGEGRSKKMAEQHAAREALKLLGV 220


>gi|54294754|ref|YP_127169.1| hypothetical protein lpl1831 [Legionella pneumophila str. Lens]
 gi|81368418|sp|Q5WVI4|RNC_LEGPL RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|53754586|emb|CAH16070.1| hypothetical protein lpl1831 [Legionella pneumophila str. Lens]
          Length = 224

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 119/217 (54%), Gaps = 6/217 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L +R+ Y F N + L++ALTH S      ++YER EFLGD IL  +I+  LFN F    E
Sbjct: 8   LCRRLNYHFNNMAYLKQALTHCSAG---SDNYERFEFLGDSILSFVIANELFNRFPLHSE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS   + LV  E  +++ARE+ L  ++ +     +      TSI AD +E+++AA+YL
Sbjct: 65  GQLSRLRSFLVKGEMLAEIAREIGLGDYLFLGQGELRSGGFRRTSILADALEAILAAIYL 124

Query: 129 DGGIEVAGTFVDKYWKQRALKS--GKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           DGG+  A   +   +  R          +DAKT+LQE+  A     PEY +T   G +H 
Sbjct: 125 DGGMTAAKQIILMLYSSRLDDPDLNHCLKDAKTQLQEFLQASKFALPEYVLTKVEGDEHA 184

Query: 187 PRFTVVVEISGLAP-AQGMDCSKRAAEQVAAAEVLKR 222
             F V   I G++  A G   ++R AEQ+AA  +L++
Sbjct: 185 QIFHVTCTIEGVSQVAYGTGPNRRKAEQLAAKAMLEQ 221


>gi|256821980|ref|YP_003145943.1| ribonuclease III [Kangiella koreensis DSM 16069]
 gi|256795519|gb|ACV26175.1| ribonuclease III [Kangiella koreensis DSM 16069]
          Length = 229

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 118/212 (55%), Gaps = 6/212 (2%)

Query: 12  RIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGEL 71
           R+GY F++ SLL+ ALTH S ++ + E   RLEFLGD ILG++I+  LF H   A EG+L
Sbjct: 14  RLGYQFSDPSLLKLALTHRSGANKHNE---RLEFLGDAILGMVIAEYLFTHLKKADEGQL 70

Query: 72  SVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGG 131
           +    SLV  +T +++A+E++L   + +     K       SI AD +E++I A+Y D G
Sbjct: 71  TRLRASLVKGKTLAEIAKEIELGECLYLGEGELKSGGFRRASILADALEAIIGAVYQDSG 130

Query: 132 IEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
            EVA T +   +++R   +      +D KTELQEW  ++    P+Y++   +G  H   F
Sbjct: 131 FEVAKTIILTLYQKRLQNIDLKAVHKDPKTELQEWLQSRKLPLPDYELLKVTGDPHKQTF 190

Query: 190 TVVVEIS-GLAPAQGMDCSKRAAEQVAAAEVL 220
            V   ++       G   S+R AEQ AA + L
Sbjct: 191 DVACILAEKKVRTHGSGSSRRNAEQQAAEKAL 222


>gi|315652049|ref|ZP_07905050.1| ribonuclease III [Eubacterium saburreum DSM 3986]
 gi|315485696|gb|EFU76077.1| ribonuclease III [Eubacterium saburreum DSM 3986]
          Length = 228

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 80/222 (36%), Positives = 116/222 (52%), Gaps = 5/222 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLISTLLFNH 62
           + L++ +GY + NR LL++ALTHSS ++ +Q     S ERLEFLGD +L L+ S   +  
Sbjct: 6   NELQELLGYEYKNRELLKQALTHSSYANEHQLGKNGSNERLEFLGDAVLELVSSEFFYEV 65

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           +    EGEL+    S V        A  + L+ FIR+          F  SI +D  E++
Sbjct: 66  YPDKPEGELTKIRASFVCEPALVDCAGNIRLSEFIRLGKGEEHTGGRFRPSIISDTFEAV 125

Query: 123 IAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           I ++YLDGG   A   + K+      ++  F  D+KT LQE   ++     EY +    G
Sbjct: 126 IGSIYLDGGFANAKEVILKFI-LNGYENKVFFYDSKTILQEIIQSQDSRPVEYCLLSEEG 184

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           PDH  +F V V I+G     G   SK++AEQ AA E LK+ G
Sbjct: 185 PDHLKKFVVAVNINGQVAGVGEGVSKKSAEQAAAYEALKKLG 226


>gi|51598958|ref|YP_073146.1| ribonuclease III [Borrelia garinii PBi]
 gi|219684131|ref|ZP_03539075.1| ribonuclease III [Borrelia garinii PBr]
 gi|81609804|sp|Q660G7|RNC_BORGA RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|51573529|gb|AAU07554.1| ribonuclease III [Borrelia garinii PBi]
 gi|219672120|gb|EED29173.1| ribonuclease III [Borrelia garinii PBr]
          Length = 245

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 78/212 (36%), Positives = 114/212 (53%), Gaps = 9/212 (4%)

Query: 17  FANRSLLEKALTHSSISHSYQE---SYERLEFLGDRILGLLISTLLFNHFDSAKEGELSV 73
           F N  LL  AL+HSS S+   +   + ERLEFLGD +L L+I+  L+  + +  EGELS 
Sbjct: 29  FNNFDLLNTALSHSSYSNELDQKADNNERLEFLGDSVLNLIITDHLYKTYPNKSEGELSK 88

Query: 74  RFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIE 133
             + +VS ++ S +ARE+DL S+I +      +       I AD +E+ + A+YLD G  
Sbjct: 89  ARSYIVSEDSLSSIAREIDLGSYILLGRGEESNDGRNKKGILADAIEAFVGAIYLDSGFS 148

Query: 134 VAGTFV----DKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
           +A  FV    D Y +      G F +D K+ LQE+   K+ ++P YK+    GPDHD  F
Sbjct: 149 MATEFVVGLFDMYIR-LMFNRGDF-KDYKSLLQEYVQKKYKISPSYKLDKEIGPDHDKVF 206

Query: 190 TVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
            V + +     + G   SK+ AE  AA   LK
Sbjct: 207 CVELYVGEKFISNGKGKSKKEAEMRAAEVALK 238


>gi|111115536|ref|YP_710154.1| ribonuclease III [Borrelia afzelii PKo]
 gi|123341290|sp|Q0SMF0|RNC_BORAP RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|110890810|gb|ABH01978.1| ribonuclease III [Borrelia afzelii PKo]
          Length = 245

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 78/212 (36%), Positives = 114/212 (53%), Gaps = 9/212 (4%)

Query: 17  FANRSLLEKALTHSSISHSYQE---SYERLEFLGDRILGLLISTLLFNHFDSAKEGELSV 73
           F N  LL  AL+HSS S+   +   + ERLEFLGD +L L+I+  L+  + +  EGELS 
Sbjct: 29  FNNFDLLNTALSHSSYSNELDQKSDNNERLEFLGDSVLNLIITDHLYKTYPNKSEGELSK 88

Query: 74  RFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIE 133
             + +VS ++ S +ARE+DL S+I +      +       I AD +E+ + A+YLD G  
Sbjct: 89  ARSYIVSEDSLSSIAREIDLGSYILLGRGEESNDGRNKKGILADAIEAFVGAIYLDSGFL 148

Query: 134 VAGTFV----DKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
           +A  FV    D Y +      G F +D K+ LQE+   K+ ++P YK+    GPDHD  F
Sbjct: 149 IATEFVVGLFDMYIR-LMFNRGDF-KDYKSLLQEYVQKKYKISPNYKLDKEIGPDHDKVF 206

Query: 190 TVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
            V + +     + G   SK+ AE  AA   LK
Sbjct: 207 CVELYVGEKFISNGKGKSKKEAEMRAAEVALK 238


>gi|83753776|pdb|1YZ9|A Chain A, Crystal Structure Of Rnase Iii Mutant E110q From Aquifex
           Aeolicus Complexed With Double Stranded Rna At 2.1-
           Angstrom Resolution
 gi|83753777|pdb|1YZ9|B Chain B, Crystal Structure Of Rnase Iii Mutant E110q From Aquifex
           Aeolicus Complexed With Double Stranded Rna At 2.1-
           Angstrom Resolution
          Length = 221

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 82/218 (37%), Positives = 122/218 (55%), Gaps = 14/218 (6%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LEK++GY F ++SLLEKALTH  +S+S +E YE LEFLGD ++   I  LL  +  + +E
Sbjct: 7   LEKKLGYTFKDKSLLEKALTH--VSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKRE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G LS     L+S E  + +A++L+L  FIR+             +I  DV ++L AA+Y+
Sbjct: 65  GFLSPLKAYLISEEFFNLLAQKLELHKFIRIKR------GKINETIIGDVFQALWAAVYI 118

Query: 129 DGGIEVAGT--FVDKYWKQ---RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           D G +   T     K +K+    A+K G+ ++D KT LQE    ++   PEY++    GP
Sbjct: 119 DSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGP 178

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
            H  +F V  +I       G   SK+ AEQ AA E++K
Sbjct: 179 HHKKKFIVEAKIKEYRTL-GEGKSKKEAEQRAAEELIK 215


>gi|91205996|ref|YP_538351.1| ribonuclease III [Rickettsia bellii RML369-C]
 gi|157826640|ref|YP_001495704.1| ribonuclease III [Rickettsia bellii OSU 85-389]
 gi|122425284|sp|Q1RHA2|RNC_RICBR RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|189043340|sp|A8GYE2|RNC_RICB8 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|91069540|gb|ABE05262.1| Ribonuclease III [Rickettsia bellii RML369-C]
 gi|157801944|gb|ABV78667.1| ribonuclease III [Rickettsia bellii OSU 85-389]
          Length = 227

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 81/221 (36%), Positives = 118/221 (53%), Gaps = 5/221 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSI--SHSYQ--ESYERLEFLGDRILGLLISTLLFN 61
           +  LEK + Y+F N++LL +AL+H S+   H Y+  + YERLEFLGD +L L+I+ +LFN
Sbjct: 4   FEELEKLLDYSFKNKALLTEALSHPSLRQHHEYKANKDYERLEFLGDAVLNLIITEILFN 63

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVES 121
           +F    EG L+   + LV  ET   V  +L L ++I ++            +   +V E+
Sbjct: 64  NFKEYNEGNLAKIRSYLVCKETICVVGAKLGLKNYIIMTHGEEIAGGRDNPNNIENVTEA 123

Query: 122 LIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           LIAA+YLD  I      + K W +          D KT LQEWA +K    P Y++  R 
Sbjct: 124 LIAAIYLDSDITTIHNIIGKLWAEFIKVKDLTDYDPKTALQEWAQSKDHHIPIYRLIKRE 183

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           G  H   FTV V+I+G     G   S + AE+ AA E+L +
Sbjct: 184 GVAHLSTFTVSVKINGYEQT-GKGHSIKEAEKNAARELLHK 223


>gi|307256562|ref|ZP_07538343.1| Ribonuclease 3 [Actinobacillus pleuropneumoniae serovar 10 str.
           D13039]
 gi|306864972|gb|EFM96874.1| Ribonuclease 3 [Actinobacillus pleuropneumoniae serovar 10 str.
           D13039]
          Length = 243

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 120/226 (53%), Gaps = 8/226 (3%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ ++   L+K++GY F N   L +ALTH S      ++ ERLEFLGD IL   I   LF
Sbjct: 18  MNNMQLERLQKKLGYQFTNLDYLLQALTHRSAGA---KNNERLEFLGDSILNFAIGKALF 74

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F  A EGELS    +LV  +T + +AR+  L  ++++ +   K       SI +D VE
Sbjct: 75  EKFPKANEGELSRMRATLVREQTLAILARQFGLGEYMKLGAGELKSGGYRRESILSDCVE 134

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRAL---KSGKFRRDAKTELQEWAHAKFGVTPEYKV 177
           ++IAA+YLD G++ A   V   W Q  L   K G  ++D KT LQE+   +    P Y+V
Sbjct: 135 AIIAAIYLDAGMDKAIAQVH-LWYQDLLAEMKPGDAQKDPKTRLQEFLQGRKLPLPTYEV 193

Query: 178 TFRSGPDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLKR 222
               G  H+  F V  +I  L     G+  S+R AEQ AA +VL +
Sbjct: 194 LDIKGEAHNQTFKVTCKIEMLEEIFIGIGTSRRKAEQNAAEQVLAK 239


>gi|85059765|ref|YP_455467.1| ribonuclease III [Sodalis glossinidius str. 'morsitans']
 gi|123519061|sp|Q2NS13|RNC_SODGM RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|84780285|dbj|BAE75062.1| ribonuclease III [Sodalis glossinidius str. 'morsitans']
          Length = 226

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 81/224 (36%), Positives = 119/224 (53%), Gaps = 6/224 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L+K++GY F    LL +ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPILTNRLQKKLGYTFQQHDLLLQALTHRSASSKHNE---RLEFLGDSILSYVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F    EG++S    +LV   T +++ARE +L   +R+     K       SI AD VE
Sbjct: 58  QRFPRVDEGDMSRMRATLVRGNTLAEMAREFELGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I      +  +++ R   +  G  ++D KT LQE+   +    P Y+V 
Sbjct: 118 ALIGGVFLDSDIRTVEKLILDWYRSRLDEISPGDKQKDPKTRLQEYLQGRHLPLPTYQVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLK 221
              G  HD  FT+  ++SGLA P  G   S+R AEQ AA + LK
Sbjct: 178 QVRGEAHDQEFTIHCQVSGLAQPVVGNGSSRRKAEQAAAEQALK 221


>gi|167630237|ref|YP_001680736.1| ribonuclease iii [Heliobacterium modesticaldum Ice1]
 gi|226735377|sp|B0TGW4|RNC_HELMI RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|167592977|gb|ABZ84725.1| ribonuclease iii [Heliobacterium modesticaldum Ice1]
          Length = 235

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 79/220 (35%), Positives = 110/220 (50%), Gaps = 5/220 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSI----SHSYQESYERLEFLGDRILGLLISTLLFNH 62
           + L +RIG A  + + LE ALTH S       +  E  +RLEFLGD +LGL+I   LF  
Sbjct: 9   AELARRIGIASEDLATLEMALTHPSFVYENPQAPPEHNQRLEFLGDAVLGLVIGEQLFVR 68

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           + +  EGELS R  ++V     +  AR L L +++++             SI AD +E++
Sbjct: 69  YPTWTEGELSRRRAAVVCEANLADGARRLQLGAWLKLGRGEEASGGREKPSILADALEAV 128

Query: 123 IAALYLDGGIEVAGTF-VDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           I A++L GGIE A  F VD +    A        D KT  QEW          Y +   S
Sbjct: 129 IGAIFLSGGIEAARRFIVDLFGDALANAQNLVSGDNKTAFQEWVQRTGPADIRYCIVDES 188

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           GPDHD RF   V ++G   A G   +K+ AEQ AA   ++
Sbjct: 189 GPDHDKRFVAAVMVNGTVIADGQGRTKKEAEQQAAGRAMR 228


>gi|59712694|ref|YP_205470.1| ribonuclease III [Vibrio fischeri ES114]
 gi|197335272|ref|YP_002156886.1| ribonuclease III [Vibrio fischeri MJ11]
 gi|75431522|sp|Q5E314|RNC_VIBF1 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|59480795|gb|AAW86582.1| RNase III [Vibrio fischeri ES114]
 gi|197316762|gb|ACH66209.1| ribonuclease III [Vibrio fischeri MJ11]
          Length = 223

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 113/211 (53%), Gaps = 6/211 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LEK+IGY F + S L+ ALTH S + ++ E   RLEFLGD IL  +++  L++ F    E
Sbjct: 8   LEKKIGYQFKDESFLKLALTHRSANGTHNE---RLEFLGDSILSFVVADDLYHRFPKVDE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G++S    +LV   T +++ RE  L  ++ +     K       SI AD VE++I A+YL
Sbjct: 65  GDMSRMRATLVRGHTLAELGREFQLGDYLYLGPGELKSGGFRRDSILADAVEAIIGAIYL 124

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D   E     +  ++  R  +++ G  ++D KT LQE+   +    P Y VT   G  H+
Sbjct: 125 DSDTETVRGIILSWYNTRLESIEPGVSQKDPKTRLQEYLQGRRKPLPTYTVTKIKGEAHN 184

Query: 187 PRFTVVVEISGL-APAQGMDCSKRAAEQVAA 216
             FT+   ++GL  P  G   S+R AEQ AA
Sbjct: 185 QEFTIECIVAGLDKPVIGKGSSRRKAEQSAA 215


>gi|16271989|ref|NP_438187.1| ribonuclease III [Haemophilus influenzae Rd KW20]
 gi|260580682|ref|ZP_05848509.1| ribonuclease III [Haemophilus influenzae RdAW]
 gi|1173093|sp|P44441|RNC_HAEIN RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|1572958|gb|AAC21692.1| ribonuclease III (rnc) [Haemophilus influenzae Rd KW20]
 gi|260092744|gb|EEW76680.1| ribonuclease III [Haemophilus influenzae RdAW]
          Length = 227

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 122/223 (54%), Gaps = 17/223 (7%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE++IGY F + +LL++ALTH S +  + E   RLEFLGD IL   I+  L++ F    E
Sbjct: 7   LERKIGYRFNDIALLKQALTHRSAATQHNE---RLEFLGDSILNFTIAEALYHQFPRCNE 63

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS    +LV   T + +AR+ +L  ++ + S   K+      SI AD VE++I A+ L
Sbjct: 64  GELSRMRATLVREPTLAILARQFELGDYMSLGSGELKNGGFRRESILADCVEAIIGAMSL 123

Query: 129 DGGIEVAGTFVDKYWKQRAL---KSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           D G+ V  T V + W Q+ L   K G  ++DAKT LQE+   K    P Y+V    G  H
Sbjct: 124 DQGLAVT-TQVIRNWYQQLLAEIKPGDNQKDAKTRLQEYLQGKHLPLPTYEVVNIQGEAH 182

Query: 186 DPRFTVVVEISGLAPAQGMD-------CSKRAAEQVAAAEVLK 221
              FTV  ++     A+ +D        S+R AEQ AA ++LK
Sbjct: 183 CQIFTVKCKVKS---AEKIDRTFVAKGSSRRKAEQAAAEQILK 222


>gi|152993835|ref|YP_001359556.1| ribonuclease III [Sulfurovum sp. NBC37-1]
 gi|189043369|sp|A6QCJ0|RNC_SULNB RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|151425696|dbj|BAF73199.1| ribonuclease III [Sulfurovum sp. NBC37-1]
          Length = 223

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 79/222 (35%), Positives = 116/222 (52%), Gaps = 7/222 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           YS LEKR+ Y F ++ L+ +ALTH S    Y    ERLEFLGD +L L++   LF  F  
Sbjct: 4   YSQLEKRLNYTFKDKQLIIEALTHKSYKKPYNN--ERLEFLGDAVLDLIVGEYLFKKFPK 61

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
           + EG LS    SLV+    + +AR++DL S+I +S     +      S+ ++  E++I A
Sbjct: 62  SDEGILSKIRASLVNESGFTLLARKIDLGSYIYLSLAEENNNGRDKPSLLSNAFEAIIGA 121

Query: 126 LYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           +YL+ G++ A     K  ++    +      +D KT LQE   A   VTP Y++   SGP
Sbjct: 122 VYLEAGLDTAKEISIKLLEECHPKIDLQSLSKDYKTALQELTQATHAVTPGYEMLGSSGP 181

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAA---EVLKR 222
           DH   F + V +     A     SK+ A+Q AA    E LK+
Sbjct: 182 DHKKEFEIAVTLDNKTIATAKGKSKKDAQQKAAKIALEALKK 223


>gi|255320780|ref|ZP_05361955.1| ribonuclease III [Acinetobacter radioresistens SK82]
 gi|262379444|ref|ZP_06072600.1| ribonuclease III [Acinetobacter radioresistens SH164]
 gi|255302157|gb|EET81399.1| ribonuclease III [Acinetobacter radioresistens SK82]
 gi|262298901|gb|EEY86814.1| ribonuclease III [Acinetobacter radioresistens SH164]
          Length = 230

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 117/216 (54%), Gaps = 5/216 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L  RIGY F    LL+ ALTH S+SH Y  +YERLEFLGD +LG++I+  L++ +    E
Sbjct: 13  LPSRIGYQFKQPELLQLALTHRSVSHKY--NYERLEFLGDSLLGMIIANYLYHAYPFENE 70

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G L+    +LV  E   ++A +L L+  + +S+   K       SI AD VE++I A+Y+
Sbjct: 71  GRLTRMRATLVRQEALGKIANDLKLSQCLILSTGELKSGGHHRESILADTVEAIIGAIYI 130

Query: 129 DGG-IEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           D G +++    V K++      ++     +D K+ LQE+  A+    P Y+V    G   
Sbjct: 131 DCGELKILQDIVLKWYGPYLNNIEPTDQLKDPKSRLQEYLQARKKPLPVYEVVDIQGDAP 190

Query: 186 DPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           +  F V   +  L    G   S+R AEQ AAAE+LK
Sbjct: 191 NQHFKVECSVDSLPKFIGEGSSRRFAEQAAAAEILK 226


>gi|150390513|ref|YP_001320562.1| ribonuclease III [Alkaliphilus metalliredigens QYMF]
 gi|149950375|gb|ABR48903.1| Ribonuclease III [Alkaliphilus metalliredigens QYMF]
          Length = 239

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 82/221 (37%), Positives = 118/221 (53%), Gaps = 8/221 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLISTLLFNHFD 64
            E+ I Y F ++ LL++ALTHSS ++  +    +  ERLEFLGD +LG++IS  +F  + 
Sbjct: 14  FEEMIQYQFKDKQLLKEALTHSSYANESKVKKIKHNERLEFLGDSVLGIIISDYIFKKYT 73

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EG+L+    ++V        A +++L  F+R+             SI AD  E+LI 
Sbjct: 74  HLPEGDLTKVRANVVCEPALGSCATKINLGGFLRLGRGEEVSGGRQRESILADAFEALIG 133

Query: 125 ALYLDGGIEVAGTFVDKYW---KQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           ALYLDGG+ +A TFV  +     ++A K   FR D KT LQE   +K      Y+V   S
Sbjct: 134 ALYLDGGMVIAQTFVLNHLIDSVEQATKGSLFR-DYKTYLQELLQSKHSERITYQVIKES 192

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F V V +       GM  SK+ AEQ AA E +++
Sbjct: 193 GPDHSKIFDVEVLLGEQLLGHGMGKSKKEAEQRAAKEAVEK 233


>gi|332289238|ref|YP_004420090.1| ribonuclease III [Gallibacterium anatis UMN179]
 gi|330432134|gb|AEC17193.1| ribonuclease III [Gallibacterium anatis UMN179]
          Length = 226

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/223 (34%), Positives = 117/223 (52%), Gaps = 6/223 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+      L+ ++ Y F   +LL++ALTH S +    E  ERLEFLGD IL   I   L+
Sbjct: 1   MNNQHLDRLQNKLSYQFKKMALLQQALTHRSAA---SEHNERLEFLGDSILNFTIGEALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F  + EG+LS    +LV  +T +Q+A E DL  ++++     K      +SI +D VE
Sbjct: 58  HQFPKSAEGDLSRMRATLVREQTLAQIAIEFDLGEYLKLGPGELKSGGYRRSSILSDCVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           ++I A+YLD   E     +  +++QR   +K G  ++D KT LQE+        P Y V 
Sbjct: 118 AIIGAIYLDSNFEKVKETILNWYQQRLAEIKPGDNQKDPKTRLQEYLQGIRQPLPTYNVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVL 220
              G  H+  F V  +IS      +G+  S+R AEQ AA ++L
Sbjct: 178 EIKGEAHNQTFKVTCKISQSDTLFEGIGSSRRKAEQAAAEKIL 220


>gi|145630695|ref|ZP_01786474.1| ribonuclease III [Haemophilus influenzae R3021]
 gi|145641851|ref|ZP_01797426.1| ribonuclease III [Haemophilus influenzae R3021]
 gi|144983821|gb|EDJ91271.1| ribonuclease III [Haemophilus influenzae R3021]
 gi|145273473|gb|EDK13344.1| ribonuclease III [Haemophilus influenzae 22.4-21]
          Length = 227

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 121/222 (54%), Gaps = 15/222 (6%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE++IGY F + +LL++ALTH S +  + E   RLEFLGD IL   I+  L++ F    E
Sbjct: 7   LERKIGYRFNDIALLKQALTHRSAATQHNE---RLEFLGDSILNFTIAEALYHQFPRCNE 63

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS    +LV   T + +AR+ +L  ++ + S   K+      SI AD VE++I A+ L
Sbjct: 64  GELSRMRATLVREPTLAILARQFELGDYMSLGSGELKNGGFRRESILADCVEAIIGAMSL 123

Query: 129 DGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D G+ V    +  +++Q    +K G  ++DAKT LQE+   K    P Y+V    G  H 
Sbjct: 124 DQGLAVTTQVIRNWYQQLLAEIKPGDNQKDAKTRLQEYLQGKHLPLPTYEVVNIQGEAHC 183

Query: 187 PRFTVVVEISGLAPAQGMD-------CSKRAAEQVAAAEVLK 221
             FTV  ++     A+ +D        S+R AEQ AA ++LK
Sbjct: 184 QIFTVECKVKS---AEKIDRTFVAKGSSRRKAEQAAAEQILK 222


>gi|332305561|ref|YP_004433412.1| ribonuclease III [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172890|gb|AEE22144.1| ribonuclease III [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 227

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 81/219 (36%), Positives = 118/219 (53%), Gaps = 6/219 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y  L K++GY F + + L  ALTH S+  ++ E   RLEFLGD +LGL+I+  LF  F  
Sbjct: 7   YKPLYKKLGYEFQDPNNLTIALTHRSVGANHNE---RLEFLGDAVLGLVIAKALFERFPK 63

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG L+   +SLV  +T ++VARE  L   + +     K       SI AD VE++I A
Sbjct: 64  QPEGNLTRMRSSLVKGDTLAEVAREFALGDLLLLGPGELKSGGHRRDSILADAVEAIIGA 123

Query: 126 LYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           +Y + G++     +  ++ +R  AL      +D KT LQE+   +    PEY+V   SG 
Sbjct: 124 IYQEVGMQGCEPLILAWFAKRIEALNPDATPKDDKTRLQEYLQGRQLPLPEYEVIDISGK 183

Query: 184 DHDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLK 221
            HD  FTV   ++GL +P  G   S+R AEQ  A + L+
Sbjct: 184 SHDQTFTVKCTVAGLNSPIIGRGKSRRRAEQRTAKQALE 222


>gi|317009322|gb|ADU79902.1| ribonuclease III [Helicobacter pylori India7]
          Length = 239

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 120/221 (54%), Gaps = 8/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y  LEK +GY+F ++ LLE+ALTH S   +     ERLEFLGD +LGL+I  LL++ F  
Sbjct: 18  YIMLEKALGYSFKDKRLLEQALTHKSCKLALNN--ERLEFLGDAVLGLVIGELLYHKFYQ 75

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+LS    S+VS    +++A+ + L  ++RVSS           SI +   E+L+A 
Sbjct: 76  YDEGKLSKLRASIVSVHGFTKLAKAIALQDYLRVSSSEEVSNGREKPSILSSAFEALMAG 135

Query: 126 LYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +YL+ G+    ++    +++ +K+  L+      D KT LQE   A+F V P Y++    
Sbjct: 136 VYLEAGLAKVHKIMQNLLNRAYKRLDLEH--LFMDYKTALQELTQAQFCVIPTYQLLKEK 193

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GPDH   F + + I     A     SK+ AEQ  A + L++
Sbjct: 194 GPDHHKEFEMALYIQDKIYATAKGKSKKEAEQQCAYQALQK 234


>gi|307245400|ref|ZP_07527488.1| Ribonuclease 3 [Actinobacillus pleuropneumoniae serovar 1 str.
           4074]
 gi|306853741|gb|EFM85958.1| Ribonuclease 3 [Actinobacillus pleuropneumoniae serovar 1 str.
           4074]
          Length = 243

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 120/226 (53%), Gaps = 8/226 (3%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ ++   L+K++GY F N   L +ALTH S      ++ ERLEFLGD IL   I   LF
Sbjct: 18  MNNMQLERLQKKLGYQFTNLDYLLQALTHRSAGA---KNNERLEFLGDSILNFAIGKALF 74

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F  A EGELS    +LV  +T + +AR+  L  ++++ +   K       SI +D VE
Sbjct: 75  EKFPKANEGELSRMRATLVREQTLAILARQFGLGEYMKLGAGELKSGGYRRESILSDCVE 134

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRAL---KSGKFRRDAKTELQEWAHAKFGVTPEYKV 177
           ++IAA+YLD G++ A   V   W Q  L   K G  ++D KT LQE+   +    P Y+V
Sbjct: 135 AIIAAIYLDAGMDKAIEQVH-LWYQDLLAEMKPGDAQKDPKTRLQEFLQGRKLPLPTYEV 193

Query: 178 TFRSGPDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLKR 222
               G  H+  F V  +I  L     G+  S+R AEQ AA +VL +
Sbjct: 194 LDIKGEAHNQTFKVTCKIEMLEEIFIGIGTSRRKAEQNAAEQVLAK 239


>gi|291454392|ref|ZP_06593782.1| ribonuclease III [Streptomyces albus J1074]
 gi|291357341|gb|EFE84243.1| ribonuclease III [Streptomyces albus J1074]
          Length = 265

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 80/219 (36%), Positives = 120/219 (54%), Gaps = 6/219 (2%)

Query: 2   SALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLL 59
           +A  ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L
Sbjct: 18  TASSHTLLEGRLGYHLES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTL 76

Query: 60  FNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVV 119
           +       EG+L+    ++V++   ++V+R L+L SFIR+             SI AD +
Sbjct: 77  YRTHPDLPEGQLAKLRAAVVNSRALAEVSRGLELGSFIRLGRGEEGTGGRDKASILADTL 136

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKV 177
           E++I A+YLD G+E AG  V + +     KS       D KT LQE    +    PEY V
Sbjct: 137 EAVIGAVYLDQGLEAAGELVHRLFDPLIEKSSSLGAGLDWKTSLQELTATEGLGVPEYLV 196

Query: 178 TFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           T  +GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 197 T-ETGPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 234


>gi|32266198|ref|NP_860230.1| ribonuclease III [Helicobacter hepaticus ATCC 51449]
 gi|81666107|sp|Q7VIA9|RNC_HELHP RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|32262248|gb|AAP77296.1| ribonuclease III [Helicobacter hepaticus ATCC 51449]
          Length = 240

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 75/216 (34%), Positives = 112/216 (51%), Gaps = 4/216 (1%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LEK++GY F N+ LL +ALTH S    Y    ERLEFLGD +L LL+   LF  F  AKE
Sbjct: 13  LEKKLGYVFQNQQLLLEALTHKSCKKQYNN--ERLEFLGDAVLDLLVGEYLFKKFPLAKE 70

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS     +V+ +   ++A+ LDL +++ +S     +      SI ++  E+LI A+YL
Sbjct: 71  GELSKLRACIVNEKGFMKLAQSLDLGAYLYISQSEENNNGRQKASILSNAFEALIGAIYL 130

Query: 129 DGGIEVAGTFVDKYWKQRALKS--GKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           +  +    + +    +   +K        D KT LQE   A +G  P Y +   SGPDH 
Sbjct: 131 ESSLTYVQSIIYDLLEYNYIKIDLDSLFMDYKTALQEITQAFYGEIPTYTLISESGPDHK 190

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
             F + + + G   A+    SK+ A+Q +A    K+
Sbjct: 191 KSFEIALSVQGKEYARASGNSKKEAQQKSAQIAYKK 226


>gi|269468620|gb|EEZ80264.1| dsRNA-specific ribonuclease [uncultured SUP05 cluster bacterium]
          Length = 221

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 120/221 (54%), Gaps = 14/221 (6%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE++I Y F + SLL+ ALTH S+    + + ERLEFLGD ILGL+IS  L+  F    E
Sbjct: 4   LEQKIDYQFKDISLLKLALTHRSVG---KNNNERLEFLGDSILGLVISRELYKRFTHVDE 60

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS   + LV  +T +Q+A  LDL++ + + S   K       SIQADVVE++  A++L
Sbjct: 61  GKLSRLRSHLVRGQTLAQLASTLDLSNILILGSGELKSGGFRRESIQADVVEAIFGAVFL 120

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D   +   T + K +K+R   +      +D KT+LQE+   +    P+Y++    G DH+
Sbjct: 121 DSDFDTVNTVILKLYKERLDIINPNDSLKDFKTQLQEYLQKRGNALPKYELIKTVGKDHN 180

Query: 187 PRFTVVVEISGLAPAQGMDCSKRA-----AEQVAAAEVLKR 222
             FT+   +      Q M   ++A     AEQ  A  +L R
Sbjct: 181 AVFTINCSLQD----QNMKVKQKATSIKRAEQSCAQALLDR 217


>gi|47168737|pdb|1RC7|A Chain A, Crystal Structure Of Rnase Iii Mutant E110k From Aquifex
           Aeolicus Complexed With Ds-Rna At 2.15 Angstrom
           Resolution
          Length = 220

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 82/218 (37%), Positives = 122/218 (55%), Gaps = 14/218 (6%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LEK++GY F ++SLLEKALTH  +S+S +E YE LEFLGD ++   I  LL  +  + +E
Sbjct: 7   LEKKLGYTFKDKSLLEKALTH--VSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKRE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G LS     L+S E  + +A++L+L  FIR+             +I  DV ++L AA+Y+
Sbjct: 65  GFLSPLKAYLISEEFFNLLAQKLELHKFIRIKR------GKINETIIGDVFKALWAAVYI 118

Query: 129 DGGIEVAGT--FVDKYWKQ---RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           D G +   T     K +K+    A+K G+ ++D KT LQE    ++   PEY++    GP
Sbjct: 119 DSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGP 178

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
            H  +F V  +I       G   SK+ AEQ AA E++K
Sbjct: 179 HHKKKFIVEAKIKEYRTL-GEGKSKKEAEQRAAEELIK 215


>gi|148827174|ref|YP_001291927.1| ribonuclease III [Haemophilus influenzae PittGG]
 gi|189043320|sp|A5UFI8|RNC_HAEIG RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|148718416|gb|ABQ99543.1| ribonuclease III [Haemophilus influenzae PittGG]
          Length = 227

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 121/222 (54%), Gaps = 15/222 (6%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE++IGY F + +LL++ALTH S +  + E   RLEFLGD IL   I+  L++ F    E
Sbjct: 7   LERKIGYRFNDIALLKQALTHRSAATQHNE---RLEFLGDSILNFTIAEALYHQFPRCNE 63

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS    +LV   T + +AR+ +L  ++ + S   K+      SI AD VE++I A+ L
Sbjct: 64  GELSRMRATLVREPTLAILARQFELGDYMSLGSGELKNGGFRRESILADCVEAIIGAMSL 123

Query: 129 DGGIEVAGTFVDKYWKQRAL---KSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           D G+ V  T V + W Q+ L   K G  ++DAKT LQE+   K    P Y+V    G  H
Sbjct: 124 DQGLAVT-TQVIRNWYQQLLAEIKPGDNQKDAKTRLQEYLQGKHLPLPTYEVVNIQGEAH 182

Query: 186 DPRFTVVVEISGLAP------AQGMDCSKRAAEQVAAAEVLK 221
              FTV  ++           A+G   S+R AEQ AA ++LK
Sbjct: 183 CQIFTVECKVKSAGKIDRTFVAKG--SSRRKAEQAAAEQILK 222


>gi|90101637|sp|Q3IDL2|RNC_PSEHT RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
          Length = 225

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 80/217 (36%), Positives = 118/217 (54%), Gaps = 5/217 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L K I Y FA++ LLE+A+TH S  H  Q + ERLEFLGD IL  +I+  L+  F  A
Sbjct: 6   TELYKTIDYIFADQGLLEQAMTHRS--HKGQHN-ERLEFLGDSILSFVIANALYAKFPKA 62

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           +EG+LS   ++LV  +T ++   E  L  ++R+     K       S  AD VE++I A+
Sbjct: 63  REGDLSRMRSTLVRGQTLAEFGLEFGLGDYLRLGPGELKSGGFRRESTLADAVEAIIGAV 122

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           +LD  IE  G  +  ++++R  A+  G  ++D KT LQE   A+    P Y V    G  
Sbjct: 123 FLDSDIERCGELILSWYEERLNAISPGLNQKDPKTLLQEHLQARKLSLPGYTVVDTKGQA 182

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           H+  FTV   + G+     +  S+R AEQ AA + LK
Sbjct: 183 HNQTFTVECIVDGMDSIISVGSSRRKAEQKAAEKALK 219


>gi|169632753|ref|YP_001706489.1| ribonuclease III [Acinetobacter baumannii SDF]
 gi|238688259|sp|B0VTM5|RNC_ACIBS RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|169151545|emb|CAP00312.1| ribonuclease III, ds RNA [Acinetobacter baumannii]
          Length = 230

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 115/213 (53%), Gaps = 5/213 (2%)

Query: 12  RIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGEL 71
           RIGY F    LL+ ALTH S+SH Y  +YERLEFLGD +LG++I+  L++ +    EG L
Sbjct: 16  RIGYQFKQPELLQLALTHRSVSHKY--NYERLEFLGDSLLGMIIANYLYHAYPHENEGRL 73

Query: 72  SVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGG 131
           +    +LV  E   ++A +L L+  + +S+   K       SI AD VE++I A+YLD  
Sbjct: 74  TRMRATLVRQEALGKIATDLQLSRCLILSTGELKSGGHHRESILADTVEAIIGAIYLDSS 133

Query: 132 -IEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
            + +    V K++      ++     +D K+ LQE+  A+    P Y+V    G      
Sbjct: 134 DLNLLKDIVLKWYTPYLDHIEPTDQLKDPKSRLQEYLQARKKPLPVYEVVDIQGDAPHQH 193

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           F V   + GL+   G   S+R AEQ AAAE+LK
Sbjct: 194 FKVECLVDGLSKIHGEGASRRFAEQAAAAEILK 226


>gi|15603994|ref|NP_220509.1| ribonuclease III [Rickettsia prowazekii str. Madrid E]
 gi|6226018|sp|Q9ZE31|RNC_RICPR RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|3860685|emb|CAA14586.1| RIBONUCLEASE III (rnc) [Rickettsia prowazekii]
          Length = 225

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 115/221 (52%), Gaps = 5/221 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSI----SHSYQESYERLEFLGDRILGLLISTLLFN 61
           +  LE  +GY+F N+ LL +AL+H S+     + Y + YERLEFLGD +L LLI+ +LF 
Sbjct: 4   FEKLETLLGYSFKNKELLIEALSHPSLRQYHEYKYDKDYERLEFLGDAVLNLLITEILFK 63

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVES 121
           +F++ KEG L+   + LV  ET   V  +L L  +I ++            +   +  E+
Sbjct: 64  NFENYKEGNLAKIRSYLVCKETICIVGTKLALKDYIIMTHGEEVAGGRDNPNNIENATEA 123

Query: 122 LIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           LIAA+YLD  IE+    ++K W +          D KT LQEWA A     P Y++  R 
Sbjct: 124 LIAAIYLDSNIEITHNIIEKLWAEFMKVQNLTDYDPKTALQEWAQANSHHLPIYRLIKRE 183

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           G  H   FTV+V++           S + AE+ AA  +L R
Sbjct: 184 GAAHSSIFTVLVKVKDYEQT-CTGYSIKEAEKKAARSLLHR 223


>gi|90109239|pdb|2EZ6|A Chain A, Crystal Structure Of Aquifex Aeolicus Rnase Iii (D44n)
           Complexed With Product Of Double-Stranded Rna Processing
 gi|90109240|pdb|2EZ6|B Chain B, Crystal Structure Of Aquifex Aeolicus Rnase Iii (D44n)
           Complexed With Product Of Double-Stranded Rna Processing
          Length = 221

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 82/218 (37%), Positives = 122/218 (55%), Gaps = 14/218 (6%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LEK++GY F ++SLLEKALTH  +S+S +E YE LEFLG+ ++   I  LL  +  + +E
Sbjct: 7   LEKKLGYTFKDKSLLEKALTH--VSYSKKEHYETLEFLGNALVNFFIVDLLVQYSPNKRE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G LS     L+S E  + +A++L+L  FIR+             +I  DV E+L AA+Y+
Sbjct: 65  GFLSPLKAYLISEEFFNLLAQKLELHKFIRIKR------GKINETIIGDVFEALWAAVYI 118

Query: 129 DGGIEVAGT--FVDKYWKQ---RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           D G +   T     K +K+    A+K G+ ++D KT LQE    ++   PEY++    GP
Sbjct: 119 DSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGP 178

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
            H  +F V  +I       G   SK+ AEQ AA E++K
Sbjct: 179 HHKKKFIVEAKIKEYRTL-GEGKSKKEAEQRAAEELIK 215


>gi|220931875|ref|YP_002508783.1| Ribonuclease III [Halothermothrix orenii H 168]
 gi|219993185|gb|ACL69788.1| Ribonuclease III [Halothermothrix orenii H 168]
          Length = 236

 Score =  122 bits (306), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 77/214 (35%), Positives = 111/214 (51%), Gaps = 6/214 (2%)

Query: 17  FANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLISTLLFNHFDSAKEGELS 72
           F + SLL+KA+TH S  H       E  ERLEFLGD +L ++IST L+ +F    EGEL+
Sbjct: 21  FNDISLLQKAVTHKSFVHEKSDPDLEDNERLEFLGDSVLSIVISTYLYKNFPEYNEGELA 80

Query: 73  VRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGI 132
                +VS+   +  AREL L  +I +      +      SI AD +E++I A+YLD G 
Sbjct: 81  KMRAYIVSSSHLACKARELGLGKYILMGKGEELNGGRERESILADTLEAVIGAIYLDQGF 140

Query: 133 EVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFT 190
                 +  ++K   + L  G   RD KT LQE+         +Y +    GPDH+ +F 
Sbjct: 141 NTITDLLINFFKDDVKKLDQGNIIRDYKTYLQEFIQKDGSCEIKYNIINEYGPDHNKKFE 200

Query: 191 VVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           V V+++G    +G   SK+ AEQ AA + L   G
Sbjct: 201 VGVKVNGKELGRGTGFSKKEAEQKAAKDALSNLG 234


>gi|83753758|pdb|1YYO|A Chain A, Crystal Structure Of Rnase Iii Mutant E110k From Aquifex
           Aeolicus Complexed With Double-Stranded Rna At 2.9-
           Angstrom Resolution
 gi|83753759|pdb|1YYO|B Chain B, Crystal Structure Of Rnase Iii Mutant E110k From Aquifex
           Aeolicus Complexed With Double-Stranded Rna At 2.9-
           Angstrom Resolution
          Length = 221

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 82/218 (37%), Positives = 122/218 (55%), Gaps = 14/218 (6%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LEK++GY F ++SLLEKALTH  +S+S +E YE LEFLGD ++   I  LL  +  + +E
Sbjct: 7   LEKKLGYTFKDKSLLEKALTH--VSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKRE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G LS     L+S E  + +A++L+L  FIR+             +I  DV ++L AA+Y+
Sbjct: 65  GFLSPLKAYLISEEFFNLLAQKLELHKFIRIKR------GKINETIIGDVFKALWAAVYI 118

Query: 129 DGGIEVAGT--FVDKYWKQ---RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           D G +   T     K +K+    A+K G+ ++D KT LQE    ++   PEY++    GP
Sbjct: 119 DSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGP 178

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
            H  +F V  +I       G   SK+ AEQ AA E++K
Sbjct: 179 HHKKKFIVEAKIKEYRTL-GEGKSKKEAEQRAAEELIK 215


>gi|239982550|ref|ZP_04705074.1| ribonuclease III [Streptomyces albus J1074]
          Length = 260

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 80/219 (36%), Positives = 120/219 (54%), Gaps = 6/219 (2%)

Query: 2   SALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLL 59
           +A  ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L
Sbjct: 13  TASSHTLLEGRLGYHLES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTL 71

Query: 60  FNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVV 119
           +       EG+L+    ++V++   ++V+R L+L SFIR+             SI AD +
Sbjct: 72  YRTHPDLPEGQLAKLRAAVVNSRALAEVSRGLELGSFIRLGRGEEGTGGRDKASILADTL 131

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKV 177
           E++I A+YLD G+E AG  V + +     KS       D KT LQE    +    PEY V
Sbjct: 132 EAVIGAVYLDQGLEAAGELVHRLFDPLIEKSSSLGAGLDWKTSLQELTATEGLGVPEYLV 191

Query: 178 TFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           T  +GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 192 T-ETGPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 229


>gi|169795096|ref|YP_001712889.1| ribonuclease III [Acinetobacter baumannii AYE]
 gi|239501066|ref|ZP_04660376.1| ribonuclease III [Acinetobacter baumannii AB900]
 gi|260556582|ref|ZP_05828800.1| ribonuclease III [Acinetobacter baumannii ATCC 19606]
 gi|301345824|ref|ZP_07226565.1| ribonuclease III [Acinetobacter baumannii AB056]
 gi|301512403|ref|ZP_07237640.1| ribonuclease III [Acinetobacter baumannii AB058]
 gi|301594764|ref|ZP_07239772.1| ribonuclease III [Acinetobacter baumannii AB059]
 gi|332851055|ref|ZP_08433164.1| ribonuclease III [Acinetobacter baumannii 6013150]
 gi|332869696|ref|ZP_08438884.1| ribonuclease III [Acinetobacter baumannii 6013113]
 gi|332875945|ref|ZP_08443731.1| ribonuclease III [Acinetobacter baumannii 6014059]
 gi|238685526|sp|A3M7P2|RNC_ACIBT RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|238688097|sp|B0VCU0|RNC_ACIBY RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|169148023|emb|CAM85886.1| ribonuclease III, ds RNA [Acinetobacter baumannii AYE]
 gi|193078016|gb|ABO12936.2| ribonuclease III [Acinetobacter baumannii ATCC 17978]
 gi|260409841|gb|EEX03141.1| ribonuclease III [Acinetobacter baumannii ATCC 19606]
 gi|332730219|gb|EGJ61544.1| ribonuclease III [Acinetobacter baumannii 6013150]
 gi|332732598|gb|EGJ63831.1| ribonuclease III [Acinetobacter baumannii 6013113]
 gi|332735811|gb|EGJ66852.1| ribonuclease III [Acinetobacter baumannii 6014059]
          Length = 230

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 115/213 (53%), Gaps = 5/213 (2%)

Query: 12  RIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGEL 71
           RIGY F    LL+ ALTH S+SH Y  +YERLEFLGD +LG++I+  L++ +    EG L
Sbjct: 16  RIGYQFKQPELLQLALTHRSVSHKY--NYERLEFLGDSLLGMIIANYLYHAYPHENEGRL 73

Query: 72  SVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGG 131
           +    +LV  E   ++A +L L+  + +S+   K       SI AD VE++I A+YLD  
Sbjct: 74  TRMRATLVRQEALGKIATDLQLSRCLILSTGELKSGGHHRESILADTVEAIIGAIYLDSS 133

Query: 132 -IEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
            + +    V K++      ++     +D K+ LQE+  A+    P Y+V    G      
Sbjct: 134 DLNLLKDIVLKWYTPYLDHIEPTDQLKDPKSRLQEYLQARKKPLPVYEVVDIQGDAPHQH 193

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           F V   + GL+   G   S+R AEQ AAAE+LK
Sbjct: 194 FKVECLVDGLSKIHGEGSSRRFAEQAAAAEILK 226


>gi|167751472|ref|ZP_02423599.1| hypothetical protein EUBSIR_02468 [Eubacterium siraeum DSM 15702]
 gi|167655280|gb|EDR99409.1| hypothetical protein EUBSIR_02468 [Eubacterium siraeum DSM 15702]
 gi|291557094|emb|CBL34211.1| RNAse III [Eubacterium siraeum V10Sc8a]
          Length = 226

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 87/228 (38%), Positives = 121/228 (53%), Gaps = 11/228 (4%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHS-YQESYERLEFLGDRILGLLISTLLFNHFDS 65
           + LE+ IGY F N  LL++ALTHSS ++  +  S ERLEFLGD +L +++S  LF +  +
Sbjct: 2   TELEQIIGYTFKNPELLKEALTHSSYTNGKHLRSNERLEFLGDSVLSIVVSEHLFENLTN 61

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+L+    S+V        AR++DL  +I +             SI AD  E+LIAA
Sbjct: 62  LPEGQLTKIRASVVCENALYPFARKIDLGKYIFLGKGEEHTGGRDRHSILADAFEALIAA 121

Query: 126 LYLDGGIEVAGTFVDKYWKQ-RALKSGKF-RRDAKTELQEWAHAKFGVTPEYKVTF---- 179
           +YLDGG E A +F+  +      L +GKF   D KT LQE         PE +VT+    
Sbjct: 122 IYLDGGFEAARSFILPFIPPLDKLSTGKFLLGDYKTVLQEIIQQ----NPEERVTYEISD 177

Query: 180 RSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIWT 227
            SG  H+ +FT  V ++G     G   SK+ AEQ AA E +   G  T
Sbjct: 178 ESGQAHNKQFTANVLLNGQIIGTGKGKSKKEAEQSAAKEAISLMGYET 225


>gi|300724126|ref|YP_003713443.1| RNase III, ds RNA [Xenorhabdus nematophila ATCC 19061]
 gi|297630660|emb|CBJ91325.1| RNase III, ds RNA [Xenorhabdus nematophila ATCC 19061]
          Length = 226

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 79/225 (35%), Positives = 122/225 (54%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+A+  + L+ ++GY F    LL +ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNAILTNRLQHKLGYTFTQHDLLLQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE +L   +R+     K       SI AD +E
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAELAREFELGECLRLGPGELKSGGHRRESILADSIE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI A++LD  I+     +  +++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGAIFLDSDIQTIEKIILNWYETRLNEISPGDKQKDPKTRLQEYLQGRHLPLPTYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SG   P +G+  S+R AEQ AA + LK+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGFEQPVRGVGSSRRKAEQAAAEQALKQ 222


>gi|192359963|ref|YP_001983041.1| ribonuclease III [Cellvibrio japonicus Ueda107]
 gi|190686128|gb|ACE83806.1| ribonuclease III [Cellvibrio japonicus Ueda107]
          Length = 225

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 81/224 (36%), Positives = 120/224 (53%), Gaps = 6/224 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M  L+Y  LE+R+GY+F ++  L+ ALTH S   S   + ERLEFLGD IL  LI   LF
Sbjct: 1   MINLKYQRLEQRLGYSFNDQRQLQLALTHRSHGAS---NNERLEFLGDSILNFLIGEALF 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
              D A+EG++S   + LV  +T +++ARE +L   + +     K       SI AD VE
Sbjct: 58  LRLDEAREGQMSRLRSQLVRGDTLAELAREFELGECLVLGEGELKSGGHRRDSILADAVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           ++I A+YL+ G++     V  ++  R  A+      +D K+ LQE+  A+    PEY+V 
Sbjct: 118 AIIGAIYLESGLDTCRERVLAWYGDRLDAISLDTSAKDPKSRLQEYLQAQRQPLPEYRVV 177

Query: 179 FRSGPDHDPRFTVVVEIS-GLAPAQGMDCSKRAAEQVAAAEVLK 221
              G  H   FT+   ++      Q    S+R AE+ AAA +LK
Sbjct: 178 EVGGEGHAQVFTIECHVAIAKQSTQAQASSRREAEKQAAAAMLK 221


>gi|319774962|ref|YP_004137450.1| Ribonuclease III [Haemophilus influenzae F3047]
 gi|329123136|ref|ZP_08251706.1| ribonuclease III [Haemophilus aegyptius ATCC 11116]
 gi|317449553|emb|CBY85758.1| Ribonuclease III [Haemophilus influenzae F3047]
 gi|327471691|gb|EGF17133.1| ribonuclease III [Haemophilus aegyptius ATCC 11116]
          Length = 227

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 120/222 (54%), Gaps = 15/222 (6%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE++IGY F +  LL++ALTH S +  + E   RLEFLGD IL   I+  L++ F    E
Sbjct: 7   LERKIGYCFNDIVLLKQALTHRSAATQHNE---RLEFLGDSILNFTIAEALYHQFPRCNE 63

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS    +LV   T + +AR+ +L  ++ + S   K+      SI AD VE++I A+ L
Sbjct: 64  GELSRMRATLVRESTLAILARQFELGDYMSLGSGELKNGGFRRESILADCVEAIIGAMSL 123

Query: 129 DGGIEVAGTFVDKYWKQRAL---KSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           D G+ V  T V + W Q+ L   K G  ++DAKT LQE+   K    P Y+V    G  H
Sbjct: 124 DQGLAVT-TQVIRNWYQQLLAEIKPGDNQKDAKTRLQEYLQGKHLPLPTYEVINIQGEAH 182

Query: 186 DPRFTVVVEISGLAP------AQGMDCSKRAAEQVAAAEVLK 221
              FTV  ++           A+G   S+R AEQ AA ++LK
Sbjct: 183 CQIFTVKCKVKSAGKIDRTFVAKG--SSRRKAEQAAAEQILK 222


>gi|319896432|ref|YP_004134625.1| ribonuclease iii [Haemophilus influenzae F3031]
 gi|317431934|emb|CBY80282.1| Ribonuclease III [Haemophilus influenzae F3031]
          Length = 227

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 120/222 (54%), Gaps = 15/222 (6%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE++IGY F +  LL++ALTH S +  + E   RLEFLGD IL   I+  L++ F    E
Sbjct: 7   LERKIGYCFNDIVLLKQALTHRSAATQHNE---RLEFLGDSILNFTIAEALYHQFPRCNE 63

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS    +LV   T + +AR+ +L  ++ + S   K+      SI AD VE++I A+ L
Sbjct: 64  GELSRMRATLVRESTLAILARQFELGDYMSLGSGELKNGGFRRESILADCVEAIIGAMSL 123

Query: 129 DGGIEVAGTFVDKYWKQRAL---KSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           D G+ V  T V + W Q+ L   K G  ++DAKT LQE+   K    P Y+V    G  H
Sbjct: 124 DQGLAVT-TQVIRNWYQQLLAEIKPGDNQKDAKTRLQEYLQGKHLPLPTYEVVNIQGEAH 182

Query: 186 DPRFTVVVEISGLAP------AQGMDCSKRAAEQVAAAEVLK 221
              FTV  ++           A+G   S+R AEQ AA ++LK
Sbjct: 183 CQIFTVECKVKSAGKIDRTFVAKG--SSRRKAEQAAAEQILK 222


>gi|260220751|emb|CBA28629.1| Ribonuclease 3 [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 224

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 85/219 (38%), Positives = 121/219 (55%), Gaps = 8/219 (3%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L++R+ + F+N SLL +ALTH S S  +   YERLEFLGD +LGL IS LL++   + 
Sbjct: 2   TALQQRLQHQFSNVSLLSRALTHRSFSADH---YERLEFLGDSVLGLAISDLLYSRLGNL 58

Query: 67  KEGELS-VRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
            EG+LS VR N LV  ET  Q+A +L L   +++     +       SI AD +E++I A
Sbjct: 59  PEGDLSRVRAN-LVRQETLHQLALKLGLPDVLKLGEGEMRSGGPKRASILADALEAIIGA 117

Query: 126 LYLDGGIEVAGTFVDKYWKQRALKS--GKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           +YLD G   A   V + ++   +        +DAKTELQEW   +    P Y V    G 
Sbjct: 118 VYLDAGFAKAQALVHRLFEAVEINPQMQAIGKDAKTELQEWLQGRKMKLPLYTVVGTIGA 177

Query: 184 DHDPRFTVVVEISGLAPAQ-GMDCSKRAAEQVAAAEVLK 221
            H   F V  E+  L  ++ G+  S+RA EQ AAA +L+
Sbjct: 178 AHKQSFDVECEVPELRLSERGIGGSRRAGEQAAAAAMLQ 216


>gi|184159116|ref|YP_001847455.1| ribonuclease III [Acinetobacter baumannii ACICU]
 gi|183210710|gb|ACC58108.1| dsRNA-specific ribonuclease [Acinetobacter baumannii ACICU]
          Length = 234

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 115/213 (53%), Gaps = 5/213 (2%)

Query: 12  RIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGEL 71
           RIGY F    LL+ ALTH S+SH Y  +YERLEFLGD +LG++I+  L++ +    EG L
Sbjct: 20  RIGYQFKQPELLQLALTHRSVSHKY--NYERLEFLGDSLLGMIIANYLYHAYPHENEGRL 77

Query: 72  SVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGG 131
           +    +LV  E   ++A +L L+  + +S+   K       SI AD VE++I A+YLD  
Sbjct: 78  TRMRATLVRQEALGKIATDLQLSRCLILSTGELKSGGHHRESILADTVEAIIGAIYLDSS 137

Query: 132 -IEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
            + +    V K++      ++     +D K+ LQE+  A+    P Y+V    G      
Sbjct: 138 DLNLLKDIVLKWYTPYLDHIEPTDQLKDPKSRLQEYLQARKKPLPVYEVVDIQGDAPHQH 197

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           F V   + GL+   G   S+R AEQ AAAE+LK
Sbjct: 198 FKVECLVDGLSKIHGEGSSRRFAEQAAAAEILK 230


>gi|298381809|ref|ZP_06991408.1| LOW QUALITY PROTEIN: ribonuclease III [Escherichia coli FVEC1302]
 gi|298279251|gb|EFI20765.1| LOW QUALITY PROTEIN: ribonuclease III [Escherichia coli FVEC1302]
          Length = 215

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 78/217 (35%), Positives = 120/217 (55%), Gaps = 6/217 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L++++GY F ++ LL++ALTH S S  + E   RLEFLGD IL  +I+  L++ F    E
Sbjct: 1   LQRKLGYTFNHQELLQQALTHRSASSKHNE---RLEFLGDSILSYVIANALYHRFPRVDE 57

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G++S    +LV   T +++ARE +L   +R+     K       SI AD VE+LI  ++L
Sbjct: 58  GDMSRMRATLVRGNTLAELAREFELGECLRLGPGELKSGGFRRESILADTVEALIGGVFL 117

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  I+     +  +++ R   +  G  ++D KT LQE+   +    P Y V    G  HD
Sbjct: 118 DSDIQTVEKLILNWYQTRLDEISPGDKQKDPKTRLQEYLQGRHLPLPTYLVVQVRGEAHD 177

Query: 187 PRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
             FT+  ++SGL+ P  G   S+R AEQ AA + LK+
Sbjct: 178 QEFTIHCQVSGLSEPVVGTGSSRRKAEQAAAEQALKK 214


>gi|332525373|ref|ZP_08401536.1| ribonuclease III [Rubrivivax benzoatilyticus JA2]
 gi|332108645|gb|EGJ09869.1| ribonuclease III [Rubrivivax benzoatilyticus JA2]
          Length = 241

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 79/220 (35%), Positives = 121/220 (55%), Gaps = 6/220 (2%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFD 64
           R+  L++R+G+ F   +L+ +ALTH S      E  ERLEFLGD +L   +S LL+  F 
Sbjct: 4   RHDALQQRLGHRFTRTALMTRALTHRSWG---AEHNERLEFLGDSVLNCAVSALLYERFS 60

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
            + EG+L+     LV  ++  +VA  L L+  +R+S    +   +   SI AD VE+LI 
Sbjct: 61  GSDEGDLTRVRAHLVREDSLHRVALTLGLSEVLRMSEGEMRGGGAQRPSILADAVEALIG 120

Query: 125 ALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           A++LDGG + A   V + + +   A ++  + +DAKTELQEW  A+    P Y++    G
Sbjct: 121 AIFLDGGFDPALATVRRLFGEVIAATEADAWSKDAKTELQEWLQARRLPVPAYRIVATRG 180

Query: 183 PDHDPRFTVVVEISGLAPAQ-GMDCSKRAAEQVAAAEVLK 221
             H   F V   ++ L  A+ G   S+R AEQ AA  +L+
Sbjct: 181 EKHAQTFEVECAVATLGLAERGEGRSRRTAEQEAARRLLE 220


>gi|54297783|ref|YP_124152.1| ribonuclease III [Legionella pneumophila str. Paris]
 gi|148359410|ref|YP_001250617.1| ribonuclease III [Legionella pneumophila str. Corby]
 gi|296107456|ref|YP_003619157.1| ribonuclease III [Legionella pneumophila 2300/99 Alcoy]
 gi|81370372|sp|Q5X446|RNC_LEGPA RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|189043325|sp|A5ID21|RNC_LEGPC RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|53751568|emb|CAH12986.1| hypothetical protein lpp1834 [Legionella pneumophila str. Paris]
 gi|148281183|gb|ABQ55271.1| ribonuclease III [Legionella pneumophila str. Corby]
 gi|295649358|gb|ADG25205.1| ribonuclease III [Legionella pneumophila 2300/99 Alcoy]
          Length = 224

 Score =  122 bits (305), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 119/217 (54%), Gaps = 6/217 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L +R+ Y F N + L++ALTH S      ++YER EFLGD IL  +I+  LFN F    E
Sbjct: 8   LCRRLNYHFNNIAYLKQALTHCSAG---SDNYERFEFLGDSILSFVIANELFNRFPLHSE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS   + LV  E  +++ARE+ L  ++ +     +      TSI AD +E+++AA+YL
Sbjct: 65  GQLSRLRSFLVKGEMLAEIAREIGLGDYLFLGQGELRSGGFRRTSILADALEAILAAIYL 124

Query: 129 DGGIEVAGTFVDKYWKQRALKS--GKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           DGG+  A   +   +  R          +DAKT+LQE+  A     PEY +T   G +H 
Sbjct: 125 DGGMTAAKQIILMLYSSRLDDPDLNHCLKDAKTQLQEFLQASKFALPEYVLTKIEGDEHA 184

Query: 187 PRFTVVVEISGLAP-AQGMDCSKRAAEQVAAAEVLKR 222
             F V   I G++  A G   ++R AEQ+AA  +L++
Sbjct: 185 QIFHVTCTIEGVSQVAYGTGPNRRKAEQLAAKAMLEQ 221


>gi|292571710|gb|ADE29625.1| Ribonuclease III [Rickettsia prowazekii Rp22]
          Length = 225

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 115/221 (52%), Gaps = 5/221 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSI----SHSYQESYERLEFLGDRILGLLISTLLFN 61
           +  LE  +GY+F N+ LL +AL+H S+     + Y + YERLEFLGD +L LLI+ +LF 
Sbjct: 4   FEKLETLLGYSFKNKELLIEALSHPSLRQYHEYKYDKDYERLEFLGDAVLNLLITEILFK 63

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVES 121
           +F++ KEG L+   + LV  ET   V  +L L  +I ++            +   +  E+
Sbjct: 64  NFENYKEGNLAKIRSYLVCKETICIVGTKLALKDYIIMTHGEEVAGGRDNPNNIENATEA 123

Query: 122 LIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           LIAA+YLD  IE+    ++K W +          D KT LQEWA A     P Y++  R 
Sbjct: 124 LIAAIYLDSNIEITHNIIEKLWAEFMKVQNFTDYDPKTALQEWAQANSHHLPIYRLIKRE 183

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           G  H   FTV+V++           S + AE+ AA  +L R
Sbjct: 184 GAAHSSIFTVLVKVKDYEQT-CTGYSIKEAEKKAARSLLHR 223


>gi|217970713|ref|YP_002355947.1| ribonuclease III [Thauera sp. MZ1T]
 gi|217508040|gb|ACK55051.1| ribonuclease III [Thauera sp. MZ1T]
          Length = 222

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 82/211 (38%), Positives = 112/211 (53%), Gaps = 6/211 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L+ R+G+AF++  LL++ALTH S     Q + ER EFLGD +L  ++S  LF  F   +E
Sbjct: 5   LQARLGHAFSDVRLLQEALTHRSFG---QPNNERFEFLGDAVLDCVVSIALFGRFGELRE 61

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS    SLV  +T  ++A EL+L   +R+     K   S   SI AD +E+L AA+YL
Sbjct: 62  GELSRVRASLVRQDTLHRLALELELGDCLRLGEGELKSGGSRRPSILADALEALFAAVYL 121

Query: 129 DGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D G E A   +D+ +      +   K  +D KT LQEW  A+    P Y +    G  H 
Sbjct: 122 DAGFEAAKGVIDRLYAPLIAEVDPCKPSKDPKTALQEWLQARRIPVPSYTMVEIVGEAHA 181

Query: 187 PRFTVVVEISGLA-PAQGMDCSKRAAEQVAA 216
             F V  EI  LA    G   S+R AEQ +A
Sbjct: 182 QEFEVACEIPKLAVRTLGRGPSRRIAEQQSA 212


>gi|212710663|ref|ZP_03318791.1| hypothetical protein PROVALCAL_01729 [Providencia alcalifaciens DSM
           30120]
 gi|212686744|gb|EEB46272.1| hypothetical protein PROVALCAL_01729 [Providencia alcalifaciens DSM
           30120]
          Length = 226

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 118/224 (52%), Gaps = 6/224 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+      L++++GY F    LL +ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPSLLEKLQRKLGYTFKQNDLLIQALTHRSASSKHNE---RLEFLGDSILSFVIANDLY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE +L   +R+     K       SI AD VE
Sbjct: 58  HRFPKVDEGDMSRMRATLVRGNTLAEIAREFELGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  ++K R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGIFLDSDIQTIEKIILAWYKARLDEISPGDKQKDPKTRLQEYLQGRHLPLPNYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLK 221
              G  HD  FT+  ++SG+  P  G+  S+R AEQ AA + LK
Sbjct: 178 LVKGEAHDQEFTIHCQVSGIEEPIHGIGSSRRKAEQAAAEQALK 221


>gi|291530279|emb|CBK95864.1| RNAse III [Eubacterium siraeum 70/3]
          Length = 226

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 87/228 (38%), Positives = 120/228 (52%), Gaps = 11/228 (4%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHS-YQESYERLEFLGDRILGLLISTLLFNHFDS 65
           + LE+ IGY F N  LL++ALTHSS ++  +  S ERLEFLGD +L +++S  LF +  +
Sbjct: 2   TELEQIIGYTFKNPELLKEALTHSSYTNGKHLRSNERLEFLGDSVLSIVVSEHLFENLTN 61

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+L+    S+V        AR++DL  +I +             SI AD  E+LIAA
Sbjct: 62  LPEGQLTKIRASVVCENALYPFARKIDLGKYIFLGKGEEHTGGRDRHSILADAFEALIAA 121

Query: 126 LYLDGGIEVAGTFVDKYWKQ-RALKSGKF-RRDAKTELQEWAHAKFGVTPEYKVTF---- 179
           +YLDGG E A  F+  +      L +GKF   D KT LQE         PE +VT+    
Sbjct: 122 IYLDGGFEAARNFILPFIPPLDKLSTGKFLLGDYKTVLQEIIQQ----NPEERVTYEISD 177

Query: 180 RSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIWT 227
            SG  H+ +FT  V ++G     G   SK+ AEQ AA E +   G  T
Sbjct: 178 ESGQAHNKQFTANVLLNGQIIGTGKGKSKKEAEQSAAKEAISLMGYET 225


>gi|160900693|ref|YP_001566275.1| ribonuclease III [Delftia acidovorans SPH-1]
 gi|238687167|sp|A9BNJ5|RNC_DELAS RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|160366277|gb|ABX37890.1| Ribonuclease III [Delftia acidovorans SPH-1]
          Length = 227

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 87/220 (39%), Positives = 119/220 (54%), Gaps = 10/220 (4%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L+ R+ + FA  +LL++A+TH S S    ++ ERLEFLGD +L L IS+LL+    S 
Sbjct: 6   NALQLRLQHQFAEPALLQRAVTHRSFS---ADNNERLEFLGDSVLNLAISSLLYQRLSSM 62

Query: 67  KEGELS-VRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
            EG+LS VR N LV   T  Q+A  L L   +R+     K       SI AD VE+LI A
Sbjct: 63  PEGDLSRVRAN-LVKEGTLHQIALRLQLPDLLRLGEGESKSGGKQRPSILADAVEALIGA 121

Query: 126 LYLDGGIEVAGTFVDKYWKQRALKSGKFR---RDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           +YLD G   AG  V  +  +    +   R   +DAKT LQEW   +    P+Y+V   +G
Sbjct: 122 VYLDAGY-AAGEKVVHHLFEGVDINPHMRAAEKDAKTALQEWLQGRRMKLPQYEVVATTG 180

Query: 183 PDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLK 221
             H   F V   I+ L   A+G   S+RAAEQ AA  +L+
Sbjct: 181 AAHRQTFEVACAIAELQLQARGTGASRRAAEQTAATAMLE 220


>gi|254468787|ref|ZP_05082193.1| ribonuclease III [beta proteobacterium KB13]
 gi|207087597|gb|EDZ64880.1| ribonuclease III [beta proteobacterium KB13]
          Length = 228

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 83/220 (37%), Positives = 117/220 (53%), Gaps = 6/220 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M  L    LE  + Y F + +LL+K+LTH S      E+ ERLEFLGD IL   I+  LF
Sbjct: 1   MDDLIVKQLEDLLQYKFKDINLLQKSLTHRSFDG---ENNERLEFLGDSILNFTIAEALF 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F +  EG+LS    SLV + T +++A ++ L  FI +     K       SI AD  E
Sbjct: 58  IKFPNIPEGDLSRLRASLVKSGTLAEIAVKIKLGDFIFLGEGELKSAGWRRPSILADTFE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           ++I ALYLDGG+  A TF+ +Y++     +   K  +D KT LQE   +K  + P+Y+V 
Sbjct: 118 AIIGALYLDGGLRPAQTFIHQYFQDWLSEINPAKVDKDPKTSLQELLQSKKLMLPKYEVA 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAA 217
              G  H   F V   I+ L+   +    S+RAAEQ AA+
Sbjct: 178 DIKGEAHAQEFIVKCNIAQLSITTEASGSSRRAAEQEAAS 217


>gi|225570731|ref|ZP_03779754.1| hypothetical protein CLOHYLEM_06832 [Clostridium hylemonae DSM
           15053]
 gi|225160474|gb|EEG73093.1| hypothetical protein CLOHYLEM_06832 [Clostridium hylemonae DSM
           15053]
          Length = 231

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 83/213 (38%), Positives = 110/213 (51%), Gaps = 7/213 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSIS-----HSYQESYERLEFLGDRILGLLISTLLFNHF 63
           LEKRIGY F    LL+KA+ HSS +     H Y E  ERLEFLGD +L L+ S  LF   
Sbjct: 8   LEKRIGYTFKEFGLLKKAMMHSSYANEQHLHKY-ECNERLEFLGDAVLELVSSEFLFYEH 66

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
               EGEL+    S+V     +  AREL +  F+ +             SI +D +E+LI
Sbjct: 67  AKMPEGELTKTRASMVCEPALAFCARELQIGDFLLLGKGEDATGGRKRESITSDAMEALI 126

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
            A+Y+DGG   A  F++++   + L++ K   D+KT LQE   A F     Y +    GP
Sbjct: 127 GAIYIDGGFANAKEFIERFI-LKDLENRKLFFDSKTILQEIVQANFKDAITYHLIGEEGP 185

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           DHD  F V V I       G   +K+AAEQ AA
Sbjct: 186 DHDKSFLVAVHIGEDEYGIGRGRTKKAAEQEAA 218


>gi|147678073|ref|YP_001212288.1| ribonuclease III [Pelotomaculum thermopropionicum SI]
 gi|189043329|sp|A5D1H6|RNC_PELTS RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|146274170|dbj|BAF59919.1| dsRNA-specific ribonuclease [Pelotomaculum thermopropionicum SI]
          Length = 241

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 118/224 (52%), Gaps = 6/224 (2%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLISTLLF 60
           + + L+ R+G A+ +  LL +ALTHSS ++  +    E+ +RLEFLGD +L L +S  L+
Sbjct: 7   KLTLLKNRLGIAWRDEGLLTRALTHSSFTYENRQNGLENNQRLEFLGDAVLELAVSDYLY 66

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
                  EG+L+    S+V   + ++VAREL+L + + +     +       SI AD  E
Sbjct: 67  RSKPEMDEGDLTKLRASVVCEPSLARVARELELGTCLYMGKGEERSGGRDRPSILADAFE 126

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +L+ A+YLD G+E A     KY       +  G+  RD KTELQE    + G   +Y + 
Sbjct: 127 ALLGAVYLDQGLEKAAGLAIKYLAPLIGDVLEGRLERDYKTELQELVQQRGGEQVQYVIL 186

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
              GPDH   FT  V   G+   QG   SK+ AEQ AA + L +
Sbjct: 187 KEEGPDHHKSFTAGVLYRGVLVGQGTGRSKKEAEQQAAKKALMK 230


>gi|319779260|ref|YP_004130173.1| Ribonuclease III [Taylorella equigenitalis MCE9]
 gi|317109284|gb|ADU92030.1| Ribonuclease III [Taylorella equigenitalis MCE9]
          Length = 251

 Score =  121 bits (304), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 82/223 (36%), Positives = 123/223 (55%), Gaps = 10/223 (4%)

Query: 4   LRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           ++   L+K++ Y+F +  LL +ALTH S S ++ E   RLEFLGD IL   +++LLF   
Sbjct: 1   MKLDELQKKLNYSFKDIKLLNRALTHRSFSSTHNE---RLEFLGDSILNFSVASLLFKKL 57

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
               EG+L+    S V+ +T +++A  L L   I++     K       SI AD VE++ 
Sbjct: 58  KDQAEGDLTRIRASYVNQDTLAKIANNLKLQDLIKLGEGELKSGGFKRPSILADAVEAIF 117

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFR---RDAKTELQEWAHAKFGVTPEYKVTFR 180
            A+Y+D  IE A   V+  + +  +K+  F    RD+KT LQE+  AK    P YKV   
Sbjct: 118 GAIYIDSNIEQAQKVVESIY-EPLMKNVDFSTVGRDSKTLLQEFVQAKRVPLPSYKVLNI 176

Query: 181 SGPDHDPRFTV--VVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           +G  HD  F V   VE+  ++ AQ +  S+R+AEQ AA  VL+
Sbjct: 177 TGAAHDQEFEVECTVELFDVS-AQAVGASRRSAEQAAATLVLE 218


>gi|157964181|ref|YP_001499005.1| ribonuclease III [Rickettsia massiliae MTU5]
 gi|189043342|sp|A8F0M2|RNC_RICM5 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|157843957|gb|ABV84458.1| Ribonuclease III [Rickettsia massiliae MTU5]
          Length = 227

 Score =  121 bits (304), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 79/223 (35%), Positives = 120/223 (53%), Gaps = 9/223 (4%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSI--SHSYQES--YERLEFLGDRILGLLISTLLFN 61
           + TLEK + Y+F N+ LL +AL+H S+   H Y++   YERLEFLGD +L L+I+ +LF 
Sbjct: 4   FETLEKLLSYSFKNKELLIEALSHPSLRQHHEYKDDKDYERLEFLGDAVLNLVITEILFR 63

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA--DVV 119
           +F +  EG L+   + LV  ET   V  +L L ++I ++    ++V     ++    +  
Sbjct: 64  NFANYNEGHLAKIRSYLVCKETICMVGAKLTLKNYIIMTHG--EEVAGGRDNLNNIENAT 121

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTF 179
           E+LIAA+YLD  IE     ++K W +          D KT LQEWA A     P Y++  
Sbjct: 122 EALIAAIYLDSNIETTYDIIEKLWAEFIKVQNLTDYDPKTALQEWAQASDHHLPIYRLIK 181

Query: 180 RSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           R G  H   FTV+V++       G   + + AE+ AA  +L R
Sbjct: 182 REGASHSSTFTVLVKVKDYEQT-GTGHAIKEAEKNAARSLLHR 223


>gi|307132118|ref|YP_003884134.1| RNase III [Dickeya dadantii 3937]
 gi|306529647|gb|ADM99577.1| RNase III [Dickeya dadantii 3937]
          Length = 226

 Score =  121 bits (304), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 79/225 (35%), Positives = 121/225 (53%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L+K++GY F    LL +ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPILINRLQKKLGYTFQQYDLLLQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE +L   +R+     K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAEIAREFELGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     + ++++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGVFLDSNIQTVERLILQWYQTRLDEISPGDKQKDPKTRLQEFLQGRHLPLPTYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SG + P  G   S+R AEQ AA + LK+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGFSEPVVGTGSSRRKAEQAAAEQALKK 222


>gi|331005223|ref|ZP_08328616.1| Ribonuclease III [gamma proteobacterium IMCC1989]
 gi|330420966|gb|EGG95239.1| Ribonuclease III [gamma proteobacterium IMCC1989]
          Length = 217

 Score =  121 bits (304), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 85/211 (40%), Positives = 114/211 (54%), Gaps = 6/211 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L+KRI Y F++ SLLE ALTH S S +   + ERLEFLGD +LG+ IS  LF  F   KE
Sbjct: 10  LQKRIDYQFSDESLLETALTHRSFSST---NNERLEFLGDSLLGVTISQQLFEQFPDVKE 66

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G LS + + LV   T + +ARE  L+ ++ + S   K       SI AD VE++I A++L
Sbjct: 67  GILSRQRSRLVKGVTLAALAREFSLSDYLIMGSGELKSGGFRRDSILADTVEAIIGAIFL 126

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  I+     + +++  R   L S    +D KT LQE   +K    P Y V    G  H+
Sbjct: 127 DSDIQQCQKVILQWFHDRLQGLSSHDQLKDPKTRLQELLQSKKKPLPTYTVANIEGASHE 186

Query: 187 PRFTVVVEISGLAPA-QGMDCSKRAAEQVAA 216
            RFTV   I+ L  A      S+R AEQ AA
Sbjct: 187 QRFTVDCGIALLDTAVTATAGSRRQAEQQAA 217


>gi|325661266|ref|ZP_08149893.1| ribonuclease III [Lachnospiraceae bacterium 4_1_37FAA]
 gi|325472773|gb|EGC75984.1| ribonuclease III [Lachnospiraceae bacterium 4_1_37FAA]
          Length = 259

 Score =  121 bits (304), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 81/216 (37%), Positives = 112/216 (51%), Gaps = 5/216 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISH----SYQESYERLEFLGDRILGLLISTLLFNHFD 64
           + K+IGY F  + LL+KA+ HSS ++      Q+  ERLEFLGD +L L  S  LF    
Sbjct: 37  IRKKIGYTFQKKELLQKAMMHSSYTNEKHMKKQDCNERLEFLGDAVLELTTSEALFFDNP 96

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
           S  EGEL+    S+V     + VA+EL L S++ +             SI +D VE+LI 
Sbjct: 97  SMPEGELTKTRASIVCEPALAFVAKELMLGSYLLLGKGEEATGGRQRDSITSDAVEALIG 156

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           A+YLDGG   A  F+ K+     L++ K   D+KT LQE   AKF     Y +    GPD
Sbjct: 157 AIYLDGGFASAKEFIQKFI-LSDLENKKLFYDSKTILQEMVQAKFTENVRYVLEKEEGPD 215

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
           H+  FT    I       G   +K+A+EQ AA + +
Sbjct: 216 HNKSFTTSAYIGEECYGTGSGRTKKASEQEAAYQTI 251


>gi|209695943|ref|YP_002263873.1| ribonuclease III [Aliivibrio salmonicida LFI1238]
 gi|208009896|emb|CAQ80209.1| ribonuclease III (RNase III) [Aliivibrio salmonicida LFI1238]
          Length = 223

 Score =  121 bits (304), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 114/211 (54%), Gaps = 6/211 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE++IGY F +   L+ ALTH S + ++ E   RLEFLGD IL  +++  L++ F    E
Sbjct: 8   LERKIGYKFNDEGFLKLALTHRSANGTHNE---RLEFLGDSILSFVVADELYHRFPKVDE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G++S    +LV   T +++ RE +L  ++ +     K       SI AD VE++I  +YL
Sbjct: 65  GDMSRMRATLVRGHTLAELGREFELGDYLFLGPGELKSGGFRRDSILADAVEAIIGGIYL 124

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D   EV    +  ++K R  +++ G  ++D KT LQE+   +    P Y VT   G  H+
Sbjct: 125 DSDTEVIRRIILAWYKTRLDSIEPGISQKDPKTRLQEYLQGRRKPLPTYTVTKIKGEAHN 184

Query: 187 PRFTVVVEISGL-APAQGMDCSKRAAEQVAA 216
             FT+   ++GL  P  G   S+R AEQ AA
Sbjct: 185 QEFTIECIVAGLDKPVIGKGSSRRKAEQSAA 215


>gi|152989964|ref|YP_001355686.1| ribonuclease III [Nitratiruptor sp. SB155-2]
 gi|189043328|sp|A6Q1H0|RNC_NITSB RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|151421825|dbj|BAF69329.1| ribonuclease III [Nitratiruptor sp. SB155-2]
          Length = 226

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 69/189 (36%), Positives = 110/189 (58%), Gaps = 8/189 (4%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
            EK++GY+F ++ LL++ALTH S         ERLEFLGD +L L++   LF  F  A E
Sbjct: 7   FEKKLGYSFEDKKLLKEALTHKSYKSPVNN--ERLEFLGDAVLDLVVGEYLFKKFPKANE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS    SLV+ E  +++A++LD+  +I +S     +      S+ ++  E+++ A+YL
Sbjct: 65  GELSKLRASLVNEEGFAKLAQKLDIGKYIFISQAEENNQGRTKPSLLSNAFEAVMGAIYL 124

Query: 129 DGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           + G+    E++   +++ + +  L S    +D KT LQE+  A +G+TP YK+   SGPD
Sbjct: 125 EKGLEKVRELSLKLLEEAYPKIDLDS--LFKDFKTALQEFTQAHYGITPTYKLLGSSGPD 182

Query: 185 HDPRFTVVV 193
           H   F V V
Sbjct: 183 HKKEFEVAV 191


>gi|302670933|ref|YP_003830893.1| ribonuclease III Rnc [Butyrivibrio proteoclasticus B316]
 gi|302395406|gb|ADL34311.1| ribonuclease III Rnc [Butyrivibrio proteoclasticus B316]
          Length = 230

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 116/217 (53%), Gaps = 5/217 (2%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSISH----SYQESYERLEFLGDRILGLLISTLLFNHF 63
             ++ IGY F N  LL +ALTHSS  +    + +  YERLEFLGD IL ++ S  LF  +
Sbjct: 9   NFQQVIGYKFKNIDLLIQALTHSSFVNEQKINKKPDYERLEFLGDAILEMVSSEYLFKKY 68

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
              KEGE+S    SLV     +  A  ++L  +I++             SI ADV+E++I
Sbjct: 69  PDKKEGEMSKIRASLVCEPALAFCAEHIELKKYIQLGKGEELTGGRNKESIIADVMEAVI 128

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
            AL+LDGG++ +  F+D Y    A     F  D+K+ LQE+  A      +Y++   SGP
Sbjct: 129 GALFLDGGLQESKRFIDTYVLTNADSMAMF-NDSKSLLQEFVQAGGLGQIKYEICGESGP 187

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
           +HD  F V V I      +G   +K+AAEQ AA + L
Sbjct: 188 EHDKIFDVRVWIGDKNMGEGTGKTKKAAEQKAAYQAL 224


>gi|262373078|ref|ZP_06066357.1| ribonuclease III [Acinetobacter junii SH205]
 gi|262313103|gb|EEY94188.1| ribonuclease III [Acinetobacter junii SH205]
          Length = 232

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 77/223 (34%), Positives = 122/223 (54%), Gaps = 5/223 (2%)

Query: 2   SALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFN 61
           + L  + L+ RIG+ F    LL+ ALTH S+SH +  +YERLEFLGD +LG++I+  L++
Sbjct: 8   NKLNDARLQNRIGHQFQQFDLLKLALTHRSVSHKH--NYERLEFLGDSLLGMIIANYLYH 65

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVES 121
            +    EG L+    +LV  E   ++A +L L+  + +S+   K       SI AD VE+
Sbjct: 66  TYPKENEGRLTRMRATLVRQEALGKIANDLQLSRSLILSTGELKSGGHHRESILADTVEA 125

Query: 122 LIAALYLDGG-IEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +I A+YLD   + +  + V K+++     ++     +D K+ LQE+  A+    P Y+V 
Sbjct: 126 IIGAIYLDSNDLNLLQSIVLKWYEPYLDHIEPTDQLKDPKSRLQEYLQARKKPLPVYEVV 185

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
              G   +  F V   + G+    G   S+R AEQ AAAE+LK
Sbjct: 186 DIQGDAPNQHFKVECNVEGMPKFIGEGSSRRFAEQTAAAEILK 228


>gi|109899454|ref|YP_662709.1| ribonuclease III [Pseudoalteromonas atlantica T6c]
 gi|109701735|gb|ABG41655.1| RNAse III [Pseudoalteromonas atlantica T6c]
          Length = 227

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 81/219 (36%), Positives = 116/219 (52%), Gaps = 6/219 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y  L  ++GY F +   L  ALTH S+  ++ E   RLEFLGD +LGL+I+  LF  F  
Sbjct: 7   YKPLYTKLGYEFQDPKNLTVALTHRSVGANHNE---RLEFLGDAVLGLVIAKALFERFPK 63

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG L+   +SLV  +T ++VARE  L   + +     K       SI AD VE++I A
Sbjct: 64  QPEGNLTRMRSSLVKGDTLAEVAREFSLGDLLLLGPGELKSGGHRRDSILADAVEAIIGA 123

Query: 126 LYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           +Y + G++     +  ++ +R  AL      +D KT LQE+   +    PEY+V   SG 
Sbjct: 124 IYQEVGMQGCEPLILAWFAKRIDALNPDATPKDDKTRLQEYLQGRQLPLPEYEVIDISGK 183

Query: 184 DHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLK 221
            HD  FTV   +SGL+ P  G   S+R AEQ  A + L+
Sbjct: 184 SHDQTFTVQCTVSGLSKPIIGRGKSRRRAEQRTAKQALE 222


>gi|332296458|ref|YP_004438381.1| Ribonuclease 3 [Thermodesulfobium narugense DSM 14796]
 gi|332179561|gb|AEE15250.1| Ribonuclease 3 [Thermodesulfobium narugense DSM 14796]
          Length = 228

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 75/219 (34%), Positives = 120/219 (54%), Gaps = 9/219 (4%)

Query: 4   LRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQE--SYERLEFLGDRILGLLISTLLFN 61
           +  S LE+ +GY F N+  L  +LTHSS S+++ E   +ERLEFLGD +L L++S  LF 
Sbjct: 5   INLSKLEEDLGYVFTNKKWLMTSLTHSSYSYNHPEVKDFERLEFLGDAVLKLVVSHKLFV 64

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVES 121
            +    EG++S     LVS +  +++A++L+L +++ + S  R    +   SI +   E+
Sbjct: 65  LYPEMSEGDMSKLRAYLVSDKHLTKIAKKLNLQNYLLIGSSER----TIKDSILSASFEA 120

Query: 122 LIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           ++ A+Y+D  ++     +DK      +K  ++  D+KT LQE   + FGV PEYKV    
Sbjct: 121 ILGAVYMDSSLKQCYKIIDKLMN---IKIEEYEEDSKTVLQELTQSLFGVLPEYKVIDVR 177

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
           GP H P F V + I           SK+ A+  AA + L
Sbjct: 178 GPSHSPIFEVQLSIDNKFFYTATGSSKKQAQSEAAKKAL 216


>gi|189043297|sp|A8Z6F6|RNC_CAMC1 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|158604915|gb|ABW74738.1| ribonuclease III [Campylobacter concisus 13826]
          Length = 223

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 70/217 (32%), Positives = 120/217 (55%), Gaps = 8/217 (3%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           E+ +GY F    LLE+ALTH S   +   + ERLEFLGD ++ LL++  LF  F    EG
Sbjct: 8   ERNLGYKFKKSELLEEALTHKSTKQAL--NNERLEFLGDAVMDLLVAEYLFKKFSKIAEG 65

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLD 129
           ++S    +LV+ ++ + +AR L +  F+R+S     +      SI +D  E+++ A+YL+
Sbjct: 66  DMSKLRAALVNEKSFANMARRLKMGEFLRLSQAEENNGGREKDSILSDAFEAVMGAIYLE 125

Query: 130 GGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
            G+    E++ + ++  + Q  +      +D KT LQE   A  GV P Y++    GPDH
Sbjct: 126 AGLLKVREISISLLELCYPQ--IDFAHLEKDYKTALQEVTQATLGVIPTYELIGSFGPDH 183

Query: 186 DPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
              F + + ++G   ++ +  SK+ A+Q+AA   L++
Sbjct: 184 KKEFEIALLLNGKEISRAVGSSKKQAQQLAAKIALEK 220


>gi|162449970|ref|YP_001612337.1| ribonuclease III [Sorangium cellulosum 'So ce 56']
 gi|161160552|emb|CAN91857.1| ribonuclease III [Sorangium cellulosum 'So ce 56']
          Length = 275

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 105/194 (54%), Gaps = 7/194 (3%)

Query: 23  LEKALTHSSISHSYQES----YERLEFLGDRILGLLISTLLFNHFDSAKEGELSVRFNSL 78
           LE+ALTH S S+  +       +RLEFLGD +LGL ++ LL   F  A+EGELS+  ++L
Sbjct: 21  LEEALTHPSFSNEQRGGRRVDNQRLEFLGDAVLGLCVTELLMERFPGAREGELSMMRSAL 80

Query: 79  VSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIEVAGTF 138
           V+ +  +  AR ++L + +RV            T++ AD  E+L+AALYLD G E A   
Sbjct: 81  VNTDALAAWARGIELGAALRVGRGAEVAGERDQTNVLADATEALVAALYLDRGFESARAL 140

Query: 139 VDKYWKQR--ALKSGKF-RRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVVVEI 195
             K        L SG    RDAK+ELQE   A+   +P Y++    GPDHD  F V VE+
Sbjct: 141 SRKIAASPLAQLASGSLLGRDAKSELQERVQARGAASPRYRLMGTEGPDHDRAFLVAVEV 200

Query: 196 SGLAPAQGMDCSKR 209
            G     G   SK+
Sbjct: 201 DGQVIGTGRGRSKK 214


>gi|219685563|ref|ZP_03540380.1| ribonuclease III [Borrelia garinii Far04]
 gi|219672962|gb|EED29984.1| ribonuclease III [Borrelia garinii Far04]
          Length = 246

 Score =  121 bits (303), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 78/212 (36%), Positives = 114/212 (53%), Gaps = 9/212 (4%)

Query: 17  FANRSLLEKALTHSSISHSYQE---SYERLEFLGDRILGLLISTLLFNHFDSAKEGELSV 73
           F N  LL  AL+HSS S+   +   + ERLEFLGD +L L+I+  L+  + +  EGELS 
Sbjct: 30  FNNFDLLNTALSHSSYSNELDQKADNNERLEFLGDSVLNLIITDHLYKTYPNKSEGELSK 89

Query: 74  RFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIE 133
             + +VS ++ S VARE++L S+I +      +       I AD +E+ + A+YLD G  
Sbjct: 90  ARSYIVSEDSLSSVAREIELGSYILLGRGEESNDGRNKKGILADAIEAFVGAIYLDSGFS 149

Query: 134 VAGTFV----DKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
           +A  FV    D Y +      G F +D K+ LQE+   K+ ++P YK+    GPDHD  F
Sbjct: 150 MATEFVVGLFDMYIR-LMFNRGDF-KDYKSLLQEYVQKKYKISPSYKLDKEIGPDHDKVF 207

Query: 190 TVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
            V + +     + G   SK+ AE  AA   LK
Sbjct: 208 CVELYVGEKFISNGKGKSKKEAEMRAAEVALK 239


>gi|255281054|ref|ZP_05345609.1| ribonuclease III [Bryantella formatexigens DSM 14469]
 gi|255268502|gb|EET61707.1| ribonuclease III [Bryantella formatexigens DSM 14469]
          Length = 230

 Score =  121 bits (303), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 119/215 (55%), Gaps = 6/215 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESY----ERLEFLGDRILGLLISTLLFNH 62
           S LE+  GY+F ++ LLE AL HSS ++ +++ +    ERLEFLGD +L L  S  L+ H
Sbjct: 6   SELEQMTGYSFKDKELLENALRHSSYANEHKKYHLKDNERLEFLGDAVLELSSSEYLYRH 65

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           +   KEGE++    S+V   T +Q A  ++L SF+R+     +       S+ +D +E+L
Sbjct: 66  YPKMKEGEMTKLRASIVCEPTLAQCAAAIELGSFLRLGRGEEQTGGRHRDSVVSDAMEAL 125

Query: 123 IAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKF-GVTPEYKVTFRS 181
           I A++LDGG   A  FV+++     ++  K   D+KT LQE   + + G    Y +    
Sbjct: 126 IGAIFLDGGFTSAKEFVNRFILN-GVEHKKLFFDSKTILQEIVQSSYKGEAMSYHLLREE 184

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           GP+HD  F V + I      +G   +K++AEQ AA
Sbjct: 185 GPEHDKTFVVQLFIGDKGFEEGRGRTKKSAEQEAA 219


>gi|120555160|ref|YP_959511.1| ribonuclease III [Marinobacter aquaeolei VT8]
 gi|120325009|gb|ABM19324.1| RNAse III [Marinobacter aquaeolei VT8]
          Length = 229

 Score =  121 bits (303), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 79/220 (35%), Positives = 116/220 (52%), Gaps = 6/220 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L++RIGY F     L  ALTH S  +   ++ ERLEFLGD I+ ++I+  L+ HF+ A+E
Sbjct: 10  LQRRIGYQFKEPERLLLALTHRSFGN---QNNERLEFLGDSIVNMVIAEYLYLHFEKARE 66

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS     +V   T +++ RE  L  ++R+ S   K       SI AD VES+I A+YL
Sbjct: 67  GQLSRLRARMVKGVTLAEIGREFQLGQYLRLGSGELKSGGFRRESILADAVESIIGAIYL 126

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D         V ++++QR   L     ++D KT LQE+  ++    P Y+V    G  H+
Sbjct: 127 DSDFHTCRAQVLRWFEQRLANLDIQDTQKDPKTRLQEYLQSRQFPLPRYEVISVDGEAHN 186

Query: 187 PRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKREGI 225
             F V   +  L     G   S+R AEQ AA   LK+ G+
Sbjct: 187 QTFHVSCALPSLDRKTTGTGSSRRVAEQQAARNALKQLGV 226


>gi|32490945|ref|NP_871199.1| hypothetical protein WGLp196 [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|30173145|sp|Q8D305|RNC_WIGBR RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|25166151|dbj|BAC24342.1| rnc [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 226

 Score =  121 bits (303), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 119/223 (53%), Gaps = 6/223 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M  L ++ L+K++GY F N  +L++ALTH S S    ++ ERLEFLGD IL  +IS  L+
Sbjct: 1   MKNLFFNKLQKKMGYLFHNNIILKQALTHRSFS---SKNNERLEFLGDSILNYIISDALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           N+F +  EG+LS   + LV   T +++ARE  L  ++ +     K       SI ++ +E
Sbjct: 58  NNFTNIPEGKLSQMRSYLVRGNTLAEIAREFCLGDYLILGIGEVKTGGKNRDSILSNAME 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           ++I  ++LD  I      V  ++K R  ++     ++D KT LQE+        P+Y + 
Sbjct: 118 AIIGGIFLDSNINKTHEIVISWYKNRLYSMSLKNLKKDPKTRLQEYLQGNKFSLPQYYIK 177

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQ-GMDCSKRAAEQVAAAEVL 220
             +G  H+  FT+   I  L  +  G   ++R AEQ AA + L
Sbjct: 178 NITGESHNQEFTICCFIDDLKKSVIGYGKTRRKAEQSAAKQAL 220


>gi|330828482|ref|YP_004391434.1| ribonuclease III [Aeromonas veronii B565]
 gi|328803618|gb|AEB48817.1| Ribonuclease III [Aeromonas veronii B565]
          Length = 223

 Score =  121 bits (303), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 77/209 (36%), Positives = 112/209 (53%), Gaps = 6/209 (2%)

Query: 4   LRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           ++ + L+ R+G+ FA+  LL +ALTH S    + E   RLEFLGD IL L+I+  LF+ F
Sbjct: 3   IKMNRLQSRLGHVFADLELLTRALTHRSAGSRHNE---RLEFLGDSILSLVIADDLFHRF 59

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             A EG+LS    +LV  +T +++ RE DL   + +     K       SI AD VE++I
Sbjct: 60  PQAAEGDLSRMRATLVREKTLAELGREFDLGDHLILGPGELKSGGFRRESILADTVEAVI 119

Query: 124 AALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
            A+YLD  +E   T +  ++  R   +K G  ++D KT LQE         P Y VT   
Sbjct: 120 GAVYLDTNLETVRTLLLSWYASRLEEIKPGIEQKDPKTRLQEILQGSRKSLPTYTVTNVK 179

Query: 182 GPDHDPRFTVVVEISGL-APAQGMDCSKR 209
           G  H+  FTV  ++ GL  P  G+  S+R
Sbjct: 180 GEAHNQEFTVQCDVEGLDGPLVGVGTSRR 208


>gi|313896309|ref|ZP_07829862.1| ribonuclease III [Selenomonas sp. oral taxon 137 str. F0430]
 gi|320529287|ref|ZP_08030377.1| ribonuclease III [Selenomonas artemidis F0399]
 gi|312975108|gb|EFR40570.1| ribonuclease III [Selenomonas sp. oral taxon 137 str. F0430]
 gi|320138461|gb|EFW30353.1| ribonuclease III [Selenomonas artemidis F0399]
          Length = 238

 Score =  121 bits (303), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 129/233 (55%), Gaps = 10/233 (4%)

Query: 1   MSALRYSTLEK---RIGYAFANRSLLEKALTHSSISHSYQESY---ERLEFLGDRILGLL 54
           +S  R + LE+    +G AF+N +LL++ALTH S ++  ++S    ERLEFLGD +L L 
Sbjct: 5   LSPARRAELERLAAHMGVAFSNIALLDEALTHPSYANESRDSIPHNERLEFLGDAVLELA 64

Query: 55  ISTLLFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVS-SDLRKDVCSFMTS 113
            ST L+ HF    EGEL+    SLV ++T +++AR L L   +R+   +LR        +
Sbjct: 65  SSTYLYKHFPQCSEGELTKMRASLVQSDTLARLARRLHLGRHLRLGHGELRGGGADRQNN 124

Query: 114 IQADVVESLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGV 171
           ++ +V E++I A+YLD G E A  +V          ++  + R D KT LQE       +
Sbjct: 125 LE-NVFEAVIGAVYLDRGWESARDYVCTQLVPEIGNVQPAQVRCDYKTTLQEHVQKDRHM 183

Query: 172 TPEYKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           +  Y++   SGPDHD RFT  V + G    +G   SK+ AEQ AAA  L + G
Sbjct: 184 SVAYELVGESGPDHDKRFTTRVLVGGETLGEGTGPSKKKAEQQAAAHALSKLG 236


>gi|110834492|ref|YP_693351.1| ribonuclease III [Alcanivorax borkumensis SK2]
 gi|123345468|sp|Q0VP19|RNC_ALCBS RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|110647603|emb|CAL17079.1| ribonuclease III [Alcanivorax borkumensis SK2]
          Length = 228

 Score =  121 bits (303), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 88/220 (40%), Positives = 116/220 (52%), Gaps = 9/220 (4%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L  R+GY F + SLLE ALTH S+S     +YERLEFLGD  LG +IS  LF  F  A
Sbjct: 6   NRLMARLGYQFQDLSLLELALTHRSVSR--HRNYERLEFLGDAQLGQIISVALFEQFPEA 63

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG+L+    SLV  +T + VAREL L  ++ +     K       SI AD +ES+I A+
Sbjct: 64  AEGQLTRMRASLVRGQTLALVARELGLGEYLVLGGGELKSGGFRRDSILADALESIIGAM 123

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
            LDGG       V  ++  R  A+     ++DAKT LQEW  A+    P Y+VT   G  
Sbjct: 124 LLDGGEPRCREVVLAWFAPRLDAISPQSAQKDAKTRLQEWLQARKFELPTYEVTQVEGLA 183

Query: 185 HDPRFTVVVEISGLAP---AQGMDCSKRAAEQVAAAEVLK 221
               F V   +  +     AQG   S+R AEQ AA+  L+
Sbjct: 184 PKQTFDVQCSLDNVQQIFIAQG--ASRRKAEQEAASLALE 221


>gi|323499981|ref|ZP_08104937.1| ribonuclease III [Vibrio sinaloensis DSM 21326]
 gi|323314947|gb|EGA68002.1| ribonuclease III [Vibrio sinaloensis DSM 21326]
          Length = 225

 Score =  121 bits (303), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 111/206 (53%), Gaps = 6/206 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + LEK++GY F +  L+  ALTH S +  + E   RLEFLGD IL  +I+  L++ F   
Sbjct: 6   AKLEKKLGYQFNDAELIGLALTHRSANGKHNE---RLEFLGDSILSFVIADDLYHRFPKV 62

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG++S    +LV   T +++ RE +L   +++     K       SI AD VE++I A+
Sbjct: 63  NEGDMSRMRATLVRGNTLAELGREFELGDHLKLGPGELKSGGFRRDSILADAVEAIIGAI 122

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLD  IE     +  ++K R  A+K G  ++D KT LQE+   +    P Y VT   G  
Sbjct: 123 YLDSDIEEVRRIILSWYKTRLDAIKPGVSQKDPKTRLQEFLQGRRKPLPAYTVTNIKGEA 182

Query: 185 HDPRFTVVVEISGLA-PAQGMDCSKR 209
           H+  FTV  E++G+  P  G   S+R
Sbjct: 183 HNQEFTVSCEVAGIGQPVIGKGTSRR 208


>gi|253988786|ref|YP_003040142.1| ribonuclease III [Photorhabdus asymbiotica subsp. asymbiotica ATCC
           43949]
 gi|253780236|emb|CAQ83397.1| ribonuclease III [Photorhabdus asymbiotica]
          Length = 226

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 78/225 (34%), Positives = 121/225 (53%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F    LL +ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPIVINRLQRKLGYTFDQHDLLIQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE +L   +R+     K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAELAREFELGECLRLGPGELKSGGYRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     + ++++ R   +  G  ++D KT LQE+        P Y V 
Sbjct: 118 ALIGGIFLDSDIQTVERTILRWYETRLNEISPGDKQKDPKTRLQEYLQGHHLPLPSYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SG+  P +G   S+R AEQ AA + LK+
Sbjct: 178 MVRGEAHDQEFTIHCQVSGIEQPVKGTGSSRRKAEQAAAEQALKQ 222


>gi|163783627|ref|ZP_02178616.1| RNase III [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881120|gb|EDP74635.1| RNase III [Hydrogenivirga sp. 128-5-R1-1]
          Length = 222

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 82/223 (36%), Positives = 125/223 (56%), Gaps = 13/223 (5%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQES-YERLEFLGDRILGLLISTLLFNHFD 64
           +  +E+RIGY F N+ LL++A TH S +     S YE LEFLGD +L  +I  +L   F 
Sbjct: 2   FEEVEERIGYTFKNKDLLKQAFTHVSYARDAGVSHYEILEFLGDALLNFIIVDILVKEFP 61

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
             +EG L+     L+S E  +++A+ELDL  +I +S   +K+V     SI  DV E+L A
Sbjct: 62  EKREGALASLKAYLISEEFFNELAQELDLPRYILMSRG-KKNV-----SIIGDVFEALWA 115

Query: 125 ALYLDGG--IEVAGTFVDKYWKQR---ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTF 179
           A+Y+D G    +     ++ +K R    ++S + R+D KT LQE    ++   P Y+V  
Sbjct: 116 AVYVDSGRDCNLVKELFNRLFKDRIIETIRSHRIRKDYKTMLQEITQKRWRERPHYRVIS 175

Query: 180 RSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
             GP+H   FTV   I G++ A G   SK+ AEQ AA  ++++
Sbjct: 176 VEGPEHAKTFTVESSIKGVS-AVGRGKSKKEAEQEAAKRLVEK 217


>gi|119471905|ref|ZP_01614213.1| RNase III, ds RNA [Alteromonadales bacterium TW-7]
 gi|119445278|gb|EAW26568.1| RNase III, ds RNA [Alteromonadales bacterium TW-7]
          Length = 225

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 78/217 (35%), Positives = 116/217 (53%), Gaps = 5/217 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L  +IGY F+++ LLE+A+TH S  H  Q + ERLEFLGD IL  +I+  L+  F  A
Sbjct: 6   TELYNKIGYEFSDQGLLEQAMTHRS--HKGQHN-ERLEFLGDSILSFVIANALYAKFPKA 62

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           +EG+LS   ++LV  +T ++   E  L  ++R+     K       S  AD VE++I A 
Sbjct: 63  REGDLSRMRSTLVRGQTLAEFGVEFGLGDYLRLGPGELKSGGFRRESTLADAVEAIIGAA 122

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           +LD GIE     +  +++ R  A+  G  ++D KT LQE    +    P Y V    G  
Sbjct: 123 FLDSGIERCSELILSWYESRLDAISPGLNQKDPKTLLQEHLQGRKLPLPGYTVVDTKGQA 182

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           H+  FTV   + G+     +  S+R AEQ AA + LK
Sbjct: 183 HNQTFTVECIVDGMDSIISVGSSRRKAEQKAAEKALK 219


>gi|260771922|ref|ZP_05880840.1| ribonuclease III [Vibrio metschnikovii CIP 69.14]
 gi|260613214|gb|EEX38415.1| ribonuclease III [Vibrio metschnikovii CIP 69.14]
          Length = 204

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/203 (36%), Positives = 111/203 (54%), Gaps = 6/203 (2%)

Query: 23  LEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELSVRFNSLVSAE 82
           +E ALTH S +  + E   RLEFLGD IL  +I+  L+  F    EG++S    +LV   
Sbjct: 1   MELALTHRSANGKHNE---RLEFLGDSILSFVIADELYRRFPKINEGDMSRMRATLVRGN 57

Query: 83  TCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIEVAGTFVDKY 142
           T +++ RE  L  ++++     K       SI AD VE++I A+YLD  IE+A   +  +
Sbjct: 58  TLAELGREFGLGDYLKLGPGELKSGGFRRDSILADAVEAIIGAIYLDSDIEMARGIILNW 117

Query: 143 WKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVVVEISGLA- 199
           ++ R  A+K G  ++D KT LQE+   K    P Y VT   G  H+  FTV  +++G+A 
Sbjct: 118 YQPRLDAIKPGVSQKDPKTRLQEFLQGKRSPLPIYIVTNIKGEAHNQEFTVSCDVAGIAT 177

Query: 200 PAQGMDCSKRAAEQVAAAEVLKR 222
           P  G   S+R AEQ AA   L++
Sbjct: 178 PVIGKGTSRRKAEQAAAETALEQ 200


>gi|167037696|ref|YP_001665274.1| ribonuclease III [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|307264836|ref|ZP_07546398.1| ribonuclease III [Thermoanaerobacter wiegelii Rt8.B1]
 gi|320116111|ref|YP_004186270.1| ribonuclease III [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|326389510|ref|ZP_08211077.1| ribonuclease III [Thermoanaerobacter ethanolicus JW 200]
 gi|166856530|gb|ABY94938.1| Ribonuclease III [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|306920094|gb|EFN50306.1| ribonuclease III [Thermoanaerobacter wiegelii Rt8.B1]
 gi|319929202|gb|ADV79887.1| ribonuclease III [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|325994515|gb|EGD52940.1| ribonuclease III [Thermoanaerobacter ethanolicus JW 200]
          Length = 246

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 85/224 (37%), Positives = 125/224 (55%), Gaps = 5/224 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQES---YERLEFLGDRILGLLISTLLFNHF 63
           S LEKRI Y+F +++LL +ALTHSS +H  + S    ERLEFLGD +L L+IS  L+ + 
Sbjct: 21  SELEKRINYSFKDKNLLIEALTHSSWAHEGKNSKISNERLEFLGDSVLSLVISEYLYKNR 80

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
              +EG LS     +V   + ++ ARE++L +F+R+             SI AD +E+++
Sbjct: 81  KDLEEGSLSKYRAEIVCEPSLARCAREIELGNFLRIGKGEELTGGRERDSILADAMEAIL 140

Query: 124 AALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           AA+YLDGG+EV    + + +K     +  G   RD KT+LQE   +       Y++    
Sbjct: 141 AAVYLDGGLEVVRNVILELFKNIIEEVLEGLIYRDYKTKLQEVVQSMEIGKIIYELIEEM 200

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           GPDH+  F   V I  +   +G   SK+ AEQ AA E L + GI
Sbjct: 201 GPDHNKTFVTQVRIGDVILGKGYGKSKKEAEQAAAMEALIKLGI 244


>gi|197122613|ref|YP_002134564.1| ribonuclease III [Anaeromyxobacter sp. K]
 gi|196172462|gb|ACG73435.1| Ribonuclease III [Anaeromyxobacter sp. K]
          Length = 383

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 114/214 (53%), Gaps = 8/214 (3%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQES----YERLEFLGDRILGLLISTLLFNH 62
             LE R+G A  +R     ALTH S  + ++E      ERLEFLGD ++ L +S  L   
Sbjct: 26  GALEARLGIAVTDRQAALAALTHKSYVNEHREDGLQDNERLEFLGDAVIDLAVSHRLMER 85

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           F SA+EG+LS    ++V  +  + +AR LDL + +R+            +S+ AD +E++
Sbjct: 86  FPSAREGDLSKMRAAVVDEQGLAGMARALDLGTLLRLGRGEELTGGRQKSSLLADAMEAV 145

Query: 123 IAALYLDGGIEVAGTFVDKYWKQ---RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTF 179
           IAA+Y   G+     FVD++  +   RA  +G   RD KT+LQE + ++   TP Y+V  
Sbjct: 146 IAAVYQGQGLPAVLCFVDRFLGEAFARA-AAGTLDRDFKTQLQELSQSRLRATPRYRVVA 204

Query: 180 RSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQ 213
             GPDH   F V  ++ G    +G   SK+ AEQ
Sbjct: 205 EHGPDHSKTFEVETDLRGEVLGRGAGRSKKDAEQ 238


>gi|309972852|gb|ADO96053.1| RNase III, dsRNA [Haemophilus influenzae R2846]
          Length = 227

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 121/223 (54%), Gaps = 17/223 (7%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE++IGY F + +LL+ ALTH S +  + E   RLEFLGD IL   I+  L++ F    E
Sbjct: 7   LERKIGYRFNDIALLKLALTHRSAATQHNE---RLEFLGDSILNFTIAEALYHQFPRCNE 63

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS    +LV   T + +AR+ +L  ++ + S   K+      SI AD VE++I A+ L
Sbjct: 64  GELSRMRATLVREPTLAILARQFELGDYMSLGSGELKNGGFRRESILADCVEAIIGAMSL 123

Query: 129 DGGIEVAGTFVDKYWKQRAL---KSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           D G+ V  T V + W Q+ L   K G  ++DAKT LQE+   K    P Y+V    G  H
Sbjct: 124 DQGLAVT-TQVIRNWYQQLLAEIKPGDNQKDAKTRLQEYLQGKHLPLPTYEVVNIQGEAH 182

Query: 186 DPRFTVVVEISGLAPAQGMD-------CSKRAAEQVAAAEVLK 221
              FTV  ++     A+ +D        S+R AEQ AA ++LK
Sbjct: 183 CQIFTVECKVKS---AEKIDRTFVAKGSSRRKAEQAAAEQILK 222


>gi|251788698|ref|YP_003003419.1| ribonuclease III [Dickeya zeae Ech1591]
 gi|247537319|gb|ACT05940.1| ribonuclease III [Dickeya zeae Ech1591]
          Length = 226

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/225 (35%), Positives = 120/225 (53%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L+K++GY F    LL +ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPILINRLQKKLGYTFQQYDLLLQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE +L   +R+     K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAEIAREFELGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  +++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGVFLDSNIQTVERLILSWYQTRLDEISPGDKQKDPKTRLQEFLQGRHLPLPTYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SG + P  G   S+R AEQ AA + LK+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGFSEPVVGTGSSRRKAEQAAAEQALKK 222


>gi|312143881|ref|YP_003995327.1| ribonuclease III [Halanaerobium sp. 'sapolanicus']
 gi|311904532|gb|ADQ14973.1| ribonuclease III [Halanaerobium sp. 'sapolanicus']
          Length = 238

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/205 (36%), Positives = 109/205 (53%), Gaps = 6/205 (2%)

Query: 18  ANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLISTLLFNHFDSAKEGELSV 73
           +N+ LL++ALTH S  +  +    +  ERLEFLGD +L L +ST +FN F    EGEL+ 
Sbjct: 22  SNKKLLQRALTHKSFPNENKNLSIKDNERLEFLGDSVLSLAVSTYIFNKFSDFPEGELAK 81

Query: 74  RFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIE 133
               +VSA   ++ A++L+L  ++ +             SI AD +E++  ALYLD G  
Sbjct: 82  MRAVVVSAPILAEAAKKLELGRYLFLGKGEEMTGGRERDSILADSMEAIFGALYLDQGFT 141

Query: 134 VAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTV 191
            A  FV K  K+  + +  G   +D KT LQE       + PEY+V    GPDH+  F V
Sbjct: 142 AASDFVLKILKEDIKEVAMGNHIQDYKTMLQEIIQQDGNIRPEYEVIDEKGPDHNKTFIV 201

Query: 192 VVEISGLAPAQGMDCSKRAAEQVAA 216
            V++   +   G   SK+ AEQ AA
Sbjct: 202 AVKLKENSLGSGQGSSKKEAEQEAA 226


>gi|439871|gb|AAA69690.1| ribonuclease [Coxiella burnetii]
          Length = 233

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 74/218 (33%), Positives = 125/218 (57%), Gaps = 7/218 (3%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L +R+G+ F N  LL+ ALTH S   S  ++ ERLEFLGD +LG +I++ L+     A
Sbjct: 5   NKLMERLGHQFNNLELLKIALTHCS---SGADNNERLEFLGDSVLGFIIASELYQRRPQA 61

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           +EG+LS    S+V+ +  +Q++ +L +  ++++    +K       SI AD +E+++ A+
Sbjct: 62  REGDLSRMRASMVNGDELAQMSTKLGINEYLQLGVGEQKSGGKRRRSILADALETIVGAI 121

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKF--RRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           Y+D G+E     V  ++ +R     K   ++DAK+ LQEW  A+    P Y+V   +G  
Sbjct: 122 YIDAGLETCRRCVLNWYGERVDDLSKLSPKKDAKSLLQEWLQARRLPLPTYEVKI-TGEA 180

Query: 185 HDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLK 221
           H   FTV   + GL    +G++ ++R AEQ+AA   L+
Sbjct: 181 HAQTFTVNCYVKGLPHKTEGVNTTRRRAEQIAAKRFLE 218


>gi|95930677|ref|ZP_01313411.1| Ribonuclease III [Desulfuromonas acetoxidans DSM 684]
 gi|95133329|gb|EAT14994.1| Ribonuclease III [Desulfuromonas acetoxidans DSM 684]
          Length = 244

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 70/202 (34%), Positives = 111/202 (54%), Gaps = 5/202 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSY----QESYERLEFLGDRILGLLISTLLFNH 62
           S  E+R+GY F +R  L+ AL H S ++          ER EFLGD +L L+++  LF  
Sbjct: 14  SQFEERLGYRFTDRHYLQTALIHKSYANEQLRDPAACNERQEFLGDAVLDLVMADYLFCT 73

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           +    EGELS   + LVSA   ++VAR L+L   +++    R+       ++ AD +E++
Sbjct: 74  YPQLPEGELSRIRSELVSARALAKVARRLNLGPCLKLGRGERRSGGQDKDNLLADALEAV 133

Query: 123 IAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR-DAKTELQEWAHAKFGVTPEYKVTFRS 181
             A++LD G +VA   + + ++  A+++ + +  D KT  QE A A+FG  PEY++    
Sbjct: 134 FGAVFLDAGWDVARDVLGRMFEGTAVQAARRKSLDYKTRFQELAQARFGAAPEYELVATE 193

Query: 182 GPDHDPRFTVVVEISGLAPAQG 203
           GPDH   +TV+V   G    QG
Sbjct: 194 GPDHQREYTVIVSCEGRHLGQG 215


>gi|303233301|ref|ZP_07319972.1| ribonuclease III [Atopobium vaginae PB189-T1-4]
 gi|302480601|gb|EFL43690.1| ribonuclease III [Atopobium vaginae PB189-T1-4]
          Length = 229

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 76/221 (34%), Positives = 113/221 (51%), Gaps = 3/221 (1%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSI--SHSYQESYERLEFLGDRILGLLISTLLFNH 62
           R   +++ + Y F++ +L + ALTH S         SYERLEFLGD ILG +I+  +F  
Sbjct: 6   RVCRVQEILDYTFSDITLAKAALTHPSAVEGQPVSASYERLEFLGDSILGAIIACDMFEQ 65

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           F    EG L+    SLVS +T SQVA EL +A  I      R      M S   +V E+L
Sbjct: 66  FPDMDEGALTRMKTSLVSGQTLSQVADELGIAPLIVFGESERGTGTRGMHSALENVYEAL 125

Query: 123 IAALYLDGGIEVAGTFVDKYWKQRAL-KSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           + A+YLDGG +    F+ +   +  + +        K+ELQE++   +   P Y++   S
Sbjct: 126 VGAMYLDGGYDPTAAFIRRTLAEYMVPQRAAHPISPKSELQEFSQRIYHEMPVYELEEES 185

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GP H P FT  V ++G    +G   SK+ ++  AA   L +
Sbjct: 186 GPAHLPHFTTAVYVNGELVGRGSGTSKKESQTQAAQAALDK 226


>gi|154707005|ref|YP_001423899.1| ribonuclease III [Coxiella burnetii Dugway 5J108-111]
 gi|165919331|ref|ZP_02219417.1| ribonuclease III [Coxiella burnetii RSA 334]
 gi|189043305|sp|A9KFA0|RNC_COXBN RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|154356291|gb|ABS77753.1| ribonuclease III [Coxiella burnetii Dugway 5J108-111]
 gi|165916991|gb|EDR35595.1| ribonuclease III [Coxiella burnetii RSA 334]
          Length = 233

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 74/218 (33%), Positives = 125/218 (57%), Gaps = 7/218 (3%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L +R+G+ F N  LL+ ALTH S   S  ++ ERLEFLGD +LG +I++ L+     A
Sbjct: 5   NKLMERLGHQFNNLELLKIALTHRS---SGADNNERLEFLGDSVLGFIIASELYQRRPQA 61

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           +EG+LS    S+V+ +  +Q++ +L +  ++++    +K       SI AD +E+++ A+
Sbjct: 62  REGDLSRMRASMVNGDELAQMSTKLGINEYLQLGVGEQKSGGKRRRSILADALEAIVGAI 121

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKF--RRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           Y+D G+E     V  ++ +R     K   ++DAK+ LQEW  A+    P Y+V   +G  
Sbjct: 122 YIDAGLETCRRCVLNWYGERVDDLSKLSPKKDAKSLLQEWLQARRLPLPTYEVKI-TGEA 180

Query: 185 HDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLK 221
           H   FTV   + GL    +G++ ++R AEQ+AA   L+
Sbjct: 181 HAQTFTVNCYVKGLPHKTEGVNTTRRRAEQIAAKRFLE 218


>gi|114320503|ref|YP_742186.1| ribonuclease III [Alkalilimnicola ehrlichii MLHE-1]
 gi|122311783|sp|Q0A8Z1|RNC_ALHEH RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|114226897|gb|ABI56696.1| RNAse III [Alkalilimnicola ehrlichii MLHE-1]
          Length = 228

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 80/217 (36%), Positives = 117/217 (53%), Gaps = 6/217 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L+ R+GY F    LL++ALTH S++       ERLEFLGD IL  +I+  L++    A E
Sbjct: 8   LQDRLGYRFRRPELLDEALTHRSVTGP---DNERLEFLGDGILNFVIADELYHRRPDATE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G LS    +LV+  T +++ + LD+ + +R+     K       SI AD VE+L  A+YL
Sbjct: 65  GVLSRLRATLVNGRTLAEIGKGLDVGTALRLGGGEMKSGGQRRKSILADAVEALFGAIYL 124

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           DGG + +   + + ++ R  +L +    +D KT LQE   A     P Y+V   SG  HD
Sbjct: 125 DGGFDPSRETILRLYRDRLASLPTEAELKDPKTRLQEHLQAGRRPLPRYEVLEVSGQSHD 184

Query: 187 PRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
             F V   +   A  A+G   S+R AEQ AA ++LKR
Sbjct: 185 QTFRVACRLQDAAVTAEGEAGSRRKAEQQAAEQMLKR 221


>gi|302537165|ref|ZP_07289507.1| ribonuclease III [Streptomyces sp. C]
 gi|302446060|gb|EFL17876.1| ribonuclease III [Streptomyces sp. C]
          Length = 273

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/219 (36%), Positives = 119/219 (54%), Gaps = 6/219 (2%)

Query: 2   SALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLL 59
           +A  ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L
Sbjct: 16  AASSHTLLEGRLGYQLES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTL 74

Query: 60  FNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVV 119
           +       EG+L+    ++V++   ++V R L+L SFIR+             SI AD +
Sbjct: 75  YTTHPDLPEGQLAKLRAAVVNSRALAEVGRGLELGSFIRLGRGEEGTGGRDKASILADTL 134

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKV 177
           E++I A+YLD G++ A   V + +     KS       D KT LQE   A+    PEY V
Sbjct: 135 EAVIGAVYLDQGLDAASELVHRLFDPLIEKSSNLGAGLDWKTSLQELTAAEGLGVPEYLV 194

Query: 178 TFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           T  +GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 195 T-ETGPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 232


>gi|295836307|ref|ZP_06823240.1| ribonuclease III [Streptomyces sp. SPB74]
 gi|295825949|gb|EFG64564.1| ribonuclease III [Streptomyces sp. SPB74]
          Length = 280

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 118/215 (54%), Gaps = 6/215 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHF 63
           ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L+   
Sbjct: 46  HTLLEGRLGYHLES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTLYRAH 104

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
               EG+L+    ++V++   ++V+R LDL +FIR+             SI AD +E++I
Sbjct: 105 PDLPEGQLAKLRAAVVNSRALAEVSRGLDLGAFIRLGRGEEGTGGRDKASILADTLEAVI 164

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKVTFRS 181
            A+YLD G++ AG  V + +     KS +     D KT LQE    +    PEY VT   
Sbjct: 165 GAVYLDQGLDKAGELVHRLFDPLIEKSAELGAGLDWKTSLQELTAVEGLGVPEYLVT-EE 223

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 224 GPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 258


>gi|290476134|ref|YP_003469034.1| RNase III, ds RNA [Xenorhabdus bovienii SS-2004]
 gi|289175467|emb|CBJ82270.1| RNase III, ds RNA [Xenorhabdus bovienii SS-2004]
          Length = 226

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 78/225 (34%), Positives = 123/225 (54%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+++  + L++++GY F    LL +ALTH S +  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNSIIINRLQRKLGYTFIQHDLLLQALTHRSANSKHNE---RLEFLGDSILSFVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE +L   +R+     K       SI AD +E
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAELAREFELGECLRLGPGELKSGGHRRESILADSIE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI A++LD  I+     +  +++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGAIFLDSDIQTIERIILSWYETRLNEISPGDKQKDPKTRLQEYLQGRHLPLPSYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  +ISG   P +G+  S+R AEQ AA + LK+
Sbjct: 178 QVRGEAHDQEFTIHCQISGFEQPVRGVGSSRRKAEQAAAEQALKQ 222


>gi|271501621|ref|YP_003334647.1| ribonuclease III [Dickeya dadantii Ech586]
 gi|270345176|gb|ACZ77941.1| ribonuclease III [Dickeya dadantii Ech586]
          Length = 226

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/225 (35%), Positives = 120/225 (53%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L+K++GY F    LL +ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPILINRLQKKLGYTFQQYDLLLQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE +L   +R+     K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAEIAREFELGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  +++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGVFLDSNIQTIERLILSWYQTRLDEISPGDKQKDPKTRLQEFLQGRHLPLPTYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SG + P  G   S+R AEQ AA + LK+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGFSEPVVGTGSSRRKAEQAAAEQALKK 222


>gi|282600119|ref|ZP_05973085.2| ribonuclease III [Providencia rustigianii DSM 4541]
 gi|282566488|gb|EFB72023.1| ribonuclease III [Providencia rustigianii DSM 4541]
          Length = 263

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 80/224 (35%), Positives = 119/224 (53%), Gaps = 6/224 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ L    L++++GY F    LL +ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 38  MNPLLLEKLQRKLGYTFTQHDLLIQALTHRSASSKHNE---RLEFLGDSILSFVIANDLY 94

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE +L   +R+     K       SI AD VE
Sbjct: 95  HRFPKVDEGDMSRMRATLVRGNTLAEIAREFELGECLRLGPGELKSGGFRRESILADTVE 154

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  ++K R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 155 ALIGGIFLDSDIQTIERIILAWYKGRLDEISPGDKQKDPKTRLQEYLQGRHLPLPNYLVV 214

Query: 179 FRSGPDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLK 221
              G  HD  FT+  E+SG+  +  G+  S+R AEQ AA + LK
Sbjct: 215 QVKGEAHDQEFTIHCEVSGIEQSINGVGSSRRKAEQAAAEQALK 258


>gi|187778952|ref|ZP_02995425.1| hypothetical protein CLOSPO_02547 [Clostridium sporogenes ATCC
           15579]
 gi|187772577|gb|EDU36379.1| hypothetical protein CLOSPO_02547 [Clostridium sporogenes ATCC
           15579]
          Length = 237

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 122/221 (55%), Gaps = 6/221 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHFDSA 66
           L+ ++   F +  LL+ ALTHSS ++  +  + YERLEFLGD +L L+IS  L+  ++  
Sbjct: 14  LQYKLKVCFKDEKLLDVALTHSSYANGKKNIKYYERLEFLGDSVLQLIISEHLYQKYEDK 73

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           KEGEL+ +   +V   +  ++A+  DL  ++++S            SI AD VES+IAA+
Sbjct: 74  KEGELTRKRAIIVCENSLYEMAKRWDLGFYLQMSKGEELTGGRERVSILADCVESIIAAI 133

Query: 127 YLDGGIEVAGTFVDKYWK---QRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           YLD G++ A  FV K +K   ++A++  +   D KT LQE       +T  Y++  + GP
Sbjct: 134 YLDKGLDEAREFVMKNFKEIIEKAMRD-EIILDYKTTLQEIVQQNNDLTINYELLKQEGP 192

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
            H  +F   V I       G+  SK+ AEQ AA E LK  G
Sbjct: 193 PHRRKFFTNVTIDNEVRGTGIGYSKKEAEQNAAKEALKNLG 233


>gi|29654794|ref|NP_820486.1| ribonuclease III [Coxiella burnetii RSA 493]
 gi|161830652|ref|YP_001597345.1| ribonuclease III [Coxiella burnetii RSA 331]
 gi|30581027|sp|P51837|RNC_COXBU RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|189043306|sp|A9N942|RNC_COXBR RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|29542062|gb|AAO91000.1| ribonuclease III [Coxiella burnetii RSA 493]
 gi|161762519|gb|ABX78161.1| ribonuclease III [Coxiella burnetii RSA 331]
          Length = 233

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/218 (33%), Positives = 125/218 (57%), Gaps = 7/218 (3%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L +R+G+ F N  LL+ ALTH S   S  ++ ERLEFLGD +LG +I++ L+     A
Sbjct: 5   NKLMERLGHQFNNLELLKIALTHCS---SGADNNERLEFLGDSVLGFIIASELYQRRPQA 61

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           +EG+LS    S+V+ +  +Q++ +L +  ++++    +K       SI AD +E+++ A+
Sbjct: 62  REGDLSRMRASMVNGDELAQMSTKLGINEYLQLGVGEQKSGGKRRRSILADALEAIVGAI 121

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKF--RRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           Y+D G+E     V  ++ +R     K   ++DAK+ LQEW  A+    P Y+V   +G  
Sbjct: 122 YIDAGLETCRRCVLNWYGERVDDLSKLSPKKDAKSLLQEWLQARRLPLPTYEVKI-TGEA 180

Query: 185 HDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLK 221
           H   FTV   + GL    +G++ ++R AEQ+AA   L+
Sbjct: 181 HAQTFTVNCYVKGLPHKTEGVNTTRRRAEQIAAKRFLE 218


>gi|294340985|emb|CAZ89380.1| Ribonuclease III (RNase III) [Thiomonas sp. 3As]
          Length = 276

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 82/222 (36%), Positives = 119/222 (53%), Gaps = 8/222 (3%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + LE R+GY F +R L E+ALTH S    + E   RLEFLGD +L L  +  L++     
Sbjct: 3   TALETRLGYVFRDRKLFERALTHRSFGADHNE---RLEFLGDSVLNLSAAAWLYHQAARQ 59

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG+LS    +LV AE  ++VAR +DL  F+R+     +   +   SI AD VE+L+ A+
Sbjct: 60  DEGQLSRLRAALVRAEALAEVARAIDLGRFLRLGEGELQSGGAQRESILADTVEALLGAI 119

Query: 127 YLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YL+ G + A   + + +      L +   R+DAKT+LQE+   +    P Y V    G  
Sbjct: 120 YLEAGFDTAQEVMRRLFAPLMDTLDADVVRKDAKTQLQEFLQGQRLPLPSYAVLDVRGAA 179

Query: 185 HDPRFTV--VVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           H  +F V   VE  GL   +G   S+R AEQ AA  +++R G
Sbjct: 180 HQQQFKVECAVEALGLK-VEGEGDSRRRAEQDAATRMIERIG 220


>gi|297191816|ref|ZP_06909214.1| ribonuclease III [Streptomyces pristinaespiralis ATCC 25486]
 gi|197722006|gb|EDY65914.1| ribonuclease III [Streptomyces pristinaespiralis ATCC 25486]
          Length = 296

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 79/219 (36%), Positives = 119/219 (54%), Gaps = 6/219 (2%)

Query: 2   SALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLL 59
           +A  ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L
Sbjct: 9   NASSHTLLEGRLGYQLES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTL 67

Query: 60  FNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVV 119
           +       EG+L+    ++V++   ++V R L+L SFIR+             SI AD +
Sbjct: 68  YRTHPDLPEGQLAKLRAAVVNSRALAEVGRGLELGSFIRLGRGEEGTGGRDKASILADTL 127

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKV 177
           E++I A+YLD G++ A   V + +     KS       D KT LQE   A+    PEY V
Sbjct: 128 EAVIGAVYLDQGLDAASELVHRLFDPLIEKSSNLGAGLDWKTSLQELTAAEGLGVPEYLV 187

Query: 178 TFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           T  +GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 188 T-ETGPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 225


>gi|260551498|ref|ZP_05825682.1| dsRNA-specific ribonuclease [Acinetobacter sp. RUH2624]
 gi|260405492|gb|EEW98985.1| dsRNA-specific ribonuclease [Acinetobacter sp. RUH2624]
          Length = 230

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 114/213 (53%), Gaps = 5/213 (2%)

Query: 12  RIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGEL 71
           RIGY F    LL+ ALTH S+SH Y  +YERLEFLGD +LG++I+  L++ +    EG L
Sbjct: 16  RIGYQFKQPELLQLALTHRSVSHKY--NYERLEFLGDSLLGMIIANYLYHAYPHENEGRL 73

Query: 72  SVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGG 131
           +    +LV  E   ++A +L L+  + +S+   K       SI AD VE++I A+YLD  
Sbjct: 74  TRMRATLVRQEALGKIATDLQLSRCLILSTGELKSGGHHRESILADTVEAIIGAIYLDSS 133

Query: 132 -IEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
            + +    V K++      ++     +D K+ LQE+  A+    P Y+V    G      
Sbjct: 134 DLNLLKDIVLKWYVPYLDHIEPTDQLKDPKSRLQEYLQARKKPLPVYEVVDIQGDAPHQH 193

Query: 189 FTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           F V   + GL    G   S+R AEQ AAAE+LK
Sbjct: 194 FKVECLVDGLPKIYGEGSSRRFAEQAAAAEILK 226


>gi|259501533|ref|ZP_05744435.1| ribonuclease III [Lactobacillus iners DSM 13335]
 gi|302191494|ref|ZP_07267748.1| ribonuclease III [Lactobacillus iners AB-1]
 gi|309804216|ref|ZP_07698293.1| ribonuclease III [Lactobacillus iners LactinV 11V1-d]
 gi|309806878|ref|ZP_07700865.1| ribonuclease III [Lactobacillus iners LactinV 03V1-b]
 gi|309808658|ref|ZP_07702550.1| ribonuclease III [Lactobacillus iners LactinV 01V1-a]
 gi|325913482|ref|ZP_08175848.1| ribonuclease III [Lactobacillus iners UPII 60-B]
 gi|259167051|gb|EEW51546.1| ribonuclease III [Lactobacillus iners DSM 13335]
 gi|308163619|gb|EFO65889.1| ribonuclease III [Lactobacillus iners LactinV 11V1-d]
 gi|308166744|gb|EFO68936.1| ribonuclease III [Lactobacillus iners LactinV 03V1-b]
 gi|308168132|gb|EFO70258.1| ribonuclease III [Lactobacillus iners LactinV 01V1-a]
 gi|325477251|gb|EGC80397.1| ribonuclease III [Lactobacillus iners UPII 60-B]
          Length = 225

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 81/220 (36%), Positives = 119/220 (54%), Gaps = 7/220 (3%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHFD 64
           + L+++    F N  LLE+ALTHSS S+ +Q  ++YE+LEFLGD +L L IS  L+ HF 
Sbjct: 8   NELQEKYQIKFNNEQLLEQALTHSSYSNEHQGCKNYEKLEFLGDAVLELAISDYLYRHFP 67

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
           +  EGEL+   +++V  E  SQ A E   +  +++     K       ++  DV E+   
Sbjct: 68  NMNEGELTRMRSNIVRTEGFSQFATECGFSREVKLGKGEEKSGSRTRHTLLEDVFEAFNG 127

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKF--RRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           AL+LD G+     F+        +  G F   RD KTELQE       +  +YKV     
Sbjct: 128 ALFLDQGMPAVQHFL-HLTVYPLIAEGDFDSSRDYKTELQEKLQVNGAIDIQYKVI--DS 184

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
            +  PRFTV + ++G   +QG+  SK+AAEQVAA+  LK 
Sbjct: 185 DEAQPRFTVQLIVAGENISQGIGRSKKAAEQVAASVALKN 224


>gi|254383289|ref|ZP_04998642.1| ribonuclease 3 [Streptomyces sp. Mg1]
 gi|194342187|gb|EDX23153.1| ribonuclease 3 [Streptomyces sp. Mg1]
          Length = 277

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 79/219 (36%), Positives = 119/219 (54%), Gaps = 6/219 (2%)

Query: 2   SALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLL 59
           +A  ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L
Sbjct: 16  AASSHTLLEGRLGYRLES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTL 74

Query: 60  FNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVV 119
           +       EG+L+    ++V++   ++V R L+L SFIR+             SI AD +
Sbjct: 75  YTTHPDLPEGQLAKLRAAVVNSRALAEVGRGLELGSFIRLGRGEEGTGGRDKASILADTL 134

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKV 177
           E++I A+YLD G++ A   V + +     KS       D KT LQE   A+    PEY V
Sbjct: 135 EAVIGAVYLDQGLDAASELVHRLFDPLIEKSSNLGAGLDWKTSLQELTAAEGLGVPEYLV 194

Query: 178 TFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           T  +GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 195 T-ETGPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 232


>gi|290957120|ref|YP_003488302.1| ribonuclease III [Streptomyces scabiei 87.22]
 gi|260646646|emb|CBG69743.1| putative ribonuclease III [Streptomyces scabiei 87.22]
          Length = 272

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 79/219 (36%), Positives = 118/219 (53%), Gaps = 6/219 (2%)

Query: 2   SALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLL 59
           +A  ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L
Sbjct: 17  TASSHTLLEGRLGYKLES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTL 75

Query: 60  FNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVV 119
           +       EG+L+    ++V++   ++V R LDL SFIR+             SI AD +
Sbjct: 76  YRTHPDLPEGQLAKLRAAVVNSRALAEVGRGLDLGSFIRLGRGEEGTGGRDKASILADTL 135

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKV 177
           E++I A+YLD G++ A   V + +     KS       D KT LQE    +    PEY V
Sbjct: 136 EAVIGAVYLDQGLDSAAELVHRLFDPLIEKSSNLGAGLDWKTSLQELTATEGLGVPEYLV 195

Query: 178 TFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           T  +GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 196 T-ETGPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 233


>gi|220917396|ref|YP_002492700.1| Ribonuclease III [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219955250|gb|ACL65634.1| Ribonuclease III [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 383

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 114/214 (53%), Gaps = 8/214 (3%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQES----YERLEFLGDRILGLLISTLLFNH 62
             LE R+G A  +R     ALTH S  + ++E      ERLEFLGD ++ L +S  L   
Sbjct: 26  GALEARLGIAVTDRQAALAALTHKSYVNEHREDGLQDNERLEFLGDAVIDLAVSHRLMER 85

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           F SA+EG+LS    ++V  +  + +AR LDL + +R+            +S+ AD +E++
Sbjct: 86  FPSAREGDLSKMRAAVVDEQGLAGMARALDLGTLLRLGRGEELTGGRQKSSLLADAMEAV 145

Query: 123 IAALYLDGGIEVAGTFVDKYWKQ---RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTF 179
           IAA+Y   G+     FVD++  +   RA  +G   RD KT+LQE + ++   TP Y+V  
Sbjct: 146 IAAVYQGQGLPAVLCFVDRFLGEAFARAA-AGTLDRDFKTQLQELSQSRLRATPRYRVVA 204

Query: 180 RSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQ 213
             GPDH   F V  ++ G    +G   SK+ AEQ
Sbjct: 205 EHGPDHSKTFEVETDLRGEVLGRGAGRSKKDAEQ 238


>gi|163814044|ref|ZP_02205436.1| hypothetical protein COPEUT_00197 [Coprococcus eutactus ATCC 27759]
 gi|158450493|gb|EDP27488.1| hypothetical protein COPEUT_00197 [Coprococcus eutactus ATCC 27759]
          Length = 232

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 81/219 (36%), Positives = 117/219 (53%), Gaps = 6/219 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLISTLLFN 61
           Y  LEK+IGY F + +LL  ALTH+S ++  +    +SYERLEFLGD IL  ++S  LF 
Sbjct: 8   YDELEKKIGYQFKDINLLITALTHTSFANELKVNKTDSYERLEFLGDAILEYIVSEYLFL 67

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVES 121
                +EG L+    SLV   T SQ++  L    ++R+S            SI  D+ ES
Sbjct: 68  KKKEYEEGRLTKLRASLVCEFTLSQISESLGYGDYVRLSKGEELTGGRKRKSILCDLFES 127

Query: 122 LIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           ++ A+YLDGGIE A  FV ++          F  DAK+ LQE+   K G    Y++    
Sbjct: 128 VLGAMYLDGGIEPAKEFVHRFLLDDVETKSLF-YDAKSTLQEFCQ-KHGRQLSYELIEER 185

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
           GP+H   F     I+G   A+G   +++ +EQ+AA + L
Sbjct: 186 GPEHSKIFVSDAVINGKVTARGEGPNRKTSEQMAAYKTL 224


>gi|118580198|ref|YP_901448.1| ribonuclease III [Pelobacter propionicus DSM 2379]
 gi|118502908|gb|ABK99390.1| RNAse III [Pelobacter propionicus DSM 2379]
          Length = 234

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 113/207 (54%), Gaps = 4/207 (1%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQE--SYERLEFLGDRILGLLISTLLFNHFD 64
           + LE+ I Y F +++ L +ALTH S  H      +Y+RLEFLGD +LG++++ +LF  F 
Sbjct: 6   AELEREIAYRFIDQAPLLQALTHPSFEHEQAGGGNYQRLEFLGDAVLGMVLAEMLFRRFP 65

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
            + EG LS   + +   +T + +AR   L  F+R+     +       SI ADV+E+LIA
Sbjct: 66  DSNEGVLSRLRSQIADQDTLAGIARSFGLGRFVRLGRGEEQGAGRNKDSILADVLEALIA 125

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKVTFRSG 182
           A+YLDGG++ +   + + +       G   R  DAK+ELQE   A+   +P Y++T  SG
Sbjct: 126 AVYLDGGLKESRRLIQRLFVAILESRGARLRFNDAKSELQELLSARRLPSPVYRLTGESG 185

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKR 209
           P HD  F   V +      +G   SK+
Sbjct: 186 PPHDRLFIFQVLVDDAVVGEGEGRSKK 212


>gi|165975962|ref|YP_001651555.1| ribonuclease III [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
 gi|238687533|sp|B0BUA6|RNC_ACTPJ RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|165876063|gb|ABY69111.1| ribonuclease III [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
          Length = 223

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 83/223 (37%), Positives = 118/223 (52%), Gaps = 8/223 (3%)

Query: 4   LRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           ++   L+K++GY F N   L +ALTH S      ++ ERLEFLGD IL   I   LF  F
Sbjct: 1   MQLERLQKKLGYQFTNLDYLLQALTHRSAGA---KNNERLEFLGDSILNFAIGKALFEKF 57

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             A EGELS    +LV  +T + +AR+  L  ++++ +   K       SI +D VE++I
Sbjct: 58  PKANEGELSRMRATLVREQTLAILARKFGLGEYMKLGAGELKSGGYRRESILSDCVEAII 117

Query: 124 AALYLDGGIEVAGTFVDKYWKQRAL---KSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           AA+YLD G++ A   V   W Q  L   K G  ++D KT LQE+   +    P Y+V   
Sbjct: 118 AAIYLDAGMDKAIAQVH-LWYQDLLAEMKPGDAQKDPKTRLQEFLQGRKLPLPTYEVLNI 176

Query: 181 SGPDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLKR 222
            G  H+  F V  +I  L     G+  S+R AEQ AA +VL +
Sbjct: 177 KGEAHNQTFKVTCKIEMLEEIFIGIGTSRRKAEQNAAEQVLAK 219


>gi|296136816|ref|YP_003644058.1| ribonuclease III [Thiomonas intermedia K12]
 gi|295796938|gb|ADG31728.1| ribonuclease III [Thiomonas intermedia K12]
          Length = 276

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 82/222 (36%), Positives = 119/222 (53%), Gaps = 8/222 (3%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + LE R+GY F +R L E+ALTH S    + E   RLEFLGD +L L  +  L++     
Sbjct: 3   TALETRLGYVFRDRKLFERALTHRSFGADHNE---RLEFLGDSVLNLSAAAWLYHQAARQ 59

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG+LS    +LV AE  ++VAR +DL  F+R+     +   +   SI AD VE+L+ A+
Sbjct: 60  DEGQLSRLRAALVRAEALAEVARAIDLGRFLRLGEGELQSGGAQRESILADTVEALLGAI 119

Query: 127 YLDGGIEVAGTFVDKYWK--QRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YL+ G + A   + + +      L +   R+DAKT+LQE+   +    P Y V    G  
Sbjct: 120 YLEAGFDTAQEVMRRLFAPLMDTLDADVVRKDAKTQLQEFLQGQRLPLPSYAVLDVRGAA 179

Query: 185 HDPRFTV--VVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           H  +F V   VE  GL   +G   S+R AEQ AA  +++R G
Sbjct: 180 HQQQFKVECAVEALGLK-VEGEGDSRRRAEQDAATRMIERIG 220


>gi|206603814|gb|EDZ40294.1| Ribonuclease III [Leptospirillum sp. Group II '5-way CG']
          Length = 247

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 118/224 (52%), Gaps = 9/224 (4%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISH-----SYQESYERLEFLGDRILGLLISTLLFN 61
           S LE  +GY F    LLE+A TH S  +         + ERLEFLGD +LGL+I+  L  
Sbjct: 8   SELEDLLGYRFRKIDLLEEATTHKSFMNEGRRLGVTRNNERLEFLGDTVLGLVIAEYLMV 67

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVES 121
            +    EG LS     +VS  T + V+R L +  F+ +            +S+ AD +E+
Sbjct: 68  TYPKYPEGVLSKFKGRIVSEPTLASVSRVLGIGGFLLIGKGEELTQGREKSSLLADAMEA 127

Query: 122 LIAALYLDGGIEVAGTFVDKYWK---QRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +IAA+YLD G++ A TF+  +++   ++ ++    + D KT+LQE+   +    P Y+V 
Sbjct: 128 VIAAIYLDSGLDAARTFIIGHFRSVIEQTVQEDSIQ-DYKTDLQEYCQRELETLPVYQVM 186

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
            + GPDH   F V V I G    +G   SK+ AEQ AA + L R
Sbjct: 187 DQRGPDHQKEFDVAVLIRGKIYGEGSGRSKKEAEQKAAKDALSR 230


>gi|300113378|ref|YP_003759953.1| ribonuclease III [Nitrosococcus watsonii C-113]
 gi|299539315|gb|ADJ27632.1| ribonuclease III [Nitrosococcus watsonii C-113]
          Length = 233

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/208 (37%), Positives = 117/208 (56%), Gaps = 8/208 (3%)

Query: 11  KRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGE 70
           +++GY FA  +LL  A+TH S +   +E+ ERLEFLGD IL  LI+  L++ F  A+EG+
Sbjct: 10  QKLGYQFAEPALLRHAITHRSAA---KENNERLEFLGDSILNFLIADFLYSGFPKAQEGK 66

Query: 71  LSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDG 130
           LS    +LV  ET +++AREL++   + +     K      TSI AD  E++I A+YLDG
Sbjct: 67  LSRLRATLVKGETLAELARELEIGDHLILGLGELKSGGYRRTSILADAFEAVIGAVYLDG 126

Query: 131 GIEVAGTFVDKYWKQR--ALKSGKF--RRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           G+E     V   ++ R   L        +D KT LQE+  A+    P+Y+V+  +G  HD
Sbjct: 127 GLEACRQLVSSLYRDRLETLTDEVLLNLKDPKTRLQEYLQARQFPLPDYRVSAVNGEAHD 186

Query: 187 PRFTVVVEISGLAPAQ-GMDCSKRAAEQ 213
             F V   ++   P+  G+  S+R AEQ
Sbjct: 187 QVFQVECTLNNTFPSVIGIGRSRRKAEQ 214


>gi|157374287|ref|YP_001472887.1| ribonuclease III [Shewanella sediminis HAW-EB3]
 gi|189043354|sp|A8FSD6|RNC_SHESH RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|157316661|gb|ABV35759.1| Ribonuclease III [Shewanella sediminis HAW-EB3]
          Length = 225

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 81/215 (37%), Positives = 116/215 (53%), Gaps = 5/215 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L + +GY F ++SLLE ALTH S S  + E   RLEFLGD IL ++IS  LF+ F  A E
Sbjct: 10  LCRTLGYEFNDQSLLEHALTHRSASSKHNE---RLEFLGDSILSIIISDALFHQFPKATE 66

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV  +  +++  E  L  ++ +     K       SI AD VE++I A+Y+
Sbjct: 67  GDLSRMRATLVCGKMLAEIGFEFKLGDYLNLGPGELKSGGFRRESIIADAVEAIIGAVYI 126

Query: 129 DGGIEVAGTFVDKYWKQR-ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDP 187
           D G+E     V  +++ R A+     ++D KT LQE         P YKV    G  H  
Sbjct: 127 DSGVEKCRCLVLSWYESRLAIIQPVNQKDPKTLLQELLQGFKKPLPVYKVIDIKGEAHAQ 186

Query: 188 RFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLK 221
            FTV   +  L+ P  G+  S+R AEQ+AAA+ L+
Sbjct: 187 TFTVECYVEELSKPVIGIASSRRKAEQLAAADALE 221


>gi|323484230|ref|ZP_08089599.1| hypothetical protein HMPREF9474_01350 [Clostridium symbiosum
           WAL-14163]
 gi|323692112|ref|ZP_08106358.1| ribonuclease III [Clostridium symbiosum WAL-14673]
 gi|323402472|gb|EGA94801.1| hypothetical protein HMPREF9474_01350 [Clostridium symbiosum
           WAL-14163]
 gi|323503835|gb|EGB19651.1| ribonuclease III [Clostridium symbiosum WAL-14673]
          Length = 228

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 113/212 (53%), Gaps = 5/212 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISH----SYQESYERLEFLGDRILGLLISTLLFNHFD 64
           LE++ GY F NR LL +A+THSS ++    S  E  ERLEFLGD +L ++ S  LF+ F 
Sbjct: 8   LEEKTGYHFNNRELLGRAMTHSSYANECHKSKLECNERLEFLGDAVLEIVSSDFLFHKFP 67

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EG+L+    S+V   T +  A EL L  ++ +             S+ +D +E+LI 
Sbjct: 68  DMPEGDLTKTRASMVCEPTLAYCAEELSLGKYLLLGKGEEATGGRNRNSVVSDAMEALIG 127

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           A+YLDGG   A  F+ K+     ++  K   D+KT LQE   ++      Y++    GPD
Sbjct: 128 AIYLDGGFASAKEFIHKFI-LNDMEHKKLFYDSKTILQEIVQSRCEEGLSYQLLREEGPD 186

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           H+  F V  +I      +G   +K+AAEQ+AA
Sbjct: 187 HNKMFEVAAKIGEKEIGRGTGRTKKAAEQLAA 218


>gi|117620609|ref|YP_855343.1| ribonuclease III [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117562016|gb|ABK38964.1| ribonuclease III [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 223

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 112/209 (53%), Gaps = 6/209 (2%)

Query: 4   LRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           ++ + L+ R+G+ F ++ LL +ALTH S    + E   RLEFLGD IL L+I+  LF+ F
Sbjct: 3   IKMNRLQSRLGHVFQDQELLTRALTHRSAGSRHNE---RLEFLGDSILSLVIADDLFHRF 59

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             A EG+LS    +LV  +T +++ RE DL   + +     K       SI AD VE++I
Sbjct: 60  PQAAEGDLSRMRATLVREKTLAELGREFDLGDHLILGPGELKSGGFRRESILADTVEAVI 119

Query: 124 AALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
            A+YLD  +E   T +  ++  R   +K G  ++D KT LQE         P Y VT   
Sbjct: 120 GAVYLDTNLETVRTLLLGWYASRLDEIKPGIEQKDPKTRLQEILQGSRKSLPTYTVTNVK 179

Query: 182 GPDHDPRFTVVVEISGL-APAQGMDCSKR 209
           G  H+  FTV  ++ GL  P  G+  S+R
Sbjct: 180 GEAHNQEFTVQCDVEGLDGPLVGVGTSRR 208


>gi|37527216|ref|NP_930560.1| ribonuclease III [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|81418780|sp|Q7N1X5|RNC_PHOLL RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|36786650|emb|CAE15714.1| ribonuclease III (RNase III) [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 226

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 79/225 (35%), Positives = 121/225 (53%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F    LL +ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPIVINRLQRKLGYTFDQYDLLIQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE +L   +R+     K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAELAREFELGECLRLGPGELKSGGYRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI A++LD  I+     +  +++ R   +  G  ++D KT LQE+        P Y V 
Sbjct: 118 ALIGAIFLDSDIQSIERIILSWYETRLNEISPGDKQKDPKTRLQEYLQGHHLPLPSYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SG+  P +G   S+R AEQ AA + LK+
Sbjct: 178 MVRGEAHDQEFTIHCQVSGIEQPVKGTGSSRRKAEQAAAEQALKQ 222


>gi|240949696|ref|ZP_04754031.1| ribonuclease III [Actinobacillus minor NM305]
 gi|240295954|gb|EER46630.1| ribonuclease III [Actinobacillus minor NM305]
          Length = 223

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 76/220 (34%), Positives = 120/220 (54%), Gaps = 6/220 (2%)

Query: 4   LRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           ++   L+K++GY F     L +ALTH S +    ++ ERLEFLGD IL   I   L++ F
Sbjct: 1   MQLERLQKKLGYQFETLDYLTQALTHRSAAS---KNNERLEFLGDSILNFTIGKALYDKF 57

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             A EGELS    +LV  +T + +AR+ +L  ++++ +   K       SI +D VE++I
Sbjct: 58  PKADEGELSRMRAALVREQTLAVIARQFELGEYLKLGAGELKSGGFRRESILSDCVEAII 117

Query: 124 AALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           AA+YLD G+E A   +  +++     +  G+ ++D KT LQE+   +    PEY+V    
Sbjct: 118 AAIYLDKGMEPAMERIYAWYETFLAEITPGEAQKDPKTRLQEFLQGRKLPLPEYEVIDIK 177

Query: 182 GPDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVL 220
           G  H+  F V  ++ G+     G   S+R AEQ  A +VL
Sbjct: 178 GEAHNQTFKVTCKVQGIEEIFTGQGTSRRKAEQNVAEKVL 217


>gi|254428849|ref|ZP_05042556.1| ribonuclease III [Alcanivorax sp. DG881]
 gi|196195018|gb|EDX89977.1| ribonuclease III [Alcanivorax sp. DG881]
          Length = 228

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 88/220 (40%), Positives = 118/220 (53%), Gaps = 9/220 (4%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L  R+GY F + SLLE ALTH S+S     +YERLEFLGD  LG +IS  LF  F  A
Sbjct: 6   NRLMARLGYQFQDISLLELALTHRSVSR--HRNYERLEFLGDAQLGQIISVALFEQFPEA 63

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG+L+    SLV  +T + VAREL L  ++ +     K       SI AD +ES+I A+
Sbjct: 64  AEGQLTRMRASLVRGQTLALVARELGLGEYLVLGGGELKSGGFRRDSILADALESIIGAM 123

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
            LDGG       V  ++  R  A+     ++DAKT LQEW  A+    P Y+VT   G  
Sbjct: 124 LLDGGESRCREVVLCWFAPRLDAISPQSAQKDAKTRLQEWLQARKFELPTYEVTQVEGLA 183

Query: 185 HDPRFTV---VVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
               F V   + ++  +  AQG   S+R AEQ AA+  L+
Sbjct: 184 PKQTFDVQCSLDQVQQIFIAQG--ASRRKAEQEAASLALE 221


>gi|119476421|ref|ZP_01616772.1| ribonuclease III [marine gamma proteobacterium HTCC2143]
 gi|119450285|gb|EAW31520.1| ribonuclease III [marine gamma proteobacterium HTCC2143]
          Length = 229

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 110/206 (53%), Gaps = 5/206 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           +  L +++G+ F + SL++ AL+H S+     ++ ERLEFLGD I+  L++  LF  F  
Sbjct: 8   HHLLIQKLGHEFNDPSLVDLALSHRSVG---AKNNERLEFLGDSIVNFLMAEALFQKFPE 64

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
            +EGELS     LV  ET +++A+E  +   + +     K       SI AD VE+LI A
Sbjct: 65  CREGELSQMRAQLVKGETLAEIAKEFSVGEHLNLGPGELKSGGYRRESILADAVEALIGA 124

Query: 126 LYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           +YLDGG+      V ++++ R   +      +DAKT LQEW  A+    P+Y +   SG 
Sbjct: 125 IYLDGGMAACNEHVPRWFESRLDLISPRNSNKDAKTRLQEWLQARKMPLPQYVLINTSGS 184

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKR 209
           DH  +FT+  +I  L      D S R
Sbjct: 185 DHQQQFTIECDIHHLQQRFTGDGSSR 210


>gi|71281241|ref|YP_270777.1| ribonuclease III [Colwellia psychrerythraea 34H]
 gi|90101619|sp|Q47WP5|RNC_COLP3 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|71146981|gb|AAZ27454.1| ribonuclease III [Colwellia psychrerythraea 34H]
          Length = 266

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/217 (35%), Positives = 119/217 (54%), Gaps = 10/217 (4%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L K++GY F    LL +ALTH S   ++ E   RLEFLGD ILG +I+  L++ F    E
Sbjct: 11  LTKKLGYEFNEPLLLVQALTHRSAKGAHNE---RLEFLGDSILGFVIAEALYDKFPKHDE 67

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+L+   +SLV   T ++VAR+ +L   + +     K       SI  D +E++I A+YL
Sbjct: 68  GDLTRMRSSLVKGVTLAEVARDFNLGECLILGPGELKSGGHHRESILEDAIEAIIGAVYL 127

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  IE     +  ++++R   +K G  ++D KT LQE+   +    P Y+V   +G  H+
Sbjct: 128 DSNIECCKALILSWFERRLMVIKPGNEQKDPKTRLQEFLQGRKIPLPTYEVIDTTGQSHN 187

Query: 187 PRFTVVVE---ISGLAPAQGMDCSKRAAEQVAAAEVL 220
             FTV  +   IS +  A+G   S+R AEQ AA ++L
Sbjct: 188 QEFTVRCQTSVISEVVIAKGT--SRRKAEQEAAQQIL 222


>gi|309809559|ref|ZP_07703417.1| ribonuclease III [Lactobacillus iners SPIN 2503V10-D]
 gi|329921162|ref|ZP_08277684.1| ribonuclease III [Lactobacillus iners SPIN 1401G]
 gi|308170231|gb|EFO72266.1| ribonuclease III [Lactobacillus iners SPIN 2503V10-D]
 gi|328934800|gb|EGG31291.1| ribonuclease III [Lactobacillus iners SPIN 1401G]
          Length = 225

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 81/220 (36%), Positives = 119/220 (54%), Gaps = 7/220 (3%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHFD 64
           + L+++    F N  LLE+ALTHSS S+ +Q  ++YE+LEFLGD +L L IS  L+ HF 
Sbjct: 8   NELQEKYQIKFNNEQLLEQALTHSSYSNEHQGCKNYEKLEFLGDAVLELAISDYLYRHFP 67

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
           +  EGEL+   +++V  E  SQ A E   +  +++     K       ++  DV E+   
Sbjct: 68  NMNEGELTRMRSNIVRTEGFSQFATECGFSREVKLGKGEEKSGSRTRHTLLEDVFEAFNG 127

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKF--RRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           AL+LD G+     F+        +  G F   RD KTELQE       +  +YKV     
Sbjct: 128 ALFLDQGMPAVQHFL-HLTVYPLIAEGDFDSSRDYKTELQEKLQVNGAIDIQYKVI--DS 184

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
            +  PRFTV + ++G   +QG+  SK+AAEQVAA+  LK 
Sbjct: 185 DEAKPRFTVQLIVAGENISQGIGRSKKAAEQVAASVALKN 224


>gi|34580889|ref|ZP_00142369.1| ribonuclease III [Rickettsia sibirica 246]
 gi|157828029|ref|YP_001494271.1| ribonuclease III [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165932727|ref|YP_001649516.1| ribonuclease III [Rickettsia rickettsii str. Iowa]
 gi|229586355|ref|YP_002844856.1| ribonuclease III [Rickettsia africae ESF-5]
 gi|166991034|sp|A8GQT8|RNC_RICRS RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|189043343|sp|B0BW84|RNC_RICRO RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|259646551|sp|C3PMF3|RNC_RICAE RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|28262274|gb|EAA25778.1| ribonuclease III [Rickettsia sibirica 246]
 gi|157800510|gb|ABV75763.1| ribonuclease III [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165907814|gb|ABY72110.1| ribonuclease III [Rickettsia rickettsii str. Iowa]
 gi|228021405|gb|ACP53113.1| Ribonuclease III [Rickettsia africae ESF-5]
          Length = 227

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/223 (34%), Positives = 119/223 (53%), Gaps = 9/223 (4%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSI--SHSYQES--YERLEFLGDRILGLLISTLLFN 61
           +  LEK + Y+F N+ LL +AL+H S+   H Y++   YERLEFLGD +L L+I+ +LF 
Sbjct: 4   FEKLEKLLSYSFKNKELLIEALSHPSLRQHHEYKDDKDYERLEFLGDAVLNLVITEILFR 63

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA--DVV 119
           +F +  EG L+   + LV  ET   V  +L L ++I ++    ++V     ++    +  
Sbjct: 64  NFANYNEGNLAKIRSYLVCKETICMVGAKLTLKNYIIMTHG--EEVAGGRDNLNNIENAT 121

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTF 179
           E+LIAA+YLD  IE     ++K W +          D KT LQEWA A     P Y++  
Sbjct: 122 EALIAAIYLDSNIETTHDIIEKLWAEFIKVQNLTDYDPKTALQEWAQASDHHLPIYRLIK 181

Query: 180 RSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           R G  H   FTV+V++       G   + + AE+ AA  +L R
Sbjct: 182 REGASHSSTFTVLVKVKDYEQT-GTGHAIKEAEKNAARSLLHR 223


>gi|157803302|ref|YP_001491851.1| ribonuclease III [Rickettsia canadensis str. McKiel]
 gi|189043341|sp|A8EXI3|RNC_RICCK RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|157784565|gb|ABV73066.1| ribonuclease III [Rickettsia canadensis str. McKiel]
          Length = 227

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 79/221 (35%), Positives = 117/221 (52%), Gaps = 5/221 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSI--SHSYQES--YERLEFLGDRILGLLISTLLFN 61
           ++ LEK +GY+F N+ LL +AL+H S+   H Y+++  YERLEFLGD +L L+I+ +LF+
Sbjct: 4   FNELEKLLGYSFKNKELLIEALSHPSLRQHHEYKDNKDYERLEFLGDAVLNLVITKILFS 63

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVES 121
           +F S  EG L+   + LV  ET   V  +L L  +I ++            +   +  E+
Sbjct: 64  NFASYNEGNLAKIRSYLVCKETICMVGAKLALKDYIIMTYGEEVAGGRDNPNNIENATEA 123

Query: 122 LIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           LIAA+YLD  IE     + + W +          D KT LQEWA A     P Y +  R 
Sbjct: 124 LIAAIYLDSNIETTHNIIGQLWAEFIKVQNLTDYDPKTALQEWAQASDHHLPIYCLIKRE 183

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           G  H   FTV+V++       G+  S + AE+ AA  +L R
Sbjct: 184 GAAHSSTFTVLVKVKDYEQI-GIGYSIKEAEKNAARSLLHR 223


>gi|153208682|ref|ZP_01946929.1| ribonuclease III [Coxiella burnetii 'MSU Goat Q177']
 gi|212219222|ref|YP_002306009.1| ribonuclease III [Coxiella burnetii CbuK_Q154]
 gi|226741367|sp|B6J4J9|RNC_COXB1 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|120575793|gb|EAX32417.1| ribonuclease III [Coxiella burnetii 'MSU Goat Q177']
 gi|212013484|gb|ACJ20864.1| ribonuclease III [Coxiella burnetii CbuK_Q154]
          Length = 233

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/218 (33%), Positives = 125/218 (57%), Gaps = 7/218 (3%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L +R+G+ F N  LL+ ALTH S   S  ++ ERLEFLGD +LG +I++ L+     A
Sbjct: 5   NKLMERLGHQFNNLELLKIALTHRS---SGADNNERLEFLGDSVLGFIIASELYQRRPQA 61

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           +EG+LS    S+V+ +  +Q++ +L +  ++++    +K       SI AD +E+++ A+
Sbjct: 62  REGDLSRMRASMVNGDELAQMSIKLGINEYLQLGVGEQKSGGKRRRSILADALEAIVGAI 121

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKF--RRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           Y+D G+E     V  ++ +R     K   ++DAK+ LQEW  A+    P Y+V   +G  
Sbjct: 122 YIDAGLETCRRCVLNWYGERVDDLSKLSPKKDAKSLLQEWLQARRLPLPTYEVKI-TGEA 180

Query: 185 HDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLK 221
           H   FTV   + GL    +G++ ++R AEQ+AA   L+
Sbjct: 181 HAQTFTVNCYVKGLPHKTEGVNTTRRRAEQIAAKRFLE 218


>gi|291546254|emb|CBL19362.1| RNAse III [Ruminococcus sp. SR1/5]
          Length = 226

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 110/205 (53%), Gaps = 5/205 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLISTLLFNHFD 64
           LE+ IGY F  +SLLE+A+THSS ++          ERLEFLGD +L L+ S  L+  F 
Sbjct: 8   LEQTIGYQFTAKSLLEQAMTHSSYANEKHLGKLGCNERLEFLGDAVLELISSDFLYKKFR 67

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
           + +EGEL+ +  S+V  ++ +  ARE  L  FI +             SI +D +ESLI 
Sbjct: 68  NNQEGELTKKRASMVCEKSLAYCAREFGLPEFILLGRGEEMMGGRKRDSIVSDGLESLIG 127

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           A+YLDGG E A  FV K+     L+  +   D+KT LQE          EY++    GPD
Sbjct: 128 AMYLDGGFEPAQAFVMKFI-LNDLEDKRIFYDSKTVLQEMVQEGGNHPVEYRLLKEEGPD 186

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKR 209
           H   FTV   I+G +   G+  +K+
Sbjct: 187 HSKSFTVEALINGKSMGTGIGHTKK 211


>gi|307252103|ref|ZP_07534002.1| Ribonuclease 3 [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|306860403|gb|EFM92417.1| Ribonuclease 3 [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
          Length = 243

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 83/226 (36%), Positives = 119/226 (52%), Gaps = 8/226 (3%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ ++   L+K++ Y F N   L +ALTH S      ++ ERLEFLGD IL   I   LF
Sbjct: 18  MNNMQLERLQKKLSYQFTNLDYLLQALTHRSAGA---KNNERLEFLGDSILNFAIGKALF 74

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F  A EGELS    +LV  +T + +AR+  L  ++++ +   K       SI +D VE
Sbjct: 75  EKFPKANEGELSRMRATLVREQTLAILARQFGLGEYMKLGAGELKSGGYRRESILSDCVE 134

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRAL---KSGKFRRDAKTELQEWAHAKFGVTPEYKV 177
           ++IAA+YLD G++ A   V   W Q  L   K G  ++D KT LQE+   +    P Y+V
Sbjct: 135 AIIAAIYLDAGMDKAIAQVH-LWYQDLLAEMKPGDAQKDPKTRLQEFLQGRKLPLPTYEV 193

Query: 178 TFRSGPDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLKR 222
               G  H+  F V  +I  L     G+  S+R AEQ AA +VL +
Sbjct: 194 LDIKGEAHNQTFKVTCKIEMLEEIFIGIGTSRRKAEQNAAEQVLAK 239


>gi|257464706|ref|ZP_05629077.1| ribonuclease III [Actinobacillus minor 202]
 gi|257450366|gb|EEV24409.1| ribonuclease III [Actinobacillus minor 202]
          Length = 223

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 76/220 (34%), Positives = 120/220 (54%), Gaps = 6/220 (2%)

Query: 4   LRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           ++   L+K++GY F     L +ALTH S +    ++ ERLEFLGD IL   I   L++ F
Sbjct: 1   MQLERLQKKLGYQFETLDYLTQALTHRSAAS---KNNERLEFLGDSILNFTIGKALYDKF 57

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             A EGELS    +LV  +T + +AR+ +L  ++++ +   K       SI +D VE++I
Sbjct: 58  PKADEGELSRMRAALVREQTLAVIARQFELGEYLKLGAGELKSGGFRRESILSDCVEAII 117

Query: 124 AALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           AA+YLD G+E A   +  +++     +  G+ ++D KT LQE+   +    PEY+V    
Sbjct: 118 AAIYLDKGMEPAMERIYAWYETFLAEITPGEAQKDPKTRLQEFLQGRKLPLPEYEVIDIK 177

Query: 182 GPDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVL 220
           G  H+  F V  ++ G+     G   S+R AEQ  A +VL
Sbjct: 178 GEAHNQTFKVTCKVQGIDEIFTGQGTSRRKAEQNVAEKVL 217


>gi|15595050|ref|NP_212839.1| ribonuclease III [Borrelia burgdorferi B31]
 gi|7531188|sp|O51648|RNC_BORBU RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|2688625|gb|AAC67040.1| ribonuclease III (rnc) [Borrelia burgdorferi B31]
          Length = 246

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 113/212 (53%), Gaps = 9/212 (4%)

Query: 17  FANRSLLEKALTHSSISHSYQE---SYERLEFLGDRILGLLISTLLFNHFDSAKEGELSV 73
           F+N  LL  AL HSS S+   +   + ERLEFLGD +L L+I+  L+  + +  EGELS 
Sbjct: 30  FSNFDLLNTALCHSSYSNELDQKSSNNERLEFLGDSVLNLIITDHLYKTYPNKSEGELSK 89

Query: 74  RFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIE 133
             + +VS ++ S +ARE++L S+I +      +       I AD +E+ + A+YLD G  
Sbjct: 90  ARSYIVSEDSLSNIAREINLGSYILLGRGEESNDGRNKKGILADAIEAFVGAIYLDSGFS 149

Query: 134 VAGTFV----DKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
            A  FV    D Y +      G F +D K+ LQE+   K+ ++P YK+    GPDHD  F
Sbjct: 150 RATEFVVGLFDMYIRL-MFNRGDF-KDYKSLLQEYVQKKYKISPSYKLDKEIGPDHDKVF 207

Query: 190 TVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
            V + +     + G   SK+ AE  AA   LK
Sbjct: 208 CVELYVGENFISNGKGKSKKEAEMRAAEVALK 239


>gi|195941524|ref|ZP_03086906.1| ribonuclease III (rnc) [Borrelia burgdorferi 80a]
 gi|216264636|ref|ZP_03436628.1| ribonuclease III [Borrelia burgdorferi 156a]
 gi|218249229|ref|YP_002375205.1| ribonuclease III [Borrelia burgdorferi ZS7]
 gi|221217995|ref|ZP_03589462.1| ribonuclease III [Borrelia burgdorferi 72a]
 gi|223889463|ref|ZP_03624049.1| ribonuclease III [Borrelia burgdorferi 64b]
 gi|224532354|ref|ZP_03672984.1| ribonuclease III [Borrelia burgdorferi WI91-23]
 gi|224533390|ref|ZP_03673984.1| ribonuclease III [Borrelia burgdorferi CA-11.2a]
 gi|225548949|ref|ZP_03769926.1| ribonuclease III [Borrelia burgdorferi 94a]
 gi|225549922|ref|ZP_03770883.1| ribonuclease III [Borrelia burgdorferi 118a]
 gi|226320458|ref|ZP_03796024.1| ribonuclease III [Borrelia burgdorferi 29805]
 gi|226321403|ref|ZP_03796930.1| ribonuclease III [Borrelia burgdorferi Bol26]
 gi|215981109|gb|EEC21916.1| ribonuclease III [Borrelia burgdorferi 156a]
 gi|218164417|gb|ACK74478.1| ribonuclease III [Borrelia burgdorferi ZS7]
 gi|221192301|gb|EEE18521.1| ribonuclease III [Borrelia burgdorferi 72a]
 gi|223885149|gb|EEF56253.1| ribonuclease III [Borrelia burgdorferi 64b]
 gi|224512661|gb|EEF83032.1| ribonuclease III [Borrelia burgdorferi WI91-23]
 gi|224513555|gb|EEF83912.1| ribonuclease III [Borrelia burgdorferi CA-11.2a]
 gi|225369381|gb|EEG98833.1| ribonuclease III [Borrelia burgdorferi 118a]
 gi|225370552|gb|EEG99988.1| ribonuclease III [Borrelia burgdorferi 94a]
 gi|226233199|gb|EEH31951.1| ribonuclease III [Borrelia burgdorferi Bol26]
 gi|226234100|gb|EEH32815.1| ribonuclease III [Borrelia burgdorferi 29805]
 gi|312147960|gb|ADQ30619.1| ribonuclease III [Borrelia burgdorferi JD1]
 gi|312148997|gb|ADQ29068.1| ribonuclease III [Borrelia burgdorferi N40]
          Length = 245

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 113/212 (53%), Gaps = 9/212 (4%)

Query: 17  FANRSLLEKALTHSSISHSYQE---SYERLEFLGDRILGLLISTLLFNHFDSAKEGELSV 73
           F+N  LL  AL HSS S+   +   + ERLEFLGD +L L+I+  L+  + +  EGELS 
Sbjct: 29  FSNFDLLNTALCHSSYSNELDQKSSNNERLEFLGDSVLNLIITDHLYKTYPNKSEGELSK 88

Query: 74  RFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIE 133
             + +VS ++ S +ARE++L S+I +      +       I AD +E+ + A+YLD G  
Sbjct: 89  ARSYIVSEDSLSNIAREINLGSYILLGRGEESNDGRNKKGILADAIEAFVGAIYLDSGFS 148

Query: 134 VAGTFV----DKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
            A  FV    D Y +      G F +D K+ LQE+   K+ ++P YK+    GPDHD  F
Sbjct: 149 RATEFVVGLFDMYIRL-MFNRGDF-KDYKSLLQEYVQKKYKISPSYKLDKEIGPDHDKVF 206

Query: 190 TVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
            V + +     + G   SK+ AE  AA   LK
Sbjct: 207 CVELYVGENFISNGKGKSKKEAEMRAAEVALK 238


>gi|149192067|ref|ZP_01870292.1| ribonuclease III [Vibrio shilonii AK1]
 gi|148834092|gb|EDL51104.1| ribonuclease III [Vibrio shilonii AK1]
          Length = 225

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 111/204 (54%), Gaps = 6/204 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LEK++GY F +  LL  ALTH S + ++ E   RLEFLGD IL  +I+  L++ F    E
Sbjct: 8   LEKKLGYHFNDSELLMLALTHRSANGNHNE---RLEFLGDSILSFVIADDLYHRFPKVNE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G++S    +LV   T +++ RE  L  ++++     K       SI AD VE++I A+YL
Sbjct: 65  GDMSRMRATLVRGNTLAELGREFVLGDYLKLGPGELKSGGFRRDSILADAVEAIIGAIYL 124

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  +E+    V  ++  R  A+K G  ++D KT LQE+   +    P Y VT   G  H+
Sbjct: 125 DSDVEMVRKIVLSWYMTRLEAIKPGVSQKDPKTRLQEFLQGRRKPLPVYTVTNIKGEAHN 184

Query: 187 PRFTVVVEISGL-APAQGMDCSKR 209
             FTV  E++G+  P  G   S+R
Sbjct: 185 QEFTVSCEVAGVDEPVIGRGTSRR 208


>gi|46143661|ref|ZP_00134800.2| COG0571: dsRNA-specific ribonuclease [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
          Length = 226

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 83/226 (36%), Positives = 119/226 (52%), Gaps = 8/226 (3%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ ++   L+K++ Y F N   L +ALTH S      ++ ERLEFLGD IL   I   LF
Sbjct: 1   MNNMQLERLQKKLSYQFTNLDYLLQALTHRSAGA---KNNERLEFLGDSILNFAIGKALF 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F  A EGELS    +LV  +T + +AR+  L  ++++ +   K       SI +D VE
Sbjct: 58  EKFPKANEGELSRMRATLVREQTLAILARQFGLGEYMKLGAGELKSGGYRRESILSDCVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRAL---KSGKFRRDAKTELQEWAHAKFGVTPEYKV 177
           ++IAA+YLD G++ A   V   W Q  L   K G  ++D KT LQE+   +    P Y+V
Sbjct: 118 AIIAAIYLDAGMDKAIEQVH-LWYQDLLAEMKPGDAQKDPKTRLQEFLQGRKLPLPTYEV 176

Query: 178 TFRSGPDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLKR 222
               G  H+  F V  +I  L     G+  S+R AEQ AA +VL +
Sbjct: 177 LDIKGEAHNQTFKVTCKIEMLEEIFIGIGTSRRKAEQNAAEQVLAK 222


>gi|254499135|ref|ZP_05111825.1| ribonuclease III [Legionella drancourtii LLAP12]
 gi|254351674|gb|EET10519.1| ribonuclease III [Legionella drancourtii LLAP12]
          Length = 228

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 119/217 (54%), Gaps = 10/217 (4%)

Query: 11  KRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGE 70
           +RI Y F   + L++ALTH S+     E+YER EFLGD IL  +I+  LF+ F S  EG 
Sbjct: 10  RRIDYHFEKPAFLKQALTHCSVG---SENYERFEFLGDSILSFVIANELFHRFPSQSEGH 66

Query: 71  LSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDG 130
           LS   + LV  +   ++ARELDL  F+ +     K       SI +D +E++ AA++ DG
Sbjct: 67  LSRLRSFLVRGDMLVEIARELDLGDFLFLGQGELKSGGFRRASILSDALEAVFAAVFFDG 126

Query: 131 GIEVAGTFVDKYWKQRALKSGKFR---RDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDP 187
           G++ A   + K ++ R L+        +D+KT LQE+  A+    PEY +    G +H+ 
Sbjct: 127 GVDAAKEVILKLYRSR-LEDPNLNDCLKDSKTRLQEYLQAEKIALPEYALIKVEGDEHEQ 185

Query: 188 RF--TVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
            F  T  VE   L   QG   ++R AEQ+AA  +L++
Sbjct: 186 LFYITCTVEAEKLV-TQGEGSNRRKAEQLAAKAMLEQ 221


>gi|302554407|ref|ZP_07306749.1| ribonuclease III [Streptomyces viridochromogenes DSM 40736]
 gi|302472025|gb|EFL35118.1| ribonuclease III [Streptomyces viridochromogenes DSM 40736]
          Length = 274

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 116/215 (53%), Gaps = 6/215 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHF 63
           ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L+   
Sbjct: 20  HTLLEGRLGYKVES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTLYRTH 78

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
               EG+L+    ++V++   ++V R LDL SFIR+             SI AD +E++I
Sbjct: 79  PDLPEGQLAKLRAAVVNSRALAEVGRGLDLGSFIRLGRGEEGTGGRDKASILADTLEAVI 138

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKVTFRS 181
            A+YLD G++ A   V + +     KS       D KT LQE    +    PEY VT  +
Sbjct: 139 GAVYLDQGLDSAAELVHRLFDPLIEKSSNLGAGLDWKTSLQELTATEGLGVPEYLVT-ET 197

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 198 GPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 232


>gi|328885312|emb|CCA58551.1| Ribonuclease III [Streptomyces venezuelae ATCC 10712]
          Length = 270

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 116/215 (53%), Gaps = 6/215 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHF 63
           ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L+   
Sbjct: 17  HTLLEGRLGYQLES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTLYRTH 75

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
               EG+L+    ++V++   + V REL+L SFIR+             SI AD +E++I
Sbjct: 76  PDLPEGQLAKLRAAVVNSRALADVGRELELGSFIRLGRGEEGTGGRDKASILADTLEAVI 135

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKVTFRS 181
            A+YLD G++ A   V + +     KS       D KT LQE   A+    PEY V+   
Sbjct: 136 GAVYLDQGLDAASELVHRLFDPLIEKSSNLGAGLDWKTSLQELTAAEGLGVPEYLVS-EE 194

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 195 GPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 229


>gi|307247515|ref|ZP_07529560.1| Ribonuclease 3 [Actinobacillus pleuropneumoniae serovar 2 str.
           S1536]
 gi|307249746|ref|ZP_07531725.1| Ribonuclease 3 [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|307254355|ref|ZP_07536193.1| Ribonuclease 3 [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|307258813|ref|ZP_07540545.1| Ribonuclease 3 [Actinobacillus pleuropneumoniae serovar 11 str.
           56153]
 gi|306856018|gb|EFM88176.1| Ribonuclease 3 [Actinobacillus pleuropneumoniae serovar 2 str.
           S1536]
 gi|306858254|gb|EFM90331.1| Ribonuclease 3 [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|306862654|gb|EFM94610.1| Ribonuclease 3 [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|306867164|gb|EFM99020.1| Ribonuclease 3 [Actinobacillus pleuropneumoniae serovar 11 str.
           56153]
          Length = 243

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 83/226 (36%), Positives = 119/226 (52%), Gaps = 8/226 (3%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ ++   L+K++ Y F N   L +ALTH S      ++ ERLEFLGD IL   I   LF
Sbjct: 18  MNNMQLERLQKKLSYQFTNLDYLLQALTHRSAGA---KNNERLEFLGDSILNFAIGKALF 74

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F  A EGELS    +LV  +T + +AR+  L  ++++ +   K       SI +D VE
Sbjct: 75  EKFPKANEGELSRMRATLVREQTLAILARQFGLGEYMKLGAGELKSGGYRRESILSDCVE 134

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRAL---KSGKFRRDAKTELQEWAHAKFGVTPEYKV 177
           ++IAA+YLD G++ A   V   W Q  L   K G  ++D KT LQE+   +    P Y+V
Sbjct: 135 AIIAAIYLDAGMDKAIEQVH-LWYQDLLAEMKPGDAQKDPKTRLQEFLQGRKLPLPTYEV 193

Query: 178 TFRSGPDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLKR 222
               G  H+  F V  +I  L     G+  S+R AEQ AA +VL +
Sbjct: 194 LDIKGEAHNQTFKVTCKIEMLEEIFIGIGTSRRKAEQNAAEQVLAK 239


>gi|331269661|ref|YP_004396153.1| ribonuclease III [Clostridium botulinum BKT015925]
 gi|329126211|gb|AEB76156.1| Ribonuclease III [Clostridium botulinum BKT015925]
          Length = 236

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 81/220 (36%), Positives = 118/220 (53%), Gaps = 6/220 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESY--ERLEFLGDRILGLLISTLLFNHFD 64
           + +E ++   F + +LL+ ALTHSS  +  +  Y  ERLEFLGD IL L IS LL+N ++
Sbjct: 10  NEVENKLNVKFNDINLLDTALTHSSFVNENKNIYSNERLEFLGDSILQLCISELLYNKYE 69

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EG L+ +   +V   +  +VA+E ++  +I +S           TSI +D VE++IA
Sbjct: 70  QEPEGFLTKKRALIVCGNSLHEVAKEWNIGKYINMSKGEEMTGGRTRTSILSDCVEAIIA 129

Query: 125 ALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFG-VTPEYKVTFRS 181
           ++YLD G EVA  F+   + +  +   S +   D KT+LQE    KFG    EY++    
Sbjct: 130 SIYLDQGYEVAKKFIIDNFNEIIQKANSDQIILDYKTKLQETIQ-KFGDYNIEYRLVSFD 188

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           GP H  +F   V I       G   SK+ AEQ AA E LK
Sbjct: 189 GPPHRRKFITEVLIDSEVKGVGEGYSKKEAEQNAAKEALK 228


>gi|282861354|ref|ZP_06270419.1| ribonuclease III [Streptomyces sp. ACTE]
 gi|282564012|gb|EFB69549.1| ribonuclease III [Streptomyces sp. ACTE]
          Length = 274

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 78/219 (35%), Positives = 119/219 (54%), Gaps = 6/219 (2%)

Query: 2   SALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLL 59
           +A  ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L
Sbjct: 16  TASSHTLLEGRLGYHLES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTL 74

Query: 60  FNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVV 119
           +       EG+L+    ++V++   ++V R LDL SFIR+             SI AD +
Sbjct: 75  YRTHPDLPEGQLAKLRAAVVNSRALAEVGRGLDLGSFIRLGRGEEGTGGRDKASILADTL 134

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKV 177
           E++I A+YLD G++ A   V + +     +S       D KT LQE   ++    PEY V
Sbjct: 135 EAVIGAVYLDQGLDAASELVHRLFDPLIDRSSNLGAGLDWKTSLQELTASESLGVPEYLV 194

Query: 178 TFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           T  +GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 195 T-ETGPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 232


>gi|307260992|ref|ZP_07542674.1| Ribonuclease 3 [Actinobacillus pleuropneumoniae serovar 12 str.
           1096]
 gi|306869294|gb|EFN01089.1| Ribonuclease 3 [Actinobacillus pleuropneumoniae serovar 12 str.
           1096]
          Length = 243

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 83/226 (36%), Positives = 119/226 (52%), Gaps = 8/226 (3%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ ++   L+K++ Y F N   L +ALTH S      ++ ERLEFLGD IL   I   LF
Sbjct: 18  MNNMQLERLQKKLSYQFTNLDYLLQALTHRSAGA---KNNERLEFLGDSILNFAIGKALF 74

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F  A EGELS    +LV  +T + +AR+  L  ++++ +   K       SI +D VE
Sbjct: 75  EKFPKANEGELSRMRATLVREQTLAILARQFGLGEYMKLGAGELKSGGYRRESILSDCVE 134

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRAL---KSGKFRRDAKTELQEWAHAKFGVTPEYKV 177
           ++IAA+YLD G++ A   V   W Q  L   K G  ++D KT LQE+   +    P Y+V
Sbjct: 135 AIIAAIYLDAGMDKAIEQVH-LWYQDLLAEMKPGDAQKDPKTRLQEFLQGRKLPLPTYEV 193

Query: 178 TFRSGPDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLKR 222
               G  H+  F V  +I  L     G+  S+R AEQ AA +VL +
Sbjct: 194 LDIKGEAHNQTFKVTCKIEMLEEIFIGIGTSRRKAEQNAAEQVLAK 239


>gi|190149854|ref|YP_001968379.1| ribonuclease III [Actinobacillus pleuropneumoniae serovar 7 str.
           AP76]
 gi|189914985|gb|ACE61237.1| ribonuclease III [Actinobacillus pleuropneumoniae serovar 7 str.
           AP76]
          Length = 226

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 83/224 (37%), Positives = 118/224 (52%), Gaps = 8/224 (3%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ ++   L+K++ Y F N   L +ALTH S      ++ ERLEFLGD IL   I   LF
Sbjct: 1   MNNMQLERLQKKLSYQFTNLDYLLQALTHRSAGA---KNNERLEFLGDSILNFAIGKALF 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F  A EGELS    +LV  +T + +AR+  L  ++++ +   K       SI +D VE
Sbjct: 58  EKFPKANEGELSRMRATLVREQTLAILARQFGLGEYMKLGAGELKSGGYRRESILSDCVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRAL---KSGKFRRDAKTELQEWAHAKFGVTPEYKV 177
           ++IAA+YLD G++ A   V   W Q  L   K G  ++D KT LQE+   +    P Y+V
Sbjct: 118 AIIAAIYLDAGMDKAIEQVH-LWYQDLLAEMKPGDAQKDPKTRLQEFLQGRKLPLPTYEV 176

Query: 178 TFRSGPDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVL 220
               G  H+  F V  +I  L     G+  S+R AEQ AA +VL
Sbjct: 177 LDIKGEAHNQTFKVTCKIEMLEEIFIGIGTSRRKAEQNAAEQVL 220


>gi|94502127|ref|ZP_01308628.1| ribonuclease III [Oceanobacter sp. RED65]
 gi|94425729|gb|EAT10736.1| ribonuclease III [Oceanobacter sp. RED65]
          Length = 226

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 81/220 (36%), Positives = 115/220 (52%), Gaps = 6/220 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L +RIGY F + S  E ALTH S      ++ ERLEFLGD I+  +++  LF  F  AKE
Sbjct: 8   LSQRIGYTFNDISFFELALTHRSKGG---KNNERLEFLGDSIVNFVVAEALFEKFPQAKE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS     LV   T +++AR+ DL  F+ + S   K       SI AD VE++I A+YL
Sbjct: 65  GKLSRLRAGLVRGTTLAELARDFDLGEFLLLGSGELKSGGFNRESILADAVEAIIGAIYL 124

Query: 129 DGGIEVAGTFVDKYWKQRA--LKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D G++     +  ++ +R   L+     +DAKT LQE         P+Y+V   +G  HD
Sbjct: 125 DSGLDTVRERILTWYGKRLDDLQLDDVVKDAKTRLQEHLQKNQSRLPKYEVMEITGQAHD 184

Query: 187 PRFTVVVEISGLAPAQ-GMDCSKRAAEQVAAAEVLKREGI 225
             F V   +  L     G+  S+R AEQ AA + L   G+
Sbjct: 185 QNFKVSCWVETLPEVTIGLGSSRRLAEQSAAQKALNALGV 224


>gi|238650709|ref|YP_002916562.1| ribonuclease III [Rickettsia peacockii str. Rustic]
 gi|259646552|sp|C4K1R3|RNC_RICPU RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|238624807|gb|ACR47513.1| ribonuclease III [Rickettsia peacockii str. Rustic]
          Length = 227

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 78/223 (34%), Positives = 119/223 (53%), Gaps = 9/223 (4%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSI--SHSYQES--YERLEFLGDRILGLLISTLLFN 61
           +  LEK + Y+F N+ LL +AL+H S+   H Y++   YERLEFLGD +L L+I+ +LF 
Sbjct: 4   FEKLEKLLSYSFKNKELLIEALSHPSLRQHHEYKDDKDYERLEFLGDAVLNLVITEILFR 63

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA--DVV 119
           +F +  EG L+   + LV  ET   V  +L L ++I ++    ++V     ++    +  
Sbjct: 64  NFANYNEGNLAKIRSYLVCKETICMVGAKLTLKNYIIMTHG--EEVAGGRDNLNNIENAT 121

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTF 179
           E+LIAA+YLD  IE     ++K W +          D KT LQEWA A     P Y++  
Sbjct: 122 EALIAAIYLDSNIETTHDIIEKLWAEFIKVQNLTDYDPKTALQEWAQASDHHLPIYRLIK 181

Query: 180 RSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           R G  H   FTV+V++       G   + + AE+ AA  +L R
Sbjct: 182 REGASHASTFTVLVKVKDYEQT-GTGHAIKEAEKNAARSLLHR 223


>gi|311693675|gb|ADP96548.1| ribonuclease 3 [marine bacterium HP15]
          Length = 229

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 79/220 (35%), Positives = 115/220 (52%), Gaps = 6/220 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L++RIGY F +   L  ALTH S  +   ++ ERLEFLGD I+ ++I+  LF HF+ A+E
Sbjct: 10  LQRRIGYQFKSPERLLLALTHRSYGN---QNNERLEFLGDSIVNMVIAEYLFLHFEKARE 66

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS     +V   T +++ RE  L +++R+ S   K       SI AD VES+I A+YL
Sbjct: 67  GQLSRLRARMVKGVTLAEIGREFQLGTYLRLGSGELKSGGFRRESILADAVESIIGAIYL 126

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D         V ++++ R   L     ++D KT LQE+  ++    P Y V    G  H+
Sbjct: 127 DSDFHTCREQVLRWFEHRLEKLDLQDTQKDPKTRLQEYLQSRQFPLPRYDVISVDGEAHN 186

Query: 187 PRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKREGI 225
             F V   +  L     G   S+R AEQ AA   LK  G+
Sbjct: 187 QTFHVSCALPSLDRKTTGTGSSRRVAEQQAARNALKELGV 226


>gi|307263177|ref|ZP_07544798.1| Ribonuclease 3 [Actinobacillus pleuropneumoniae serovar 13 str.
           N273]
 gi|306871539|gb|EFN03262.1| Ribonuclease 3 [Actinobacillus pleuropneumoniae serovar 13 str.
           N273]
          Length = 243

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 83/224 (37%), Positives = 118/224 (52%), Gaps = 8/224 (3%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ ++   L+K++ Y F N   L +ALTH S      ++ ERLEFLGD IL   I   LF
Sbjct: 18  MNNMQLERLQKKLSYQFTNLDYLLQALTHRSAGA---KNNERLEFLGDSILNFAIGKALF 74

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F  A EGELS    +LV  +T + +AR+  L  ++++ +   K       SI +D VE
Sbjct: 75  EKFPKANEGELSRMRATLVREQTLAILARQFGLGEYMKLGAGELKSGGYRRESILSDCVE 134

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRAL---KSGKFRRDAKTELQEWAHAKFGVTPEYKV 177
           ++IAA+YLD G++ A   V   W Q  L   K G  ++D KT LQE+   +    P Y+V
Sbjct: 135 AIIAAIYLDAGMDKAIEQVH-LWYQDLLAEMKPGDAQKDPKTRLQEFLQGRKLPLPTYEV 193

Query: 178 TFRSGPDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVL 220
               G  H+  F V  +I  L     G+  S+R AEQ AA +VL
Sbjct: 194 LDIKGEAHNQTFKVTCKIEMLEEIFIGIGTSRRKAEQNAAEQVL 237


>gi|303248688|ref|ZP_07334942.1| ribonuclease III [Desulfovibrio fructosovorans JJ]
 gi|302489944|gb|EFL49870.1| ribonuclease III [Desulfovibrio fructosovorans JJ]
          Length = 233

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 80/223 (35%), Positives = 117/223 (52%), Gaps = 9/223 (4%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQES---YERLEFLGDRILGLLISTLLFNHF 63
           + LE  +G+ F    LL  ALTHSS ++   E+    ERLEFLGD +L L +S  LF  F
Sbjct: 5   TALENALGHVFVRPELLTTALTHSSYANERGEAAKHNERLEFLGDAVLELSVSEELFARF 64

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             A EGEL++  + LV+  + + +A  L L   I +             S+ +DV E++I
Sbjct: 65  PEAPEGELTLLRSQLVNESSLAAMALRLSLEDHILLGKGEENQGGRTRPSLLSDVFEAVI 124

Query: 124 AALYLDGGIEVAGTFVD----KYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTF 179
            AL+LDGG  VA +FV+    + W  R++      RD K+ LQE+        P Y +  
Sbjct: 125 GALFLDGGYGVAKSFVNATFAEVWPVRSVAPKT--RDYKSRLQEYTQKVHKARPVYTLLD 182

Query: 180 RSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
             GP+HD RFTV +E+        M+ S + AEQ+AA   L++
Sbjct: 183 SEGPEHDKRFTVRLELPDGHALTAMEKSVKKAEQMAARLALEK 225


>gi|212212136|ref|YP_002303072.1| ribonuclease III [Coxiella burnetii CbuG_Q212]
 gi|226741368|sp|B6IYZ9|RNC_COXB2 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|212010546|gb|ACJ17927.1| ribonuclease III [Coxiella burnetii CbuG_Q212]
          Length = 233

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 125/218 (57%), Gaps = 7/218 (3%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L +R+G+ F N  LL+ ALTH S   S  ++ ERLEFLGD +LG +I++ L+     A
Sbjct: 5   NKLMERLGHQFNNLELLKIALTHRS---SGADNNERLEFLGDSVLGFIIASELYQRRPQA 61

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           +EG+LS    S+V+ +  +Q++ +L +  ++++    +K       SI AD +E+++ ++
Sbjct: 62  REGDLSRMRASMVNGDELAQMSTKLGINEYLQLGVGEQKSGGKRRRSILADALEAIVGSI 121

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKF--RRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           Y+D G+E     V  ++ +R     K   ++DAK+ LQEW  A+    P Y+V   +G  
Sbjct: 122 YIDAGLETCRRCVLNWYGERVDDLSKLSPKKDAKSLLQEWLQARRLPLPTYEVKI-TGEA 180

Query: 185 HDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLK 221
           H   FTV   + GL    +G++ ++R AEQ+AA   L+
Sbjct: 181 HAQTFTVNCYVKGLPHKTEGVNTTRRRAEQIAAKRFLE 218


>gi|239928705|ref|ZP_04685658.1| ribonuclease III [Streptomyces ghanaensis ATCC 14672]
 gi|291437029|ref|ZP_06576419.1| ribonuclease III [Streptomyces ghanaensis ATCC 14672]
 gi|291339924|gb|EFE66880.1| ribonuclease III [Streptomyces ghanaensis ATCC 14672]
          Length = 286

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 116/215 (53%), Gaps = 6/215 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHF 63
           ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L+   
Sbjct: 30  HTLLEGRLGYQVES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTLYRTH 88

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
               EG+L+    ++V++   ++V R LDL SFIR+             SI AD +E++I
Sbjct: 89  PDLPEGQLAKLRAAVVNSRALAEVGRGLDLGSFIRLGRGEEGTGGRDKASILADTLEAVI 148

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKVTFRS 181
            A+YLD G++ A   V + +     KS       D KT LQE    +    PEY VT  +
Sbjct: 149 GAVYLDQGLDSAAELVHRLFDPLIEKSSNLGAGLDWKTSLQELTATEGLGVPEYLVT-ET 207

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 208 GPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 242


>gi|303256999|ref|ZP_07343013.1| ribonuclease III [Burkholderiales bacterium 1_1_47]
 gi|330999188|ref|ZP_08322907.1| ribonuclease III [Parasutterella excrementihominis YIT 11859]
 gi|302860490|gb|EFL83567.1| ribonuclease III [Burkholderiales bacterium 1_1_47]
 gi|329575388|gb|EGG56932.1| ribonuclease III [Parasutterella excrementihominis YIT 11859]
          Length = 228

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 84/229 (36%), Positives = 120/229 (52%), Gaps = 14/229 (6%)

Query: 4   LRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF--- 60
           L  + LE+RIGY F N+ LL +A+TH S S    E  ERLEFLGD +L  +I   LF   
Sbjct: 2   LPLTVLEERIGYTFKNKELLRRAMTHRSFS---AEHNERLEFLGDSVLNCVIGNALFLKD 58

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
            HFD   EG LS   ++LV     +++A  + ++ F++V +  +    +   S  AD VE
Sbjct: 59  KHFD---EGSLSRVRSNLVRQSALAEIAERIGISDFLKVGAGEKHTGGNHRPSTIADAVE 115

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQE-WAHAKFGVTPEYKV 177
           ++  A++ DGG E A T + + ++     L      +DAKT LQE      FG+ P Y +
Sbjct: 116 AIFGAVFTDGGFEEAQTVIIRLYEPMLSQLTPTTLGKDAKTNLQEVLQRMHFGL-PLYDI 174

Query: 178 TFRSGPDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLKREGI 225
               G  HD  F V V+I  L  +  G+  S+R AEQ AA + L  E I
Sbjct: 175 VEIRGAPHDQEFEVRVDIPDLGISLTGVGKSRRQAEQDAAQKALDSEAI 223


>gi|294631623|ref|ZP_06710183.1| ribonuclease III [Streptomyces sp. e14]
 gi|292834956|gb|EFF93305.1| ribonuclease III [Streptomyces sp. e14]
          Length = 275

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 78/219 (35%), Positives = 118/219 (53%), Gaps = 6/219 (2%)

Query: 2   SALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLL 59
           +A  ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L
Sbjct: 25  TASSHTLLEGRLGYRLES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTL 83

Query: 60  FNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVV 119
           +       EG+L+    ++V++   ++V R LDL +FIR+             SI AD +
Sbjct: 84  YRTHPDLPEGQLAKLRAAVVNSRALAEVGRGLDLGAFIRLGRGEEGTGGRDKASILADTL 143

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKV 177
           E++I A+YLD G++ A   V + +     KS       D KT LQE    +    PEY V
Sbjct: 144 EAVIGAVYLDQGLDAASELVHRLFDPLIEKSSNLGAGLDWKTSLQELTATEGLGVPEYLV 203

Query: 178 TFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           T  +GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 204 T-ETGPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 241


>gi|153871985|ref|ZP_02001008.1| Ribonuclease III [Beggiatoa sp. PS]
 gi|152071548|gb|EDN68991.1| Ribonuclease III [Beggiatoa sp. PS]
          Length = 225

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 116/217 (53%), Gaps = 5/217 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y+ L + +GY F     L  ALTH S+   + E   RLEFLGD +L  + + +L+  F S
Sbjct: 5   YNHLCQALGYHFKQPEHLTTALTHRSVGTPHNE---RLEFLGDALLNCITAKMLYERFPS 61

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
           A+EG+L+    +LV  +T  ++A+ L+L  ++R+     K   +  TS  AD VE++I A
Sbjct: 62  AREGQLTRLRANLVKRDTLVKIAQRLELGKYLRLGDGEIKSGGAKRTSTLADAVEAIIGA 121

Query: 126 LYLDGGIEVAGTFVDKYWKQRALK-SGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           +YLD  ++     +   W++   K S +  +D KT LQE+   +    P Y+V   SG  
Sbjct: 122 IYLDSDMKTCQAVILPIWQESLSKLSLEKIKDPKTRLQEYLQERQQTLPIYRVLSTSGTP 181

Query: 185 HDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVL 220
           H+  F V   I  L  P  G   S+R AEQ AAA+VL
Sbjct: 182 HEQHFEVECRIPYLKEPTYGSGHSRRRAEQSAAAKVL 218


>gi|254514114|ref|ZP_05126175.1| ribonuclease III [gamma proteobacterium NOR5-3]
 gi|219676357|gb|EED32722.1| ribonuclease III [gamma proteobacterium NOR5-3]
          Length = 224

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 87/219 (39%), Positives = 122/219 (55%), Gaps = 6/219 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE++ G    N SLL +AL+H S+      + ERLEFLGD +LG ++S  L+  F  A E
Sbjct: 7   LERQFGCRLQNGSLLTQALSHRSVGS---RNNERLEFLGDSVLGFVVSEELYRRFPDADE 63

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    SLV     + VARELDL   +R+ +           SI AD +E+L+ A+ L
Sbjct: 64  GQLSRLRVSLVKGSALAAVARELDLGDQLRLGAGEIHGGGRRRDSILADTLEALLGAIVL 123

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D GIE     + + ++ R  ALK  + R+D KT LQE+   +    P+Y +   +G DH 
Sbjct: 124 DLGIEACRAAISRVFQSRFDALKLEQARKDPKTRLQEFLQGRGRQLPDYVLCDAAGEDHA 183

Query: 187 PRFTVVVEIS-GLAPAQGMDCSKRAAEQVAAAEVLKREG 224
             FTV  E+S G   AQG+  S+RAAEQ AA  +L + G
Sbjct: 184 KIFTVACELSDGDEVAQGVGESRRAAEQAAATAILAQLG 222


>gi|304310579|ref|YP_003810177.1| Ribonuclease III [gamma proteobacterium HdN1]
 gi|301796312|emb|CBL44520.1| Ribonuclease III [gamma proteobacterium HdN1]
          Length = 231

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 112/215 (52%), Gaps = 7/215 (3%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           S L  RIGY F + +LL  ALTH S+S   Q + ERLEFLGD +L L+I   LF  F   
Sbjct: 5   SLLCSRIGYTFNDFNLLNLALTHRSVSG--QTNNERLEFLGDSVLNLIIGGELFTKFPQG 62

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           KEG+LS    SLV  ET +Q+  E  L  F+ +     K   +   S  AD VE++I A+
Sbjct: 63  KEGQLSRLRASLVRGETLAQIGGEFGLGEFLILGPGEHKSGGARRESTLADAVEAIIGAI 122

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQE-WAHAKFGVTPEYKVTFRSGP 183
           + + G   A   V +++  R  AL      +D KT LQE   H K G+ PEY++   SG 
Sbjct: 123 FCESGYNEARKVVLRWFDSRIQALTLNDTVKDNKTRLQEILQHLKMGL-PEYRILSVSGS 181

Query: 184 DHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAA 217
            H   F +   I+G+     G   S+R AEQ AA 
Sbjct: 182 SHQQVFQIECAITGVEERFAGSGLSRRQAEQQAAG 216


>gi|261368258|ref|ZP_05981141.1| ribonuclease III [Subdoligranulum variabile DSM 15176]
 gi|282569773|gb|EFB75308.1| ribonuclease III [Subdoligranulum variabile DSM 15176]
          Length = 225

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 121/226 (53%), Gaps = 10/226 (4%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ---ESYERLEFLGDRILGLLIST 57
           M+  +   L++ + Y F N +LL  ALTH+S ++  +      ERLEFLGD +L ++ + 
Sbjct: 1   MATHKPEELQEVLHYQFKNPALLRIALTHTSYANESKVPTTHNERLEFLGDSVLSVVAAD 60

Query: 58  LLFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQAD 117
            LF+  D   EGEL+    SLVS +   Q A+E+ L  ++R+             S+ +D
Sbjct: 61  YLFHQSDRP-EGELTRMRASLVSEDALFQFAQEIRLGDYLRLGHGEDLGGGRNRPSVVSD 119

Query: 118 VVESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKF-RRDAKTELQEWAHAKFGVTPEYK 176
             E++IAALYLDGG+EVA +F+  +     L  GK    D KT LQE           Y+
Sbjct: 120 AFEAVIAALYLDGGLEVARSFILPF-----LSEGKTAEEDYKTRLQEVVQQNPSARLRYE 174

Query: 177 VTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           V   +GPDH  +FTV V       A+G+  SK+AAEQ AA + L R
Sbjct: 175 VEGETGPDHAKQFTVAVYCDDKRLAEGVGRSKKAAEQHAAKQALDR 220


>gi|164688568|ref|ZP_02212596.1| hypothetical protein CLOBAR_02213 [Clostridium bartlettii DSM
           16795]
 gi|164602981|gb|EDQ96446.1| hypothetical protein CLOBAR_02213 [Clostridium bartlettii DSM
           16795]
          Length = 233

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 81/220 (36%), Positives = 119/220 (54%), Gaps = 6/220 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESY---ERLEFLGDRILGLLISTLLFNHFDS 65
            E++I Y F N+  + +ALTHSS S+   ++Y   ERLEFLGD +L ++IS  LF     
Sbjct: 14  FEQKINYEFKNKEYILEALTHSSYSNE-NKNYPFNERLEFLGDSVLSIVISDYLFKKETK 72

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EGEL+    ++V  E+ S+V++ + L  ++ +             SI AD +E++IAA
Sbjct: 73  LPEGELTKIRANIVCEESLSEVSKNIHLGKYMLLGKGEEATGGRERISILADALEAVIAA 132

Query: 126 LYLDGGIEVAGTFVDKYWKQRALKS--GKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           +YLDGGI+ A  F+    ++    S  GK  RD KT LQE   +       YK+    GP
Sbjct: 133 IYLDGGIKCAREFILTNMEKIINDSIKGKIFRDYKTCLQEVLQSNGENNIWYKLIEEKGP 192

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKRE 223
           DH+ RF + V I+      G   SK+ AEQVAA   L ++
Sbjct: 193 DHNKRFVMEVGINDTVLGVGEGKSKKDAEQVAAKCALDKK 232


>gi|167040357|ref|YP_001663342.1| ribonuclease III [Thermoanaerobacter sp. X514]
 gi|256750709|ref|ZP_05491594.1| ribonuclease III [Thermoanaerobacter ethanolicus CCSD1]
 gi|300914441|ref|ZP_07131757.1| ribonuclease III [Thermoanaerobacter sp. X561]
 gi|307724323|ref|YP_003904074.1| ribonuclease III [Thermoanaerobacter sp. X513]
 gi|166854597|gb|ABY93006.1| Ribonuclease III [Thermoanaerobacter sp. X514]
 gi|256750292|gb|EEU63311.1| ribonuclease III [Thermoanaerobacter ethanolicus CCSD1]
 gi|300889376|gb|EFK84522.1| ribonuclease III [Thermoanaerobacter sp. X561]
 gi|307581384|gb|ADN54783.1| ribonuclease III [Thermoanaerobacter sp. X513]
          Length = 246

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 84/224 (37%), Positives = 125/224 (55%), Gaps = 5/224 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQES---YERLEFLGDRILGLLISTLLFNHF 63
           S LE+RI Y+F +++LL +ALTHSS +H  + S    ERLEFLGD +L L+IS  L+ + 
Sbjct: 21  SELEERINYSFKDKNLLIEALTHSSWAHEGKNSKISNERLEFLGDSVLSLVISEYLYKNR 80

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
              +EG LS     +V   + ++ ARE++L +F+R+             SI AD +E+++
Sbjct: 81  KDLEEGSLSKYRAEIVCEPSLARCAREIELGNFLRIGKGEELTGGRERDSILADAMEAIL 140

Query: 124 AALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           AA+YLDGG+EV    + + +K     +  G   RD KT+LQE   +       Y++    
Sbjct: 141 AAVYLDGGLEVVRNVILELFKNIIEEVLEGLIYRDYKTKLQEVVQSMEIGKIIYELIEEM 200

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           GPDH+  F   V I  +   +G   SK+ AEQ AA E L + GI
Sbjct: 201 GPDHNKTFVTQVRIGDVILGKGYGKSKKEAEQAAAMEALIKLGI 244


>gi|134299915|ref|YP_001113411.1| ribonuclease III [Desulfotomaculum reducens MI-1]
 gi|189043307|sp|A4J683|RNC_DESRM RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|134052615|gb|ABO50586.1| RNAse III [Desulfotomaculum reducens MI-1]
          Length = 246

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 83/224 (37%), Positives = 116/224 (51%), Gaps = 7/224 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQES----YERLEFLGDRILGLLISTLLFNHFD 64
           L+ R+G+ + N +LL +ALTHSS  H  +       +RLEFLGD +L L+IS  L+  F 
Sbjct: 11  LKTRLGFKWHNPTLLIQALTHSSCVHENRGHGLCHNQRLEFLGDAVLELIISEHLYKMFP 70

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EGEL+    S V   + ++VAR LDL   +R+     +       SI AD  E+L+ 
Sbjct: 71  DRTEGELTKMRASSVCEPSLAKVARGLDLGRCLRMGRGEERSGGRERPSILADAFEALLG 130

Query: 125 ALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           A+YLD G+E++  FV          + +G+  RD KTELQE           Y +   SG
Sbjct: 131 AIYLDQGLEISRHFVLNCLSSIIDDVVAGRLDRDYKTELQEILQQSSPDPLTYTIMDESG 190

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR-EGI 225
           PDHD  FT  V   G    +G   SK+ AEQ AA +  +  EG+
Sbjct: 191 PDHDKTFTAGVIYKGKVIGKGSGHSKKEAEQQAAKDAFQHLEGM 234


>gi|307545610|ref|YP_003898089.1| ribonuclease III [Halomonas elongata DSM 2581]
 gi|307217634|emb|CBV42904.1| ribonuclease III [Halomonas elongata DSM 2581]
          Length = 229

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 114/213 (53%), Gaps = 6/213 (2%)

Query: 11  KRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGE 70
           +RIG+ FA   LLE A+TH S       + ERLEFLGD I+  +I+  LF  F  A+EG+
Sbjct: 10  RRIGHRFAQPELLELAMTHRSYGG---RNNERLEFLGDSIVNFVIAEDLFQRFPQAREGQ 66

Query: 71  LSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDG 130
           LS     LV  +T +++ARE+     +R+ S   K       SI AD VE++I A+YLD 
Sbjct: 67  LSRLRARLVKGQTLAELAREMSFGECLRLGSGEMKSGGHRRDSILADAVEAVIGAIYLDA 126

Query: 131 GIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           G++ A T V  ++ +R   +     ++D KT LQE+  ++    P Y+V    G  H   
Sbjct: 127 GMDTARTRVLSWFAERLETINLQDTQKDPKTRLQEFLQSRQVALPRYEVISVEGEAHAQT 186

Query: 189 FTVVVEISGLAPAQ-GMDCSKRAAEQVAAAEVL 220
           FTV   +  L     G+  S+R AEQ AA + L
Sbjct: 187 FTVECHVEMLDEHTLGIGSSRRHAEQQAAEQAL 219


>gi|225551799|ref|ZP_03772742.1| ribonuclease III [Borrelia sp. SV1]
 gi|225371594|gb|EEH01021.1| ribonuclease III [Borrelia sp. SV1]
          Length = 245

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 114/212 (53%), Gaps = 9/212 (4%)

Query: 17  FANRSLLEKALTHSSISHSYQE---SYERLEFLGDRILGLLISTLLFNHFDSAKEGELSV 73
           F+N  LL+ AL HSS S+   +   + ERLEFLGD +L L+I+  L+  + +  EGELS 
Sbjct: 29  FSNFDLLDTALCHSSYSNELDQKSSNNERLEFLGDSVLNLIITDHLYKTYPNKSEGELSK 88

Query: 74  RFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIE 133
             + +VS ++ S +ARE++L S+I +      +       I AD +E+ + A+YLD G  
Sbjct: 89  ARSYIVSEDSLSNIAREINLGSYILLGRGEESNDGRNKKGILADAIEAFVGAIYLDSGFL 148

Query: 134 VAGTFV----DKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
            A  FV    D Y +      G F +D K+ LQE+   K+ ++P YK+    GPDHD  F
Sbjct: 149 RATEFVVGLFDMYIRL-MFNRGDF-KDYKSLLQEYVQKKYKISPSYKLDKEIGPDHDKVF 206

Query: 190 TVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
            V + +     + G   SK+ AE  AA   LK
Sbjct: 207 CVELYVGENFISNGKGKSKKEAEMRAAEVALK 238


>gi|325478725|gb|EGC81836.1| ribonuclease III [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 236

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 119/214 (55%), Gaps = 6/214 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ---ESYERLEFLGDRILGLLISTLLFNHFDS 65
            E +IGY+F ++ L++ A THSS ++  +   +S ERLEFLGD IL +++S +LF H+++
Sbjct: 14  FENKIGYSFNDKELIDVAFTHSSYTNEARGESKSNERLEFLGDSILDMIVSEILFKHYNN 73

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG L+   + LV   + ++   + D++S++      ++        ++AD  E++ AA
Sbjct: 74  KPEGWLTKTRSRLVCTSSFAKACEKFDMSSYLNFGKGEKEHGGHLKKHVKADTFEAVCAA 133

Query: 126 LYLDGGIEVAGTFVDKYWKQRAL---KSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           +YLD   E     + K +K+ AL          D KT+LQE+ +AK     +Y++    G
Sbjct: 134 IYLDSSYEKLFDILVKNYKEEALVIINDDSIFNDYKTKLQEYHNAKDKKILKYELVKEEG 193

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           P+H   FT+ V++     A G+  +K+ AEQ AA
Sbjct: 194 PEHAKTFTMAVKLGNRILATGVGKNKKQAEQDAA 227


>gi|167623017|ref|YP_001673311.1| ribonuclease III [Shewanella halifaxensis HAW-EB4]
 gi|189043349|sp|B0TIV7|RNC_SHEHH RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|167353039|gb|ABZ75652.1| Ribonuclease III [Shewanella halifaxensis HAW-EB4]
          Length = 225

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 120/215 (55%), Gaps = 5/215 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L + +GY F  ++ L++ALTH S S+ + E   RLEFLGD IL ++IS  L++ F +A E
Sbjct: 10  LCRTLGYEFTEQAFLDQALTHRSASNKHNE---RLEFLGDSILSIVISDALYHQFPTATE 66

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV  +  +++A E  L  ++++     K       SI AD VE++I A+YL
Sbjct: 67  GDLSRMRATLVCGKMLAEIAIEFKLGDYLKLGPGELKSGGFRRESILADAVEAIIGAIYL 126

Query: 129 DGGIEVAGTFVDKYWKQR-ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDP 187
           D  IE   + V K+++ R  +     ++D KT LQE         P YKV    G  H+ 
Sbjct: 127 DSEIEKCRSLVLKWYESRLKVIEPINQKDPKTLLQEHLQKFRKPLPVYKVVHTEGDAHEQ 186

Query: 188 RFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLK 221
            FTV   +  L+ A  G+  S+R AEQ AAA+VL+
Sbjct: 187 TFTVECIVEDLSQAVVGVASSRRKAEQSAAAQVLE 221


>gi|323451297|gb|EGB07175.1| hypothetical protein AURANDRAFT_6264 [Aureococcus anophagefferens]
          Length = 227

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 82/220 (37%), Positives = 118/220 (53%), Gaps = 8/220 (3%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSI-SHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           +L KR+ + F +   LE ALTH S  +H+    +ERLEFLGDR+LGL+++  L +H+   
Sbjct: 3   SLSKRLDHDFDDLDHLEAALTHPSTGAHASTGRFERLEFLGDRVLGLVVAEWLHDHYPDE 62

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSD-LRKDVCSFMTSIQADVVESLIAA 125
            EGE  +R + LV  E    VA  L L   +R  S  L     +   ++ AD +E+++ A
Sbjct: 63  DEGESQIRHSGLVRTEALVAVAGGLRLDGHVRAKSHGLWVSRSNSNDTMVADALEAIVGA 122

Query: 126 LYLDGGIEVAGTFVDKYWKQRALKSGKFR--RDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           +++DGG   +   V K W     K+      RD KT LQE A       P Y+   ++GP
Sbjct: 123 VFVDGGYAASKRVVLKAWAPLLAKADATPPLRDPKTRLQEHAQKHKRPLPTYETIRKTGP 182

Query: 184 DHDPRFTVVVEI---SGLAPAQGMDCSKRAAEQVAAAEVL 220
           DHDP  TV       +  A A+GM  SKRAA  +AAA++L
Sbjct: 183 DHDPTITVQAHYGDRTANATAKGMHPSKRAA-SMAAAKIL 221


>gi|225019245|ref|ZP_03708437.1| hypothetical protein CLOSTMETH_03198 [Clostridium methylpentosum
           DSM 5476]
 gi|224947876|gb|EEG29085.1| hypothetical protein CLOSTMETH_03198 [Clostridium methylpentosum
           DSM 5476]
          Length = 228

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 83/226 (36%), Positives = 117/226 (51%), Gaps = 13/226 (5%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSISHS----YQESYERLEFLGDRILGLLISTLLFNHF 63
             EK IGY F N+ LLE+ALTHSS ++     + ++ ERLEFLGD ++ L+I+  LF +F
Sbjct: 3   NFEKTIGYTFHNQKLLEQALTHSSFTNETGRHHHKNNERLEFLGDSVVSLIIANHLFVNF 62

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
               EGEL+    SLV   + ++ A  +DL + + +             S   D  E+L+
Sbjct: 63  PDMPEGELTKLRASLVCDRSLAEFAGRIDLGNQLIMGKGEEHSGGRQRRSNLEDAFEALV 122

Query: 124 AALYLDGGIEVAGTFVDKYW-KQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTF--- 179
            A+YLDGG+E A +FV  +  K   L S     D KT LQE         PE K+++   
Sbjct: 123 GAIYLDGGLEAARSFVLGFIPKTLDLNSISRVTDYKTALQEIIQK----NPEEKLSYVLV 178

Query: 180 -RSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
             SGPDHD  F   V ++      G   SK+ AEQ AA + L+  G
Sbjct: 179 SESGPDHDKMFEAEVHLNSNVIGTGSGKSKKQAEQNAAKQALELMG 224


>gi|309805468|ref|ZP_07699513.1| ribonuclease III [Lactobacillus iners LactinV 09V1-c]
 gi|312872453|ref|ZP_07732522.1| ribonuclease III [Lactobacillus iners LEAF 2062A-h1]
 gi|312874441|ref|ZP_07734471.1| ribonuclease III [Lactobacillus iners LEAF 2052A-d]
 gi|312874574|ref|ZP_07734599.1| ribonuclease III [Lactobacillus iners LEAF 2053A-b]
 gi|315653376|ref|ZP_07906298.1| ribonuclease III [Lactobacillus iners ATCC 55195]
 gi|325911776|ref|ZP_08174180.1| ribonuclease III [Lactobacillus iners UPII 143-D]
 gi|308165119|gb|EFO67357.1| ribonuclease III [Lactobacillus iners LactinV 09V1-c]
 gi|311089965|gb|EFQ48384.1| ribonuclease III [Lactobacillus iners LEAF 2053A-b]
 gi|311090053|gb|EFQ48467.1| ribonuclease III [Lactobacillus iners LEAF 2052A-d]
 gi|311092035|gb|EFQ50410.1| ribonuclease III [Lactobacillus iners LEAF 2062A-h1]
 gi|315489301|gb|EFU78941.1| ribonuclease III [Lactobacillus iners ATCC 55195]
 gi|325476282|gb|EGC79444.1| ribonuclease III [Lactobacillus iners UPII 143-D]
          Length = 225

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 119/220 (54%), Gaps = 7/220 (3%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHFD 64
           + L+++    F N  LLE+ALTHSS S+ +Q  ++YE+LEFLGD +L L IS  L+ HF 
Sbjct: 8   NELQEKYQIKFNNEQLLEQALTHSSYSNEHQGCKNYEKLEFLGDAVLELAISDYLYRHFP 67

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
           +  EGEL+   +++V  E  SQ A E   +  +++     K       ++  DV E+   
Sbjct: 68  NMNEGELTRMRSNIVRTEGFSQFATECGFSREVKLGKGEEKSGSRTRHTLLEDVFEAFNG 127

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKF--RRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           AL+LD G+     F+        +  G F   RD KTELQE       +  +YKV     
Sbjct: 128 ALFLDQGMPAVQHFL-HLTVYPLIAEGDFDSSRDYKTELQEKLQVNGAIDIQYKVI--DS 184

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
            +  P+FTV + ++G   +QG+  SK+AAEQVAA+  LK 
Sbjct: 185 DEAQPKFTVQLIVAGENISQGIGRSKKAAEQVAASVALKN 224


>gi|308234556|ref|ZP_07665293.1| ribonuclease III [Atopobium vaginae DSM 15829]
 gi|328944154|ref|ZP_08241619.1| ribonuclease III [Atopobium vaginae DSM 15829]
 gi|327492123|gb|EGF23897.1| ribonuclease III [Atopobium vaginae DSM 15829]
          Length = 233

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 76/221 (34%), Positives = 109/221 (49%), Gaps = 3/221 (1%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNH 62
           R    E+ I Y F N+ L++ A+TH S         SYERLEFLGD ILG +++T +F  
Sbjct: 6   RIKHAEQIIEYTFENKRLIQAAITHPSAVEGLPVSASYERLEFLGDSILGAIVATDMFEK 65

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           F    EG L+    SLVS +T S VA EL +   I      +       TS   +V ESL
Sbjct: 66  FPGMDEGALTRMKISLVSGKTLSMVAEELGIGECIIFGDSEKGTGVRGFTSALENVYESL 125

Query: 123 IAALYLDGGIEVAGTFVDKYWKQRALKS-GKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           + ALYL+ G E    F+ +      +    K     K+ LQE    +F + P Y++   +
Sbjct: 126 VGALYLEAGYEPTVKFIRRTLTPYMVPELAKHPISPKSRLQEVCQKRFHIAPVYELEDET 185

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           GP H P+FT  V + G    +G   SK+ ++ +AA   L +
Sbjct: 186 GPAHAPQFTSAVFVDGELMGRGTGSSKKESQSIAALSALDK 226


>gi|268593250|ref|ZP_06127471.1| ribonuclease III [Providencia rettgeri DSM 1131]
 gi|291311145|gb|EFE51598.1| ribonuclease III [Providencia rettgeri DSM 1131]
          Length = 226

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 77/216 (35%), Positives = 116/216 (53%), Gaps = 6/216 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L++++GY F    LL +ALTH S S  + E   RLEFLGD IL  +I+  L++ F    E
Sbjct: 9   LQRKLGYQFKQNELLIQALTHRSASSKHNE---RLEFLGDSILSFVIANDLYHRFPKVDE 65

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G++S    +LV   T +++ARE +L   +R+     K       SI AD VE+LI  ++L
Sbjct: 66  GDMSRMRATLVRGNTLAEIAREFELGECLRLGPGELKSGGFRRESILADTVEALIGGIFL 125

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  I+     +  +++ R   +  G  ++D KT LQE+   +    P Y V    G  HD
Sbjct: 126 DSDIQTIERIILDWYQSRLVEISPGDKQKDPKTRLQEYLQGRHLPLPNYLVVQVKGEAHD 185

Query: 187 PRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLK 221
             FT+  ++SG+  P  G+  S+R AEQ AA + LK
Sbjct: 186 QEFTIHCQVSGIDQPINGVGSSRRKAEQAAAEQALK 221


>gi|289578474|ref|YP_003477101.1| ribonuclease III [Thermoanaerobacter italicus Ab9]
 gi|297544750|ref|YP_003677052.1| ribonuclease III [Thermoanaerobacter mathranii subsp. mathranii
           str. A3]
 gi|289528187|gb|ADD02539.1| ribonuclease III [Thermoanaerobacter italicus Ab9]
 gi|296842525|gb|ADH61041.1| ribonuclease III [Thermoanaerobacter mathranii subsp. mathranii
           str. A3]
          Length = 246

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 84/224 (37%), Positives = 122/224 (54%), Gaps = 5/224 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQES---YERLEFLGDRILGLLISTLLFNHF 63
           S LEK+I Y+F N+ LL +ALTHSS +H  + S    ERLEFLGD +L L+IS  L+ + 
Sbjct: 21  SELEKKINYSFKNKDLLIEALTHSSWAHEGKNSKISNERLEFLGDSVLSLVISEYLYKNR 80

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
              +EG LS     +V   + ++ ARE+ L +F+ +             S+ AD +E+L+
Sbjct: 81  KDLEEGSLSKYRAEIVCEPSLARCAREIGLGNFLLIGKGEEMTGGRERDSLLADAMEALL 140

Query: 124 AALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           AA+YLDGG+EV    +   ++     +  G   RD KT+LQE   +       Y++    
Sbjct: 141 AAVYLDGGLEVVRNIILDLFRNIIEEVLEGLIYRDYKTKLQEVVQSMGIGKITYELVKEI 200

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           GPDH+  F   V I  +A  +G   SK+ AEQ AA E L + GI
Sbjct: 201 GPDHNKTFITKVRIGDVALGEGYGKSKKEAEQAAAMEALVKLGI 244


>gi|33593415|ref|NP_881059.1| ribonuclease III [Bordetella pertussis Tohama I]
 gi|33597819|ref|NP_885462.1| ribonuclease III [Bordetella parapertussis 12822]
 gi|33602721|ref|NP_890281.1| ribonuclease III [Bordetella bronchiseptica RB50]
 gi|81424808|sp|Q7VW39|RNC_BORPE RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|81426476|sp|Q7W5J6|RNC_BORPA RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|81429935|sp|Q7WD32|RNC_BORBR RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|33572771|emb|CAE42703.1| ribonuclease III [Bordetella pertussis Tohama I]
 gi|33574248|emb|CAE38580.1| ribonuclease III [Bordetella parapertussis]
 gi|33577163|emb|CAE35720.1| ribonuclease III [Bordetella bronchiseptica RB50]
 gi|332382824|gb|AEE67671.1| ribonuclease III [Bordetella pertussis CS]
          Length = 256

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 82/223 (36%), Positives = 121/223 (54%), Gaps = 14/223 (6%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+A+  +TLE R+ + F +++LLE+ALTH S  H  + + ERLEFLGD +L  +++ +LF
Sbjct: 1   MTAMSLATLETRLDHRFGDKALLEQALTHRS--HGARHN-ERLEFLGDSVLNFVVAAMLF 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             +    EG+LS    +LV   + + +A+ LDL+ ++R+     K       SI AD VE
Sbjct: 58  ERYGKLDEGDLSRLRANLVKQASLADIAQRLDLSQYLRLGEGELKSGGFRRPSILADTVE 117

Query: 121 SLIAALYLDGGIEVA-GTFVDKYWKQRALKSGK-FRRDAKTELQEWAHAKFGVTPEYKVT 178
           +L  A++LD G E A    V +Y    A    K   +DAKT LQE+   +    P+Y V 
Sbjct: 118 ALFGAVFLDAGFEAARRVIVRQYQPVMAHVDPKTLGKDAKTLLQEFLQGRKLALPQYTVV 177

Query: 179 FRSGPDHDPRFTV-----VVEISGLAPAQGMDCSKRAAEQVAA 216
              G  H  +F V      +EI  +AP      S+RAAEQ AA
Sbjct: 178 ATHGAAHSQQFEVECAIPALEIKIVAPG----ASRRAAEQSAA 216


>gi|222824476|ref|YP_002576050.1| ribonuclease III [Campylobacter lari RM2100]
 gi|222539697|gb|ACM64798.1| ribonuclease III [Campylobacter lari RM2100]
          Length = 222

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 117/220 (53%), Gaps = 8/220 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L++R+ Y F N  LL +ALTH S    Y    ERLEFLGD ++ L++   LF  F    E
Sbjct: 5   LQERLNYHFKNEQLLIEALTHKSYKKPYNN--ERLEFLGDAVMDLVVGEFLFFKFQKESE 62

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G LS    +LV+ ++ + +A++LDL   I +S     +      SI +D  E+L+ A+YL
Sbjct: 63  GNLSKLRAALVNEKSFANLAQKLDLGECIFMSIAEENNDGRNKPSILSDAFEALMGAMYL 122

Query: 129 DGGIE----VAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           + G E    +A   +++ +    + +    +D KT+LQE   A    TPEY V    GPD
Sbjct: 123 EIGFEKTKNIALNLLNEVYPH--IDTQSLFKDYKTKLQEITQANMAGTPEYIVVNAFGPD 180

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           H  +F + ++I G   A+ +  SK+ A+Q  A   L++ G
Sbjct: 181 HKKQFEIAIKIQGKEFARAIAGSKKEAQQQCAKIALEKLG 220


>gi|260913782|ref|ZP_05920258.1| ribonuclease III [Pasteurella dagmatis ATCC 43325]
 gi|260632321|gb|EEX50496.1| ribonuclease III [Pasteurella dagmatis ATCC 43325]
          Length = 225

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 116/218 (53%), Gaps = 10/218 (4%)

Query: 9   LEKRIGYAFANRSLLEKALTH--SSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           L++++GY+F   SLLE+ALTH  +SI+H+     ERLEFLGD IL L I+  L++ F   
Sbjct: 8   LQRKLGYSFNQVSLLEQALTHRSASINHN-----ERLEFLGDAILNLTIAEALYHQFPKC 62

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EGELS    +LV   T + +AR+ +L  ++ +     K       SI AD VE++I A+
Sbjct: 63  NEGELSRMRATLVREPTLAILARKFELGDYLSLGPGELKSGGFRRESILADCVEAIIGAI 122

Query: 127 YLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
            LD  +      V  ++K     +K G  ++D KT LQE+   K    P Y V    G  
Sbjct: 123 SLDSNLPKTSKIVCNWYKSLLEEIKPGDNQKDPKTRLQEYLQGKRLPLPNYNVVDIKGEA 182

Query: 185 HDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLK 221
           H   FTV   +  +     G+  S+R AEQ AA ++L+
Sbjct: 183 HCQTFTVECYVKNIDRTFIGIGASRRKAEQAAAEKILQ 220


>gi|306833964|ref|ZP_07467088.1| ribonuclease III [Streptococcus bovis ATCC 700338]
 gi|304423965|gb|EFM27107.1| ribonuclease III [Streptococcus bovis ATCC 700338]
          Length = 228

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 79/226 (34%), Positives = 119/226 (52%), Gaps = 8/226 (3%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLIS 56
           M AL  + L++  G  F +++LLE A TH+S ++ ++       ERLEFLGD +L LLIS
Sbjct: 1   MQALD-TKLQQDFGIVFEDKTLLETAFTHTSYANEHRLLNISHNERLEFLGDAVLQLLIS 59

Query: 57  TLLFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA 116
             LF  +    EG+LS   + +V  E+ +  +R      FI++ +   K       +I  
Sbjct: 60  QYLFKKYPKKPEGDLSKMRSVIVREESLAGFSRYCGFDEFIKLGNGEEKSGGRNRDTILG 119

Query: 117 DVVESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPE 174
           D+ E+ + AL +D G+E    F+++    +  K G F R  D KT LQE       VT +
Sbjct: 120 DLFEAFLGALLMDQGVEAVNKFLNQVMIPQVEK-GNFERVKDYKTTLQELLQGHGDVTID 178

Query: 175 YKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
           Y+V+  SGP H   F V V ++  A +QG+  SK+ AEQ AA   L
Sbjct: 179 YRVSNESGPAHAKVFEVTVYVNDKAKSQGIGKSKKLAEQDAAKNAL 224


>gi|119358263|ref|YP_912907.1| ribonuclease III [Chlorobium phaeobacteroides DSM 266]
 gi|119355612|gb|ABL66483.1| RNAse III [Chlorobium phaeobacteroides DSM 266]
          Length = 273

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 80/226 (35%), Positives = 114/226 (50%), Gaps = 16/226 (7%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ------ESYERLEFLGDRILGLLISTLLFNH 62
           LE   G    N  L + ALTH S+ H Y+      +S +RLEFLGD +LGLLIS  LF +
Sbjct: 44  LETCAGSKGGNLFLYQTALTHRSVVHDYEHATPAVQSNQRLEFLGDAVLGLLISDYLFRN 103

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           F  ++EGELS     +V+ ++ +  AR + L   + +     K+      S  AD  ESL
Sbjct: 104 FPDSREGELSSNRAKIVNRKSLAGFARSIGLGKHLIIGESADKNKIRSSESALADAFESL 163

Query: 123 IAALYLDGGIEVAGTFVDKYWKQRALKSGKFR------RDAKTELQEWAHAKFGVTPEYK 176
           I A+YLD G++ A  FV K   + A     FR       + K++L E+  +     P YK
Sbjct: 164 IGAIYLDKGLDAAFAFVMKQITEHA----DFRSIVAAEHNYKSQLIEYTQSHHLPPPVYK 219

Query: 177 VTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           V    G +H+  FT+ V +      QG    K+ AEQ+AA E + R
Sbjct: 220 VIAEEGAEHEKTFTIEVSVDDRQMGQGTAPRKKDAEQLAAREAIDR 265


>gi|171909524|ref|ZP_02924994.1| putative Ribonuclease III [Verrucomicrobium spinosum DSM 4136]
          Length = 238

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 70/191 (36%), Positives = 101/191 (52%), Gaps = 5/191 (2%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSI---SHSYQESYERLEFLGDRILGLLISTLLFNHFD 64
           +LE RI Y F    LL++ALTH S+   S + Q   +RLE+LGD +L L++S  +++ F 
Sbjct: 3   SLESRIAYQFKQPELLQEALTHPSLPYESKNPQRHNQRLEYLGDAVLQLVLSEAIYHQFP 62

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EG L+     LV   T + +AR+L L   + +      +      S  ADV+ES+I 
Sbjct: 63  LDDEGLLTKLRTRLVQTRTLAHIARQLCLGRDLLLGKGEESNGGRSRESTLADVMESIIG 122

Query: 125 ALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           A+YLDGGIE    FV ++W     AL+      + K +LQE    + G TP Y++    G
Sbjct: 123 AVYLDGGIEAVRPFVLQHWSHDLAALQHSPVELNPKGQLQELLQGEGGNTPTYRIIAAEG 182

Query: 183 PDHDPRFTVVV 193
           PDH   F  VV
Sbjct: 183 PDHQKVFQAVV 193


>gi|88812349|ref|ZP_01127599.1| ribonuclease III [Nitrococcus mobilis Nb-231]
 gi|88790356|gb|EAR21473.1| ribonuclease III [Nitrococcus mobilis Nb-231]
          Length = 226

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 120/220 (54%), Gaps = 6/220 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           Y  L++R+GY F+  +LL +ALTH S   ++  + ERLEFLGD +L  +++  +F+    
Sbjct: 5   YDRLQERLGYRFSESTLLVRALTHRS---AFGPNNERLEFLGDSVLNFVVAAEVFDRRKQ 61

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
           A+EGELS     LV+  + + +AREL L   +R+     K       SI +D +E+++ A
Sbjct: 62  AREGELSRLRAKLVNQASLADIARELALGEALRLGGGEMKAGGQRRDSILSDTLEAIVGA 121

Query: 126 LYLDGGIEVAGTFVDKYW--KQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           +YLD G  +    + + +  + R L S +  +D KT LQE   +     PEY+V   +G 
Sbjct: 122 VYLDAGFAICREVIRRLYGNRLRELPSIRELKDPKTRLQEHLQSIRLPLPEYRVLEIAGR 181

Query: 184 DHDPRFTVVVEISGLAP-AQGMDCSKRAAEQVAAAEVLKR 222
            H   F V   I G+     G+  S+R AEQ AAA +L+R
Sbjct: 182 AHAQTFQVECRIIGVETVTHGLANSRRQAEQKAAASMLQR 221


>gi|121595570|ref|YP_987466.1| ribonuclease III [Acidovorax sp. JS42]
 gi|120607650|gb|ABM43390.1| RNAse III [Acidovorax sp. JS42]
          Length = 228

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 106/197 (53%), Gaps = 5/197 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M     STL++R+ + F++ SLL++ALTH S S  + E   RLEFLGD +L L +S+LLF
Sbjct: 1   MQPASLSTLQQRLQHQFSDASLLQRALTHRSFSADHNE---RLEFLGDSVLSLAVSSLLF 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
                  EGELS     LV  ++  Q+A  L L   +R+     K       SI AD +E
Sbjct: 58  RRMRDLPEGELSRVRALLVKQDSLHQIAVRLQLPPVLRLGEGEAKSGGKLRPSILADALE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRAL--KSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           ++I A+YLD G E A   V + ++   L  +  +  +DAKT LQEW   +    P+Y+V 
Sbjct: 118 AIIGAVYLDAGYECAEQLVHRLFEGVELSPRLQEAAKDAKTALQEWLQGRKMNLPQYRVV 177

Query: 179 FRSGPDHDPRFTVVVEI 195
             +G  H+  F V  E+
Sbjct: 178 STTGAAHNQVFHVECEV 194


>gi|222111791|ref|YP_002554055.1| ribonuclease iii [Acidovorax ebreus TPSY]
 gi|221731235|gb|ACM34055.1| ribonuclease III [Acidovorax ebreus TPSY]
          Length = 228

 Score =  118 bits (296), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 106/197 (53%), Gaps = 5/197 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M     STL++R+ + F++ SLL++ALTH S S  + E   RLEFLGD +L L +S+LLF
Sbjct: 1   MQPASLSTLQQRLQHQFSDASLLQRALTHRSFSADHNE---RLEFLGDSVLSLAVSSLLF 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
                  EGELS     LV  ++  Q+A  L L   +R+     K       SI AD +E
Sbjct: 58  RRMRDLPEGELSRVRALLVKQDSLHQIAVRLQLPPVLRLGEGEAKSGGKLRPSILADALE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRAL--KSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           ++I A+YLD G E A   V + ++   L  +  +  +DAKT LQEW   +    P+Y+V 
Sbjct: 118 AIIGAVYLDAGYECAEQLVHRLFEGVELSPRLQEAAKDAKTALQEWLQGRKMNLPQYRVV 177

Query: 179 FRSGPDHDPRFTVVVEI 195
             +G  H+  F V  E+
Sbjct: 178 STTGAAHNQVFHVECEV 194


>gi|126208025|ref|YP_001053250.1| ribonuclease III [Actinobacillus pleuropneumoniae L20]
 gi|189043287|sp|A3MZQ9|RNC_ACTP2 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|126096817|gb|ABN73645.1| ribonuclease III [Actinobacillus pleuropneumoniae serovar 5b str.
           L20]
          Length = 223

 Score =  118 bits (296), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 83/223 (37%), Positives = 117/223 (52%), Gaps = 8/223 (3%)

Query: 4   LRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           ++   L+K++ Y F N   L +ALTH S      ++ ERLEFLGD IL   I   LF  F
Sbjct: 1   MQLERLQKKLSYQFTNLDYLLQALTHRSAGA---KNNERLEFLGDSILNFAIGKALFEKF 57

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             A EGELS    +LV  +T + +AR+  L  ++R+ +   K       SI +D VE++I
Sbjct: 58  PKANEGELSRMRATLVREQTLAILARQFGLGEYMRLGAGELKSGGYRRESILSDCVEAII 117

Query: 124 AALYLDGGIEVAGTFVDKYWKQRAL---KSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           AA+YLD G++ A   V   W Q  L   K G  ++D KT LQE+   +    P Y+V   
Sbjct: 118 AAIYLDAGMDKAIEQVH-LWYQDLLAEMKPGDAQKDPKTRLQEFLQGRKLPLPTYEVLDI 176

Query: 181 SGPDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLKR 222
            G  H+  F V  +I  L     G+  S+R AEQ AA +VL +
Sbjct: 177 KGEAHNQTFKVTCKIEMLEEIFIGIGTSRRKAEQNAAEQVLAK 219


>gi|27364934|ref|NP_760462.1| ribonuclease III [Vibrio vulnificus CMCP6]
 gi|31076872|sp|Q8DC76|RNC_VIBVU RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|27361080|gb|AAO09989.1| ribonuclease III [Vibrio vulnificus CMCP6]
          Length = 225

 Score =  118 bits (296), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 109/204 (53%), Gaps = 6/204 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L +++GY F +  LL  ALTH S +  + E   RLEFLGD IL  +I+  L++ F    E
Sbjct: 8   LTRQLGYQFQDDELLNLALTHRSANSKHNE---RLEFLGDSILSFVIADELYHRFPKVNE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G++S    +LV   T +++ RE  L  ++++     K       SI AD VE++I A+YL
Sbjct: 65  GDMSRMRATLVRGNTLAELGREFGLGDYLKLGPGELKSGGFRRDSILADAVEAIIGAVYL 124

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  +EV    V  ++  R  A+K G  ++D KT LQE+   +    P Y VT   G  H+
Sbjct: 125 DSDLEVVRGIVLNWYTSRLEAIKPGVSQKDPKTRLQEFLQGRRKPLPVYTVTNIKGEAHN 184

Query: 187 PRFTVVVEISGL-APAQGMDCSKR 209
             FTV  +I+G+  P  G   S+R
Sbjct: 185 QEFTVECDIAGMDKPVVGRGTSRR 208


>gi|67459568|ref|YP_247192.1| ribonuclease III [Rickettsia felis URRWXCal2]
 gi|75536032|sp|Q4UKA8|RNC_RICFE RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|67005101|gb|AAY62027.1| Ribonuclease III [Rickettsia felis URRWXCal2]
          Length = 225

 Score =  118 bits (296), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 77/221 (34%), Positives = 115/221 (52%), Gaps = 5/221 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSI--SHSYQES--YERLEFLGDRILGLLISTLLFN 61
           +  LEK +GY+F N+ LL +AL+H S+   H Y++   YERLEFLGD +L L+++ +LF 
Sbjct: 4   FEKLEKLLGYSFKNKELLIEALSHPSLRQHHEYKDDKDYERLEFLGDAVLNLVVTEILFK 63

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVES 121
           +F +  EG L+   + LV  ET   V  +L L  +I ++            +   +  E+
Sbjct: 64  NFANYNEGNLAKIRSYLVCKETICVVGTKLTLKDYIIMTHGEEVAGGRDNPNNIENATEA 123

Query: 122 LIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           LIAA+YLD  IE     + K W +          D KT LQEWA A     P Y++  R 
Sbjct: 124 LIAAIYLDSNIETTRNIIGKLWAEFIKIQNLTDYDPKTALQEWAQASSHHLPIYRLIKRE 183

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           G  H   FTV+V++       G   S + AE+ AA ++L +
Sbjct: 184 GAAHSSTFTVLVKVKDYKQI-GTGHSIKEAEKNAARKLLHK 223


>gi|295111283|emb|CBL28033.1| ribonuclease III, bacterial [Synergistetes bacterium SGP1]
          Length = 251

 Score =  118 bits (296), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 71/217 (32%), Positives = 117/217 (53%), Gaps = 5/217 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSIS--HSYQESYERLEFLGDRILGLLISTLLFNHFD 64
           + L+  +GY+F +  LLE+AL H+S +  H    S ERLEFLGD +LG +++  L+  + 
Sbjct: 29  AALQAALGYSFRDEGLLEEALCHASFANEHGLAVSNERLEFLGDSVLGFVVARALYRLYP 88

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
            A+EG+L+ +   LV   +    AREL+L   I     +R +  +  TS+  D VE+L+ 
Sbjct: 89  EAREGDLTQKRAELVCGRSLRDRARELNLPPLILHGHSVRDE--ALPTSMCEDAVEALLG 146

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           A+ LDGG++ A   + + + Q A    +     K+ LQ W  A+    P Y++   +GP 
Sbjct: 147 AVCLDGGVQAAEGVIGRLFLQEAEVRAETDVSPKSRLQTWLQARRIPLPTYELVSVTGPS 206

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           H P F V + ++G+        +++ AE  AA  VL+
Sbjct: 207 HAPSFRVRLRVNGVE-HTACGSTRKGAESDAAERVLE 242


>gi|124515064|gb|EAY56575.1| ribonuclease III [Leptospirillum rubarum]
          Length = 247

 Score =  118 bits (296), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 78/224 (34%), Positives = 117/224 (52%), Gaps = 9/224 (4%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISH-----SYQESYERLEFLGDRILGLLISTLLFN 61
           S LE R+ Y F    LLE+A TH S  +         + ERLEFLGD +LGL+++  L  
Sbjct: 8   SELEDRLRYRFRKIDLLEEATTHKSFMNEGRRLGVTRNNERLEFLGDTVLGLVVAEYLMV 67

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVES 121
            +    EG LS     +VS  T + V+R L +  F+ +            +S+ AD +E+
Sbjct: 68  TYPKYPEGILSKFKGRVVSEPTLASVSRALGIGGFLLIGKGEELTQGREKSSLLADAMEA 127

Query: 122 LIAALYLDGGIEVAGTFVDKYWK---QRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +IAA+YLD G++ A TF+  +++   ++ +     + D KT+LQE+   +    P Y+V 
Sbjct: 128 VIAAIYLDSGLDAARTFIIGHFRSVIEQTVHEDSIQ-DYKTDLQEYCQRELETLPVYQVM 186

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
            + GPDH   F V V I G    +G   SK+ AEQ AA + L R
Sbjct: 187 DQRGPDHQKEFDVAVLIRGKIYGEGSGKSKKEAEQKAAKDALSR 230


>gi|15892080|ref|NP_359794.1| ribonuclease III [Rickettsia conorii str. Malish 7]
 gi|22654066|sp|Q92JB0|RNC_RICCN RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|15619202|gb|AAL02695.1| ribonuclease III [Rickettsia conorii str. Malish 7]
          Length = 227

 Score =  118 bits (296), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 77/223 (34%), Positives = 118/223 (52%), Gaps = 9/223 (4%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSI--SHSYQES--YERLEFLGDRILGLLISTLLFN 61
           +  LEK + Y+F N+ LL +AL+H S+   H Y++   YERLEFLGD +L L+I+ +LF 
Sbjct: 4   FEKLEKLLSYSFKNKELLIEALSHPSLRQHHEYKDDKDYERLEFLGDAVLNLVITEILFR 63

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA--DVV 119
           +F +  EG L+   + LV  ET   V  +L L ++I ++    ++V     ++    +  
Sbjct: 64  NFANYNEGNLAKIRSYLVCKETICMVGAKLTLKNYIIMTHG--EEVAGGRDNLNNIENAT 121

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTF 179
           E+LIAA+YLD  IE     ++  W +          D KT LQEWA A     P Y++  
Sbjct: 122 EALIAAIYLDSNIETTHDIIENLWAEFIKVQNLTDYDPKTALQEWAQASDHHLPIYRLIK 181

Query: 180 RSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           R G  H   FTV+V++       G   + + AE+ AA  +L R
Sbjct: 182 REGASHSSTFTVLVKVKDYEQT-GTGHTIKEAEKNAARSLLHR 223


>gi|288905744|ref|YP_003430966.1| Ribonuclease III [Streptococcus gallolyticus UCN34]
 gi|306831841|ref|ZP_07464997.1| ribonuclease III [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
 gi|325978776|ref|YP_004288492.1| ribonuclease III [Streptococcus gallolyticus subsp. gallolyticus
           ATCC BAA-2069]
 gi|288732470|emb|CBI14042.1| Ribonuclease III [Streptococcus gallolyticus UCN34]
 gi|304426039|gb|EFM29155.1| ribonuclease III [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
 gi|325178704|emb|CBZ48748.1| ribonuclease III [Streptococcus gallolyticus subsp. gallolyticus
           ATCC BAA-2069]
          Length = 228

 Score =  118 bits (296), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 79/226 (34%), Positives = 119/226 (52%), Gaps = 8/226 (3%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLIS 56
           M AL  + L++  G  F +++LLE A TH+S ++ ++       ERLEFLGD +L LLIS
Sbjct: 1   MQALD-TKLQRDFGIVFEDKTLLETAFTHTSYANEHRLLNISHNERLEFLGDAVLQLLIS 59

Query: 57  TLLFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA 116
             LF  +    EG+LS   + +V  E+ +  +R      FI++ +   K       +I  
Sbjct: 60  QYLFKKYPKKPEGDLSKMRSVIVREESLAGFSRYCGFDEFIKLGNGEEKSGGRNRDTILG 119

Query: 117 DVVESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPE 174
           D+ E+ + AL +D G+E    F+++    +  K G F R  D KT LQE       VT +
Sbjct: 120 DLFEAFLGALLMDQGVEAVNKFLNQVMIPQVEK-GNFERVKDYKTTLQELLQGHGDVTID 178

Query: 175 YKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
           Y+V+  SGP H   F V V ++  A +QG+  SK+ AEQ AA   L
Sbjct: 179 YRVSNESGPAHAKVFEVTVYVNDEAKSQGIGRSKKLAEQDAAKNAL 224


>gi|320155320|ref|YP_004187699.1| ribonuclease III [Vibrio vulnificus MO6-24/O]
 gi|56749444|sp|Q7MHN8|RNC_VIBVY RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|319930632|gb|ADV85496.1| ribonuclease III [Vibrio vulnificus MO6-24/O]
          Length = 225

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 109/204 (53%), Gaps = 6/204 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L +++GY F +  LL  ALTH S +  + E   RLEFLGD IL  +I+  L++ F    E
Sbjct: 8   LTRQLGYQFQDDELLNLALTHRSANSKHNE---RLEFLGDSILSFVIADELYHRFPKVNE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G++S    +LV   T +++ RE  L  ++++     K       SI AD VE++I A+YL
Sbjct: 65  GDMSRMRATLVRGNTLAELGREFGLGDYLKLGPGELKSGGFRRDSILADAVEAIIGAVYL 124

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  +EV    V  ++  R  A+K G  ++D KT LQE+   +    P Y VT   G  H+
Sbjct: 125 DSDLEVVRGIVLNWYASRLEAIKPGVSQKDPKTRLQEFLQGRRKPLPVYTVTNIKGEAHN 184

Query: 187 PRFTVVVEISGL-APAQGMDCSKR 209
             FTV  +I+G+  P  G   S+R
Sbjct: 185 QEFTVECDIAGMDKPVVGRGTSRR 208


>gi|270304349|gb|ACZ71259.1| RNAse type III [Escherichia coli BL21]
          Length = 226

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 75/225 (33%), Positives = 123/225 (54%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F ++ LL++ALTH   S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPIVINRLQRKLGYTFNHQELLQQALTHRRASRKHNE---RLEFLGDSILSYVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE +L   +R+ +   K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAELAREFELGECLRLGTGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRA--LKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++L+  I+     +  +++ R   +  G  ++D KT + E+   +    P Y V 
Sbjct: 118 ALIGGVFLESDIQTVEKLILNWYQTRVDEISPGDKQKDPKTRVHEYLQGRHLPLPTYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SGL+ P  G   S+R AEQ AA + LK+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAAAEQALKK 222


>gi|221194650|ref|ZP_03567707.1| ribonuclease III [Atopobium rimae ATCC 49626]
 gi|221185554|gb|EEE17944.1| ribonuclease III [Atopobium rimae ATCC 49626]
          Length = 243

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 87/224 (38%), Positives = 108/224 (48%), Gaps = 3/224 (1%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSI--SHSYQESYERLEFLGDRILGLLISTLLFNH 62
           R    EK   + F  R L+E ALTH S         SYERLEFLGD ILG +++T LF  
Sbjct: 6   RIRAAEKICNHVFKRRDLIEAALTHPSAVEDKPVSASYERLEFLGDSILGAIVATDLFER 65

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           +    EGEL+    SLVS  T S VA  L +   I      R      M S   +V ES+
Sbjct: 66  YPEMDEGELTRLKISLVSGHTLSLVAEALGIGPLIITGVSERGTGGRGMRSALENVYESI 125

Query: 123 IAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR-DAKTELQEWAHAKFGVTPEYKVTFRS 181
           + ALYLD G E    FV +        +   R    K+ LQE   A    TPEY++   S
Sbjct: 126 VGALYLDAGYEPTHEFVIRTLAPHISPALAERSVSPKSRLQEAVQANGKSTPEYELVSES 185

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           GP H P F  VV + G    +G   SK+AAE  AA + L R G+
Sbjct: 186 GPAHTPTFISVVSVDGCKVGRGQGHSKKAAEAAAAQDALVRLGV 229


>gi|293391848|ref|ZP_06636182.1| ribonuclease III [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290952382|gb|EFE02501.1| ribonuclease III [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 226

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 113/228 (49%), Gaps = 6/228 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M   +   L+++I Y F N  LL++ALTH S  H + E   RLEFLGD IL L I   LF
Sbjct: 1   MKENQLERLQRQINYRFQNIELLKQALTHRSAGHQHNE---RLEFLGDAILNLTIGEALF 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EGELS    +LV   T + +AR+  L  +I +     K       SI AD VE
Sbjct: 58  HQFPKCNEGELSRMRATLVREPTLALLARDFKLGDYILLGQGELKSGGFRRESILADCVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           ++I A+ LD  +  A   V ++++   + +K G  ++DAKT LQE+        P Y + 
Sbjct: 118 AIIGAISLDSNLTNATQIVCQWYQNLLKEIKPGDNQKDAKTRLQEYLQGNRLPLPTYNIV 177

Query: 179 FRSGPDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLKREGI 225
              G  H+  F V   I        G   S+R AEQ AA ++L+   I
Sbjct: 178 NIQGEAHNQLFIVECSIQNSDRTFIGKGSSRRKAEQAAAEQILQELNI 225


>gi|319787580|ref|YP_004147055.1| ribonuclease III [Pseudoxanthomonas suwonensis 11-1]
 gi|317466092|gb|ADV27824.1| ribonuclease III [Pseudoxanthomonas suwonensis 11-1]
          Length = 230

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 81/218 (37%), Positives = 118/218 (54%), Gaps = 6/218 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + +  RIG+AFA+ SLL++ALTH S    + E   RLEFLGD ++ L+ +  L+  +  A
Sbjct: 7   TVVRDRIGHAFADPSLLQQALTHRSAGSPHNE---RLEFLGDAVVNLIAAEALYQRWPKA 63

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG L+     LV   + + +AREL L   + +     K       SI AD +E+++AA+
Sbjct: 64  DEGVLTRARAELVREASLAVIARELQLGERLTLGPGELKSGGFRRDSILADALEAVVAAI 123

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLD G +     V  +++Q   AL  G+  +DAKT LQEW   +    P Y++   SG D
Sbjct: 124 YLDAGYDACRAHVLPWFEQSIAALPVGQPGKDAKTRLQEWLQGRGKPLPAYELVSESGED 183

Query: 185 HDPRFTVVVEIS-GLAPAQGMDCSKRAAEQVAAAEVLK 221
           H   F     +S   A A+G   S+R AEQ AAA VL+
Sbjct: 184 HAKVFLARCTLSEPPASAEGQGTSRRLAEQAAAAAVLE 221


>gi|56459918|ref|YP_155199.1| RNase III, dsRNA-specific ribonuclease [Idiomarina loihiensis L2TR]
 gi|81363596|sp|Q5R106|RNC_IDILO RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|56178928|gb|AAV81650.1| Rnase III, dsRNA-specific ribonuclease [Idiomarina loihiensis L2TR]
          Length = 229

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 114/206 (55%), Gaps = 6/206 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + LEK +GY+F  + LL +A+TH S S ++ E   RLEFLGD ILGL+I+  L+  F   
Sbjct: 9   TELEKIVGYSFEQQGLLHQAMTHRSASSTHNE---RLEFLGDSILGLVIAEALYQKFPKV 65

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG+LS    ++V   + +++ +++ L  F+ +     K       SI AD VE++I A+
Sbjct: 66  AEGDLSRMRAAIVCGRSLAKLGKKMGLGDFLSLGQGELKSGGYRRESILADAVEAIIGAI 125

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLD  ++     +  +++ +   ++ G  ++D KT LQE   A+    PEY V    G  
Sbjct: 126 YLDSDMDTIRQVILNWFEPQLTLIEPGTSQKDPKTRLQELLQARQKPLPEYDVVATQGQA 185

Query: 185 HDPRFTVVVEISGL-APAQGMDCSKR 209
           H+ +FTV   + G+ +P +G   S+R
Sbjct: 186 HNQQFTVNCSVEGIESPFKGTGTSRR 211


>gi|145300361|ref|YP_001143202.1| ribonuclease III [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142853133|gb|ABO91454.1| ribonuclease III [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 223

 Score =  118 bits (295), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 82/222 (36%), Positives = 120/222 (54%), Gaps = 6/222 (2%)

Query: 4   LRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           ++ + L+ R+G+ F ++ LL +ALTH S    + E   RLEFLGD IL L+I+  LF+ F
Sbjct: 3   IKMNRLQSRLGHVFHDKELLTRALTHRSAGSRHNE---RLEFLGDSILSLVIADALFHRF 59

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             A EG+LS    +LV  +T +++ RE DL   + +     K       SI AD VE++I
Sbjct: 60  PQAAEGDLSRMRATLVREKTLAELGREFDLGDDLILGPGELKSGGFRRESILADTVEAVI 119

Query: 124 AALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
            A+YLD  +E     +  ++  R   +K G  ++D KT LQE         P Y VT   
Sbjct: 120 GAVYLDTDLEAVRVLLLSWYASRLDEIKPGIEQKDPKTRLQEILQGSRKSLPTYTVTNVK 179

Query: 182 GPDHDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
           G  H+  FTV  ++ GL  P  G+  S+R AEQ AA + L+R
Sbjct: 180 GEAHNQEFTVQCDVEGLDGPLVGVGTSRRKAEQAAAQQALER 221


>gi|268318202|ref|YP_003291921.1| ribonuclease III [Rhodothermus marinus DSM 4252]
 gi|262335736|gb|ACY49533.1| ribonuclease III [Rhodothermus marinus DSM 4252]
          Length = 260

 Score =  118 bits (295), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 110/210 (52%), Gaps = 6/210 (2%)

Query: 19  NRSLLEKALTHSSI----SHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELSVR 74
           N +L E+ALTH S+      S+  S ERLEFLGD +LG +++  L+ HF    EG L+  
Sbjct: 39  NAALYEQALTHRSVLRGQPDSHLHSNERLEFLGDAVLGFVVAAYLYEHFPDRNEGFLTRL 98

Query: 75  FNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIEV 134
              LV+ E  +Q AR L L + +R+S ++ +       SI +D  E+L+ A+YLD G+E 
Sbjct: 99  RAKLVNREALAQAARRLGLGAHVRLSENMERAGGRDNDSILSDAFEALVGAIYLDLGLEA 158

Query: 135 AGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVV 192
           A  FV++            RR  + K+ L E+A A+    P Y+V    GP H   FTV 
Sbjct: 159 ARAFVERALLAPLDLEALARRPDNYKSLLLEFAQARGWPQPRYRVVAEEGPSHARTFTVE 218

Query: 193 VEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
             I      +G   SK+ AEQ AA E L R
Sbjct: 219 AWIGNRRLGRGTAGSKKQAEQQAAREALAR 248


>gi|313888515|ref|ZP_07822182.1| ribonuclease III [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312845544|gb|EFR32938.1| ribonuclease III [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 231

 Score =  118 bits (295), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 80/230 (34%), Positives = 119/230 (51%), Gaps = 11/230 (4%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLIS 56
           M+      LE+++ Y F ++ LLE ALTHSS  +  +    ES ERLEFLGD +LGL+I 
Sbjct: 1   MTFSNLKNLERKLNYDFKDKGLLETALTHSSYVNENKMKQYESNERLEFLGDAVLGLVIG 60

Query: 57  TLLFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA 116
              + +F    EG L+      V+ +    +A+ L+L  FIR     +K+  S   S  A
Sbjct: 61  EYFYKNFPKDLEGSLTKMRAESVNEKVLFFIAKGLELGDFIRFGKGEKKNGGSKRESTSA 120

Query: 117 DVVESLIAALYLDGGIEVAGTFV----DKYWKQRALKSGKFRRDAKTELQEWAHAKFGVT 172
           D +E+LI A++LD     A   V    D++ K+ A K   F  D KT LQE    + G  
Sbjct: 121 DALEALIGAIFLDSNFNNAKKIVLNLFDEFLKEDAYKL--FNVDFKTMLQEEVQ-RSGQK 177

Query: 173 PEYKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
            EYK+    GPD+D  F   + +  +   +G   +K+ ++Q AA E L+R
Sbjct: 178 AEYKLVREEGPDNDKTFFTELYLDEVLAGKGSGKTKKESQQEAAREALER 227


>gi|319760660|ref|YP_004124598.1| ribonuclease III [Candidatus Blochmannia vafer str. BVAF]
 gi|318039374|gb|ADV33924.1| ribonuclease III [Candidatus Blochmannia vafer str. BVAF]
          Length = 231

 Score =  118 bits (295), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 71/224 (31%), Positives = 122/224 (54%), Gaps = 6/224 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           MS+L ++ L+ ++GY F    LLE ALTH S S+ + E   RLEFLGD IL  +++ LL+
Sbjct: 1   MSSLDFNVLQGKLGYFFCKLDLLELALTHRSFSNQHNE---RLEFLGDAILNYVVANLLY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + ++   EG++S   ++LV ++T  ++A+E ++  ++++     K+      SI ++ VE
Sbjct: 58  HRYNCISEGDMSRIRSNLVCSKTLVRLAKEFNVGEYLKLGQGELKNGGISRESILSNTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYW--KQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           ++I  ++LD  ++     ++ ++     A+     ++D KT LQE+        P Y V 
Sbjct: 118 AIIGGVFLDSNMKTVEILINNWYLCHLNAINFMNKQKDPKTRLQEYLQRHGCPLPIYYVN 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLK 221
              G  H   FT+  +IS L  P+ G   S + AEQ AA   LK
Sbjct: 178 RIQGKAHSQMFTIFCQISQLTDPSIGYGSSIQKAEQSAAENALK 221


>gi|322420696|ref|YP_004199919.1| ribonuclease III [Geobacter sp. M18]
 gi|320127083|gb|ADW14643.1| ribonuclease III [Geobacter sp. M18]
          Length = 224

 Score =  118 bits (295), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 121/207 (58%), Gaps = 2/207 (0%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISH-SYQESYERLEFLGDRILGLLISTLLFNHFDSAK 67
           LE ++GY F+NR LLE+ALTH + ++ +  +  +RLEF GD +L  L+S LL   F  ++
Sbjct: 4   LEGKLGYRFSNRELLEEALTHRTYANEAGGKDNQRLEFFGDAVLDFLLSDLLLQRFPDSR 63

Query: 68  EGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALY 127
           EGEL+    +LV   + +++A  L+L + +R+     K       S+ AD  E+L+AALY
Sbjct: 64  EGELTKMRAALVDEVSLARIAAGLELGAALRLGRGEEKGGGRQKRSLLADAFEALLAALY 123

Query: 128 LDGGIEVAGTFVDKYWKQRALKSGKF-RRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           LDGG++ A   V + ++    +      RDAKTELQE A    G  P Y++   +GPDHD
Sbjct: 124 LDGGVDTARRVVHELFEPLLCRPEILCGRDAKTELQERARLLRGKLPRYQLKQVTGPDHD 183

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQ 213
            RFTV + +      +G+  +K+ AEQ
Sbjct: 184 RRFTVEIFLGSELMGEGVGRTKKEAEQ 210


>gi|318056548|ref|ZP_07975271.1| ribonuclease III [Streptomyces sp. SA3_actG]
 gi|318076722|ref|ZP_07984054.1| ribonuclease III [Streptomyces sp. SA3_actF]
          Length = 275

 Score =  118 bits (295), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 81/220 (36%), Positives = 121/220 (55%), Gaps = 8/220 (3%)

Query: 2   SALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLL 59
           +A  ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L
Sbjct: 19  AASSHTLLEGRLGYHLES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTL 77

Query: 60  FNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVV 119
           +       EG+L+    ++V++   ++V+R LDL +FIR+             SI AD +
Sbjct: 78  YRTHPDLPEGQLAKLRAAVVNSRALAEVSRGLDLGAFIRLGRGEEGTGGRDKASILADTL 137

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEW-AHAKFGVTPEYK 176
           E++I A+YLD G++ A   V + +     KS +     D KT LQE  A    GV PEY 
Sbjct: 138 EAVIGAVYLDQGLDKAAELVHRLFDPLIEKSAELGAGLDWKTSLQELTAMEGLGV-PEYL 196

Query: 177 VTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           VT   GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 197 VT-EEGPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 235


>gi|261868615|ref|YP_003256537.1| ribonuclease III [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261413947|gb|ACX83318.1| ribonuclease III [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 226

 Score =  118 bits (295), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 113/228 (49%), Gaps = 6/228 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M   +   L+++I Y F N  LL++ALTH S  H + E   RLEFLGD IL L I   LF
Sbjct: 1   MKENQLERLQRQINYRFQNIELLKQALTHRSAGHQHNE---RLEFLGDAILNLTIGEALF 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EGELS    +LV   T + +AR+  L  +I +     K       SI AD VE
Sbjct: 58  HQFPKCNEGELSRMRATLVREPTLALLARDFKLGDYILLGQGELKSGGFRRESILADCVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           ++I A+ LD  +  A   V ++++   + +K G  ++DAKT LQE+        P Y + 
Sbjct: 118 AIIGAISLDSSLTNATQIVCQWYQNLLKEIKPGDNQKDAKTRLQEYLQGNRLPLPTYNIV 177

Query: 179 FRSGPDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLKREGI 225
              G  H+  F V   I        G   S+R AEQ AA ++L+   I
Sbjct: 178 NIQGEAHNQLFIVECSIQNSDRTFIGKGSSRRKAEQAAAEQILQELNI 225


>gi|302522137|ref|ZP_07274479.1| ribonuclease III [Streptomyces sp. SPB78]
 gi|302431032|gb|EFL02848.1| ribonuclease III [Streptomyces sp. SPB78]
          Length = 286

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 81/220 (36%), Positives = 121/220 (55%), Gaps = 8/220 (3%)

Query: 2   SALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLL 59
           +A  ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L
Sbjct: 30  AASSHTLLEGRLGYHLES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTL 88

Query: 60  FNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVV 119
           +       EG+L+    ++V++   ++V+R LDL +FIR+             SI AD +
Sbjct: 89  YRTHPDLPEGQLAKLRAAVVNSRALAEVSRGLDLGAFIRLGRGEEGTGGRDKASILADTL 148

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEW-AHAKFGVTPEYK 176
           E++I A+YLD G++ A   V + +     KS +     D KT LQE  A    GV PEY 
Sbjct: 149 EAVIGAVYLDQGLDKAAELVHRLFDPLIEKSAELGAGLDWKTSLQELTAMEGLGV-PEYL 207

Query: 177 VTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           VT   GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 208 VT-EEGPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 246


>gi|289768866|ref|ZP_06528244.1| ribonuclease III [Streptomyces lividans TK24]
 gi|289699065|gb|EFD66494.1| ribonuclease III [Streptomyces lividans TK24]
          Length = 276

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 77/215 (35%), Positives = 116/215 (53%), Gaps = 6/215 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHF 63
           ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L+   
Sbjct: 31  HTLLEGRLGYQLES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTLYRTH 89

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
               EG+L+    ++V++   ++V R L+L SFIR+             SI AD +E++I
Sbjct: 90  PDLPEGQLAKLRAAVVNSRALAEVGRGLELGSFIRLGRGEEGTGGRDKASILADTLEAVI 149

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKVTFRS 181
            A+YLD G++ A   V + +     KS       D KT LQE    +    PEY VT  +
Sbjct: 150 GAVYLDQGLDAASELVHRLFDPLIEKSSNLGAGLDWKTSLQELTATEGLGVPEYLVT-ET 208

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 209 GPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 243


>gi|21223928|ref|NP_629707.1| ribonuclease III [Streptomyces coelicolor A3(2)]
 gi|256784973|ref|ZP_05523404.1| ribonuclease III [Streptomyces lividans TK24]
 gi|7531197|sp|Q9ZBQ7|RNC_STRCO RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|4007731|emb|CAA22415.1| ribonuclease III [Streptomyces coelicolor A3(2)]
          Length = 272

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 77/215 (35%), Positives = 116/215 (53%), Gaps = 6/215 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHF 63
           ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L+   
Sbjct: 27  HTLLEGRLGYQLES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTLYRTH 85

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
               EG+L+    ++V++   ++V R L+L SFIR+             SI AD +E++I
Sbjct: 86  PDLPEGQLAKLRAAVVNSRALAEVGRGLELGSFIRLGRGEEGTGGRDKASILADTLEAVI 145

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKVTFRS 181
            A+YLD G++ A   V + +     KS       D KT LQE    +    PEY VT  +
Sbjct: 146 GAVYLDQGLDAASELVHRLFDPLIEKSSNLGAGLDWKTSLQELTATEGLGVPEYLVT-ET 204

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 205 GPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 239


>gi|121605952|ref|YP_983281.1| ribonuclease III [Polaromonas naphthalenivorans CJ2]
 gi|120594921|gb|ABM38360.1| RNAse III [Polaromonas naphthalenivorans CJ2]
          Length = 233

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 81/216 (37%), Positives = 113/216 (52%), Gaps = 8/216 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L+KR+ + FA   LL +ALTH S S  + E   R+EFLGD +L L ++ LL+       E
Sbjct: 14  LQKRLQHEFAKPKLLVQALTHRSFSSDHNE---RIEFLGDSVLNLAVAGLLYEQLSELPE 70

Query: 69  GELS-VRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALY 127
           G+LS VR N LV  +T  Q+A  L L   +R+     +       S+ AD +E++I A+Y
Sbjct: 71  GDLSRVRAN-LVKQDTLHQLAVVLGLPDLLRLGEGEARSGGKNRPSMLADALEAVIGAVY 129

Query: 128 LDGGIEVAGTFVDKYWK--QRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           LD G + A   V + +K  Q   +     +D KTELQEW   +    P YKV    G  H
Sbjct: 130 LDAGYDQADQLVRRLFKDVQVNPQMKAIGKDPKTELQEWLQGRKMRLPLYKVVSTMGAAH 189

Query: 186 DPRFTVVVEISGLAPAQ-GMDCSKRAAEQVAAAEVL 220
              F V  EI+    A+ G+  S+RA EQ AA  +L
Sbjct: 190 QQTFEVECEIAEFGRAERGIGVSRRAGEQAAATAML 225


>gi|166031773|ref|ZP_02234602.1| hypothetical protein DORFOR_01474 [Dorea formicigenerans ATCC
           27755]
 gi|166028226|gb|EDR46983.1| hypothetical protein DORFOR_01474 [Dorea formicigenerans ATCC
           27755]
          Length = 233

 Score =  117 bits (294), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 115/216 (53%), Gaps = 5/216 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLISTLLFNHFD 64
           LE RIGY F + +LL+KA++HSS  +       E  ERLEFLGD +L L+ S  LF    
Sbjct: 10  LEHRIGYTFQDFALLKKAMSHSSYVNEEHLPKYECNERLEFLGDAVLELVSSEFLFFEHP 69

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
           +  EGEL+    S+V     +  ARE++L  ++ +             S+ +D +E+LI 
Sbjct: 70  TTPEGELTKTRASMVCEPALAFCAREIELGEYLLLGKGEDATGGRKRESVTSDAMEALIG 129

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           A+Y+DGG   A  F++++   + L++ K   D+KT LQE   A F     Y +    GPD
Sbjct: 130 AIYVDGGFANAKEFINRFI-LKDLENKKLFYDSKTILQEIVQAHFKEELSYHLVGEEGPD 188

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
           HD  F V ++I       G   +K++AEQ AA + +
Sbjct: 189 HDKTFQVELQIGEQVYGIGKGRTKKSAEQEAAYKTI 224


>gi|160892686|ref|ZP_02073476.1| hypothetical protein CLOL250_00216 [Clostridium sp. L2-50]
 gi|156865727|gb|EDO59158.1| hypothetical protein CLOL250_00216 [Clostridium sp. L2-50]
          Length = 230

 Score =  117 bits (294), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 80/224 (35%), Positives = 117/224 (52%), Gaps = 6/224 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLIS 56
           M+  R+  +E  IGY F +  LL  ALTH S ++  +    ESYER EFLGD IL  ++S
Sbjct: 1   MNTERFHNIEDIIGYTFRDLDLLVTALTHKSYANERKINKVESYERSEFLGDAILEFVVS 60

Query: 57  TLLFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA 116
             L+ ++    EG+L+    SLV   T SQ+++EL    ++ +S            SI  
Sbjct: 61  EYLYQNYPEYPEGKLTKLRASLVCEFTLSQISKELKFGHYVLLSKGEDLTGGRNRNSIMC 120

Query: 117 DVVESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYK 176
           D+ E+++ A+YLDGG++ A  FV ++          F  DAK+ LQE A  K   T  Y 
Sbjct: 121 DLFEAVLGAIYLDGGLDEAKKFVHRFLLDDVETHSLF-YDAKSTLQELAQ-KEEKTLTYA 178

Query: 177 VTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
           +    GPDH+  +   V I+G   A G   S++A+EQ AA   L
Sbjct: 179 LLEEKGPDHNKSYVSEVCINGEHVATGEGASRKASEQTAAYNAL 222


>gi|183599777|ref|ZP_02961270.1| hypothetical protein PROSTU_03285 [Providencia stuartii ATCC 25827]
 gi|188022041|gb|EDU60081.1| hypothetical protein PROSTU_03285 [Providencia stuartii ATCC 25827]
          Length = 226

 Score =  117 bits (294), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 77/224 (34%), Positives = 118/224 (52%), Gaps = 6/224 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+      L++++GY F    LL +ALTH S +  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPSLLEQLQRKLGYKFNQHDLLIQALTHRSANSKHNE---RLEFLGDSILSFVIANDLY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE +L   +R+     K       SI AD VE
Sbjct: 58  HRFPKVDEGDMSRMRATLVRGNTLAEIAREFELGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  +++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGIFLDSDIQTIEKIILDWYQTRLNEISPGDKQKDPKTRLQEYLQGRHLPLPNYIVV 177

Query: 179 FRSGPDHDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLK 221
              G  HD  FT+  ++SG+  P  G+  S+R AEQ AA + LK
Sbjct: 178 QVKGEAHDQEFTIHCQVSGIEQPINGVGSSRRKAEQAAAEQALK 221


>gi|37681015|ref|NP_935624.1| ribonuclease III [Vibrio vulnificus YJ016]
 gi|37199765|dbj|BAC95595.1| dsRNA-specific ribonuclease [Vibrio vulnificus YJ016]
          Length = 259

 Score =  117 bits (294), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 109/204 (53%), Gaps = 6/204 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L +++GY F +  LL  ALTH S +  + E   RLEFLGD IL  +I+  L++ F    E
Sbjct: 42  LTRQLGYQFQDDELLNLALTHRSANSKHNE---RLEFLGDSILSFVIADELYHRFPKVNE 98

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G++S    +LV   T +++ RE  L  ++++     K       SI AD VE++I A+YL
Sbjct: 99  GDMSRMRATLVRGNTLAELGREFGLGDYLKLGPGELKSGGFRRDSILADAVEAIIGAVYL 158

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  +EV    V  ++  R  A+K G  ++D KT LQE+   +    P Y VT   G  H+
Sbjct: 159 DSDLEVVRGIVLNWYASRLEAIKPGVSQKDPKTRLQEFLQGRRKPLPVYTVTNIKGEAHN 218

Query: 187 PRFTVVVEISGL-APAQGMDCSKR 209
             FTV  +I+G+  P  G   S+R
Sbjct: 219 QEFTVECDIAGMDKPVVGRGTSRR 242


>gi|325294757|ref|YP_004281271.1| ribonuclease 3 [Desulfurobacterium thermolithotrophum DSM 11699]
 gi|325065205|gb|ADY73212.1| Ribonuclease 3 [Desulfurobacterium thermolithotrophum DSM 11699]
          Length = 234

 Score =  117 bits (294), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 125/232 (53%), Gaps = 10/232 (4%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSIS--HSYQESYERLEFLGDRILGLLISTL 58
           M    +  LE++I Y F ++ LL+KALTH S S     +E+YE LEFLGD ++GL++S  
Sbjct: 1   MEKKSFEELERKINYFFKDKKLLKKALTHKSFSFEKDSEENYEVLEFLGDAVIGLIVSEE 60

Query: 59  LFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADV 118
           L   F +  EGELS     LVS  + S++A+ +DL S+I +            +SI  DV
Sbjct: 61  LIKRFPTKTEGELSQIRAFLVSEPSLSELAKTVDLGSYIYLGKGEHLSGGREKSSILCDV 120

Query: 119 VESLIAALYLDGGIEVAG-----TFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTP 173
            ESL  A+YLDGG E A       F+ K W+   L+     +D K+ LQE    +F V P
Sbjct: 121 FESLFGAIYLDGGFENAKEVFKRNFLMKLWE--ILEEAVTYKDFKSFLQEVTQKEFKVIP 178

Query: 174 EYKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
            Y V    GP+H+  FTV   +  L        SKR+AEQ AA E+LK  G+
Sbjct: 179 SYSVIKAEGPEHEKIFTVECRVKDLKTV-STGKSKRSAEQQAAKEMLKVLGV 229


>gi|251791907|ref|YP_003006627.1| ribonuclease III [Aggregatibacter aphrophilus NJ8700]
 gi|247533294|gb|ACS96540.1| ribonuclease III [Aggregatibacter aphrophilus NJ8700]
          Length = 226

 Score =  117 bits (294), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 112/216 (51%), Gaps = 6/216 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L+++I Y F +  LL++ALTH S  H + E   RLEFLGD IL L I+  LF+ F    E
Sbjct: 9   LQRKIDYQFQDTGLLKQALTHRSAGHKHNE---RLEFLGDAILNLTIAEALFHQFPKCNE 65

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS    +LV   T + +AR+  L  ++ +     K       SI AD VE++I A+ L
Sbjct: 66  GELSRMRATLVREPTLAILARDFQLGDYLSLGQGELKSGGFRRESILADCVEAIIGAISL 125

Query: 129 DGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  +  A   V ++++   + ++ G  ++DAKT LQE+        P Y +    G  H+
Sbjct: 126 DSNLTNATEIVTRWYQPLLKDIQPGDNQKDAKTRLQEYLQGNRLPVPTYNIVNIQGEAHN 185

Query: 187 PRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLK 221
             FTV   I        G   S+R AEQ AA ++L+
Sbjct: 186 QLFTVECSIQNNDRTFIGKGSSRRKAEQAAAEQILQ 221


>gi|302874772|ref|YP_003843405.1| ribonuclease III [Clostridium cellulovorans 743B]
 gi|307690613|ref|ZP_07633059.1| ribonuclease III [Clostridium cellulovorans 743B]
 gi|302577629|gb|ADL51641.1| ribonuclease III [Clostridium cellulovorans 743B]
          Length = 235

 Score =  117 bits (294), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 83/221 (37%), Positives = 116/221 (52%), Gaps = 6/221 (2%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNH 62
           R   LE+++  +F N  LL  ALTHSS  +  +  +  ERLEFLGD +L L IS  LF  
Sbjct: 7   RIRILEEQLNVSFENIDLLNTALTHSSFVNQKKHIDYNERLEFLGDSVLQLTISEYLFKE 66

Query: 63  FDSAKEGELSVRFNSLVSAE-TCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVES 121
                EGEL+ R  SL+  E +   V R+ ++ +F+ +S           TSI AD VE+
Sbjct: 67  LHGKSEGELT-RLRSLIVCENSLHSVGRDWNIGNFLLMSKGEELTGGRSRTSILADAVEA 125

Query: 122 LIAALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTF 179
           +IAA+YLD G + A  F+  ++K+        K   D KT LQE       ++  YK+  
Sbjct: 126 VIAAIYLDKGYDAAREFILLHFKEVINLALDNKIVLDYKTRLQEVLQKDGEISIAYKLEK 185

Query: 180 RSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
             GP H  RF V +E++      G   SK+ AEQ+AA EVL
Sbjct: 186 YDGPPHRRRFFVNLEVANKVLGSGEGFSKKEAEQMAAKEVL 226


>gi|16331055|ref|NP_441783.1| ribonuclease III [Synechocystis sp. PCC 6803]
 gi|2500554|sp|P74368|RNC1_SYNY3 RecName: Full=Ribonuclease 3 1; AltName: Full=Ribonuclease III 1;
           Short=RNase III 1
 gi|1653550|dbj|BAA18463.1| ribonuclease III [Synechocystis sp. PCC 6803]
          Length = 231

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 112/213 (52%), Gaps = 12/213 (5%)

Query: 25  KALTHSSI--SHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELSVRFNSLVSAE 82
           +ALTH S    H    SY+RLEFLGD +LG ++  +LF  +    E EL+   + LV+  
Sbjct: 17  EALTHRSYCNEHPGTPSYDRLEFLGDAVLGFVVGRILFERYPHFTEAELTRLRSQLVNQN 76

Query: 83  TCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIEVAGTFV--- 139
             + +AR L +A  IR+S  L +D      SI ADV ESL+ A  LD G+     F+   
Sbjct: 77  QLAYLARFLHIAPEIRLSQSLARDDGQSSPSILADVFESLLGAALLDRGLTAVEDFIQEL 136

Query: 140 -----DKYWKQRALKSGKF--RRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVV 192
                +++ K +  +S K     D K+ LQ+WA AK    PEY++   SGP H   FT  
Sbjct: 137 FVPILEQWEKSQDGRSPKLVPTMDVKSMLQQWALAKTKQLPEYELINTSGPPHAQEFTFT 196

Query: 193 VEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
           V+++G    QG   SK+ A + AA E LK  G+
Sbjct: 197 VKVAGKIHGQGSGPSKQIATKQAALEALKSLGL 229


>gi|239948355|ref|ZP_04700108.1| GTP-binding protein Era [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239922631|gb|EER22655.1| GTP-binding protein Era [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 567

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 79/223 (35%), Positives = 117/223 (52%), Gaps = 9/223 (4%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSI--SHSYQES--YERLEFLGDRILGLLISTLLFN 61
           +  LEK + Y+F N+ LL +AL+H S+   H Y++   YERLEFLGD +L L+I+ +LF 
Sbjct: 4   FEKLEKLLSYSFKNKELLIEALSHPSLRQHHEYKDDKDYERLEFLGDAVLNLVITEILFK 63

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA--DVV 119
           +F +  EG L+   + LV  ET   V  +L L  +I ++    ++V     +     +  
Sbjct: 64  NFANYNEGNLAKIRSYLVCKETICMVGAKLALKDYIIMTHG--EEVVGGRDNPNNIENAT 121

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTF 179
           E+LIAA+YLD  IE     + K W++          D KT LQEWA A     P Y++  
Sbjct: 122 EALIAAIYLDSNIETTHNIIGKLWEEFIKVQNLTDYDPKTALQEWAQASDHHLPIYRLIK 181

Query: 180 RSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           R G  H   FTV+V++       G   S + AE+ AA  +L R
Sbjct: 182 REGAAHSSTFTVLVKVKDYE-QTGTGHSIKEAEKNAARSLLHR 223


>gi|302558162|ref|ZP_07310504.1| ribonuclease III [Streptomyces griseoflavus Tu4000]
 gi|302475780|gb|EFL38873.1| ribonuclease III [Streptomyces griseoflavus Tu4000]
          Length = 272

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/215 (35%), Positives = 116/215 (53%), Gaps = 6/215 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHF 63
           ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L+   
Sbjct: 16  HTLLEGRLGYRLES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTLYRTH 74

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
               EG+L+    ++V++   ++V R L+L SFIR+             SI AD +E++I
Sbjct: 75  PDLPEGQLAKLRAAVVNSRALAEVGRGLELGSFIRLGRGEEGTGGRDKASILADTLEAVI 134

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKVTFRS 181
            A+YLD G++ A   V + +     KS       D KT LQE    +    PEY VT  +
Sbjct: 135 GAVYLDQGLDSAAELVHRLFDPLIEKSSNLGAGLDWKTSLQELTATEGLGVPEYLVT-ET 193

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 194 GPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 228


>gi|157960865|ref|YP_001500899.1| ribonuclease III [Shewanella pealeana ATCC 700345]
 gi|189043351|sp|A8H1C7|RNC_SHEPA RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|157845865|gb|ABV86364.1| Ribonuclease III [Shewanella pealeana ATCC 700345]
          Length = 225

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 119/215 (55%), Gaps = 5/215 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L + +GY F  ++ L++ALTH S S+ + E   RLEFLGD IL ++IS  L++ F +A E
Sbjct: 10  LCRTLGYEFNEKAFLDQALTHRSASNKHNE---RLEFLGDSILSIVISDALYHQFPAATE 66

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV  +  +++A E  L  ++++     K       SI AD VE++I A+YL
Sbjct: 67  GDLSRMRATLVCGKMLAEIAIEFKLGDYLKLGPGELKSGGFRRESILADAVEAIIGAIYL 126

Query: 129 DGGIEVAGTFVDKYWKQR-ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDP 187
           D  IE     V  +++ R  +     ++D KT LQE+        P Y+V    G  H+ 
Sbjct: 127 DSDIENCRQLVLNWYESRLKVIEPINQKDPKTLLQEYLQKYRKPLPVYRVAHTEGDAHEQ 186

Query: 188 RFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLK 221
            FTV   +  L+ A  G+  S+R AEQ AAA+VL+
Sbjct: 187 TFTVECIVEDLSQAVVGVASSRRKAEQSAAAQVLE 221


>gi|333024194|ref|ZP_08452258.1| putative ribonuclease III [Streptomyces sp. Tu6071]
 gi|332744046|gb|EGJ74487.1| putative ribonuclease III [Streptomyces sp. Tu6071]
          Length = 314

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 119/216 (55%), Gaps = 8/216 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHF 63
           ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L+   
Sbjct: 62  HTLLEGRLGYHLES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTLYRTH 120

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
               EG+L+    ++V++   ++V+R LDL +FIR+             SI AD +E++I
Sbjct: 121 PDLPEGQLAKLRAAVVNSRALAEVSRGLDLGAFIRLGRGEEGTGGRDKASILADTLEAVI 180

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEW-AHAKFGVTPEYKVTFR 180
            A+YLD G++ A   V + +     KS +     D KT LQE  A    GV PEY VT  
Sbjct: 181 GAVYLDQGLDKAAELVHRLFDPLIEKSAELGAGLDWKTSLQELTAMEGLGV-PEYLVT-E 238

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
            GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 239 EGPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 274


>gi|315634822|ref|ZP_07890104.1| ribonuclease III [Aggregatibacter segnis ATCC 33393]
 gi|315476374|gb|EFU67124.1| ribonuclease III [Aggregatibacter segnis ATCC 33393]
          Length = 226

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 79/220 (35%), Positives = 115/220 (52%), Gaps = 6/220 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L+++I Y F + +LL++ALTH S  H++ E   RLEFLGD IL L I+  LF+ F    E
Sbjct: 9   LQRKIDYHFQDVALLKQALTHRSAGHNHNE---RLEFLGDAILNLTIAEALFHLFPKCNE 65

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS    +LV   T + +AR+  L  ++ +     K       SI AD VE++I A+ L
Sbjct: 66  GELSRMRATLVREPTLAILARDFQLGDYLSLGQGELKSGGFRRESILADCVEAIIGAISL 125

Query: 129 DGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  +  A   V+++++     +K G  ++DAKT LQE+        P Y V    G  H+
Sbjct: 126 DSSLTHATQIVNRWYQTLLENIKPGDNQKDAKTRLQEYLQGNRQPLPTYNVVSIQGEAHN 185

Query: 187 PRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLKREGI 225
             F V   IS       G   S+R AEQ AA ++L+   I
Sbjct: 186 QLFIVECSISDNDRTFIGKGSSRRKAEQAAAEQILQELNI 225


>gi|153816163|ref|ZP_01968831.1| hypothetical protein RUMTOR_02411 [Ruminococcus torques ATCC 27756]
 gi|317500483|ref|ZP_07958707.1| ribonuclease III [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331089416|ref|ZP_08338315.1| ribonuclease III [Lachnospiraceae bacterium 3_1_46FAA]
 gi|145846498|gb|EDK23416.1| hypothetical protein RUMTOR_02411 [Ruminococcus torques ATCC 27756]
 gi|316898238|gb|EFV20285.1| ribonuclease III [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330404784|gb|EGG84322.1| ribonuclease III [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 228

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 113/205 (55%), Gaps = 5/205 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ-ESY---ERLEFLGDRILGLLISTLLFNHFD 64
           LE++IGY F N S LE+A+ HSS ++ ++ E Y   ERLEFLGD +L L+ S  LF    
Sbjct: 8   LEQKIGYRFRNFSFLEQAMMHSSYTNEHRMEKYRCNERLEFLGDAVLELISSEFLFRQSP 67

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EGEL+    S+V  ++ +  AR++DL S++ +          F  S+ +D +E+LI 
Sbjct: 68  KVPEGELTKTRASMVCEQSLAMCARDIDLGSYLLLGKGEEVTGGRFRDSVTSDALEALIG 127

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           A+YLDGG   A  F+ ++      +  K   D+KT LQE   A+     EY +    GPD
Sbjct: 128 AIYLDGGFTNAKEFIHRFVLTDQ-EDKKLFYDSKTILQEIVQAEKLGEIEYHLIGEEGPD 186

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKR 209
           H+  F+V + I G +  +G   +K+
Sbjct: 187 HNKSFSVELTIRGRSYGKGKGRTKK 211


>gi|303251584|ref|ZP_07337758.1| ribonuclease III [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
 gi|302649582|gb|EFL79764.1| ribonuclease III [Actinobacillus pleuropneumoniae serovar 6 str.
           Femo]
          Length = 223

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 82/223 (36%), Positives = 117/223 (52%), Gaps = 8/223 (3%)

Query: 4   LRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           ++   L+K++ Y F N   L +ALTH S      ++ ERLEFLGD IL   I   LF  F
Sbjct: 1   MQLERLQKKLSYQFTNLDYLLQALTHRSAGA---KNNERLEFLGDSILNFAIGKALFEKF 57

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             A EGELS    +LV  +T + +AR+  L  ++++ +   K       SI +D VE++I
Sbjct: 58  PKANEGELSRMRATLVREQTLAILARQFGLGEYMKLGAGELKSGGYRRESILSDCVEAII 117

Query: 124 AALYLDGGIEVAGTFVDKYWKQRAL---KSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           AA+YLD G++ A   V   W Q  L   K G  ++D KT LQE+   +    P Y+V   
Sbjct: 118 AAIYLDAGMDKAIAQVH-LWYQDLLAEMKPGDAQKDPKTRLQEFLQGRKLPLPTYEVLDI 176

Query: 181 SGPDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLKR 222
            G  H+  F V  +I  L     G+  S+R AEQ AA +VL +
Sbjct: 177 KGEAHNQTFKVTCKIEMLEEIFIGIGTSRRKAEQNAAEQVLAK 219


>gi|291277478|ref|YP_003517250.1| ribonuclease III [Helicobacter mustelae 12198]
 gi|290964672|emb|CBG40527.1| ribonuclease III [Helicobacter mustelae 12198]
          Length = 223

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 75/213 (35%), Positives = 114/213 (53%), Gaps = 8/213 (3%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAK 67
            LEK I Y F N+ LL  ALTH S  +  +++ ERLE+LGD +L LLI   L+  F   K
Sbjct: 3   NLEKAINYHFKNQDLLLTALTHKSCKN--KKNNERLEYLGDAVLDLLIGEFLYQEFPEHK 60

Query: 68  EGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALY 127
           EG+LS    +LV+ ++  + A+ + L  FI +SS+   +      SI +   E+LI A+Y
Sbjct: 61  EGDLSKMRAALVNEQSFMRFAKAIHLQDFILISSNEETNQGREKPSILSSAFEALIGAVY 120

Query: 128 LDGGIE----VAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           L+ G+E    +    + K + +  + +     D KT LQE   A F   P+Y++    GP
Sbjct: 121 LEAGLERAKDITYHLLHKLYPK--IDTQSLFTDYKTALQELTQAHFHEIPKYELLEEIGP 178

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           DH  +F V V I     A+ +  SK++A+Q  A
Sbjct: 179 DHCKKFKVSVYIQNQEYAKAIGTSKKSAQQNCA 211


>gi|229825033|ref|ZP_04451102.1| hypothetical protein GCWU000182_00383 [Abiotrophia defectiva ATCC
           49176]
 gi|229790780|gb|EEP26894.1| hypothetical protein GCWU000182_00383 [Abiotrophia defectiva ATCC
           49176]
          Length = 247

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 78/212 (36%), Positives = 110/212 (51%), Gaps = 5/212 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISH----SYQESYERLEFLGDRILGLLISTLLFNHFD 64
           +E+ IGYAF NR  L  A +HSS  +    S  +  ER+EFLGD +L L+ S  LFN   
Sbjct: 19  IEQTIGYAFKNRKFLTNAFSHSSFVNEKHLSKSDCNERMEFLGDAVLELVTSEFLFNGHK 78

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
             +EGEL+     LV     +  ARE+ L+ ++ +             SI +D +E+LI 
Sbjct: 79  DMQEGELTKLRARLVCEPALAYSAREIGLSDYLLLGHGEAITGGRNRDSILSDAMEALIG 138

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           A+YLDGG+  A  F++K+     ++  K   D+KT  QE   +    T  YK+    GPD
Sbjct: 139 AIYLDGGLTNAKEFIEKHV-LNDIEHKKLFFDSKTIFQEMVQSDNMGTISYKLLAEYGPD 197

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           HD +F   V I       G   +K+AAEQVAA
Sbjct: 198 HDKKFKEAVYIGEKEYGVGEGHTKKAAEQVAA 229


>gi|295696065|ref|YP_003589303.1| ribonuclease III [Bacillus tusciae DSM 2912]
 gi|295411667|gb|ADG06159.1| ribonuclease III [Bacillus tusciae DSM 2912]
          Length = 231

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 83/225 (36%), Positives = 115/225 (51%), Gaps = 6/225 (2%)

Query: 3   ALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ---ESYERLEFLGDRILGLLISTLL 59
           A ++  LE R+G  F N SLL +A THSS  + ++   E  ERLEFLGD +L LL+S  L
Sbjct: 2   ATKWDELEARLGITFRNASLLRQAFTHSSYRNEHRGDVEDNERLEFLGDAVLELLVSEFL 61

Query: 60  FNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVV 119
           F  +    EGEL+    ++V   +  + A  L L  +IR+             S+ ADV 
Sbjct: 62  FRAYPRFPEGELTRMRAAIVCEPSLVRFATALGLDQYIRLGRGEEMSGGRRRPSLLADVY 121

Query: 120 ESLIAALYLDGGIEVAGTFVDK-YWKQRALKSGKFRRDAKTELQEWAHAKFGVTP-EYKV 177
           E+LI A++LD G+E A  F+ +  +     +      D KT LQE    K G+ P  Y++
Sbjct: 122 EALIGAIFLDQGLEAAREFLQRMMFPALQREQAPILDDYKTMLQEHVQ-KVGLGPLTYRI 180

Query: 178 TFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           T   GP H   F   V I G A  +G   SK+ AEQ AA E L +
Sbjct: 181 TDERGPAHHREFVAQVWIGGQAYGEGSGRSKKEAEQHAAREALMK 225


>gi|325971140|ref|YP_004247331.1| ribonuclease 3 [Spirochaeta sp. Buddy]
 gi|324026378|gb|ADY13137.1| Ribonuclease 3 [Spirochaeta sp. Buddy]
          Length = 248

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 116/206 (56%), Gaps = 9/206 (4%)

Query: 18  ANRSLLEKALTHSSISHSYQESY---ERLEFLGDRILGLLISTLLFNHFDSAKEGELSVR 74
           +N  LL  A TH S ++   +S    ERLEFLGD +LG+ ++  LF +F +  EG+ S  
Sbjct: 32  SNLELLNLAFTHRSFANETSDSVDNNERLEFLGDSVLGMCVADWLFRNFPAKAEGDFSKI 91

Query: 75  FNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIEV 134
            + +VS ++ + +AR+L +  ++ +             ++ AD +E+L AA YLD G E 
Sbjct: 92  KSVVVSEDSLAMIARQLSVDKYLLLGKGEEFTGGRDKKALLADCMEALFAACYLDSGFEA 151

Query: 135 AGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVV 192
           A +FV  Y +Q+  A+    + RD KT LQE+   ++   P Y +  ++GP+HD  F V 
Sbjct: 152 AKSFVMLYLEQQIQAVLDDDYHRDYKTSLQEYMQKRWRKVPSYTLVRKTGPEHDFTFFVE 211

Query: 193 VEISG--LAPAQGMDCSKRAAEQVAA 216
           V+++G    PA G   +K+ AEQ+AA
Sbjct: 212 VDVNGQVFGPASG--ANKKQAEQMAA 235


>gi|71274462|ref|ZP_00650750.1| Ribonuclease III [Xylella fastidiosa Dixon]
 gi|71901683|ref|ZP_00683759.1| Ribonuclease III [Xylella fastidiosa Ann-1]
 gi|170730564|ref|YP_001775997.1| ribonuclease III [Xylella fastidiosa M12]
 gi|238687923|sp|B0U3D8|RNC_XYLFM RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|71164194|gb|EAO13908.1| Ribonuclease III [Xylella fastidiosa Dixon]
 gi|71728553|gb|EAO30708.1| Ribonuclease III [Xylella fastidiosa Ann-1]
 gi|167965357|gb|ACA12367.1| Ribonuclease III [Xylella fastidiosa M12]
          Length = 227

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/225 (35%), Positives = 116/225 (51%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M + + S  ++RIGY F + SLL +AL H S    + E   RLEFLGD ++ LLI+  LF
Sbjct: 1   MISSKASDYQQRIGYVFTDPSLLLQALRHCSAGTPHNE---RLEFLGDSVVNLLIAEALF 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             +  A EG L+   + LV   + + +AR + L   + +     K       SI AD VE
Sbjct: 58  QRWPRADEGALTRARSELVRETSLASIARTMQLGEQLILGPGELKSGGHRRDSILADAVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           ++IAA+YLD  +    T V  +++    AL  GK  +D KT LQEW  A+    P Y++ 
Sbjct: 118 AVIAAIYLDADLATCRTVVLPWFETALTALPVGKPEKDPKTRLQEWLQARQWSLPVYELI 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
           F SG  H   F V   +  L    +G   S+R AEQ AA+  + +
Sbjct: 178 FESGDPHTKHFRVSCTLGELKLRTEGEGSSRRLAEQDAASHAINQ 222


>gi|303252175|ref|ZP_07338343.1| ribonuclease III [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
 gi|302648958|gb|EFL79146.1| ribonuclease III [Actinobacillus pleuropneumoniae serovar 2 str.
           4226]
          Length = 223

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 82/223 (36%), Positives = 117/223 (52%), Gaps = 8/223 (3%)

Query: 4   LRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           ++   L+K++ Y F N   L +ALTH S      ++ ERLEFLGD IL   I   LF  F
Sbjct: 1   MQLERLQKKLSYQFTNLDYLLQALTHRSAGA---KNNERLEFLGDSILNFAIGKALFEKF 57

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             A EGELS    +LV  +T + +AR+  L  ++++ +   K       SI +D VE++I
Sbjct: 58  PKANEGELSRMRATLVREQTLAILARQFGLGEYMKLGAGELKSGGYRRESILSDCVEAII 117

Query: 124 AALYLDGGIEVAGTFVDKYWKQRAL---KSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           AA+YLD G++ A   V   W Q  L   K G  ++D KT LQE+   +    P Y+V   
Sbjct: 118 AAIYLDAGMDKAIEQVH-LWYQDLLAEMKPGDAQKDPKTRLQEFLQGRKLPLPTYEVLDI 176

Query: 181 SGPDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLKR 222
            G  H+  F V  +I  L     G+  S+R AEQ AA +VL +
Sbjct: 177 KGEAHNQTFKVTCKIEMLEEIFIGIGTSRRKAEQNAAEQVLAK 219


>gi|189485602|ref|YP_001956543.1| ribonuclease III [uncultured Termite group 1 bacterium phylotype
           Rs-D17]
 gi|170287561|dbj|BAG14082.1| ribonuclease III [uncultured Termite group 1 bacterium phylotype
           Rs-D17]
          Length = 243

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 114/219 (52%), Gaps = 7/219 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSIS-HSYQESYER-LEFLGDRILGLLISTLLFNHF 63
           +   +K I Y F +  +L  ALTH S +  +  E+Y R +EFLGD IL  +++  L+  +
Sbjct: 6   WEKFQKIIEYKFGDPKILATALTHKSYAAETVGENYNRRMEFLGDSILSAIVAETLYLRY 65

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
               EG+LS     ++SA   S  ARE+DL   I +             S+  DV E++I
Sbjct: 66  PRESEGKLSQFKAQIISAHNLSSWAREMDLGGCIYLGKSEDTKEARQRESLLCDVFEAVI 125

Query: 124 AALYLDGGIEVAGTFVDKYWK-QRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
            A+YLDGG E A  FV ++   Q+ ++      D K+ LQE   + +   PEYKV   SG
Sbjct: 126 GAIYLDGGFENAKKFVLRFLNDQKEIEI----TDYKSRLQEILQSIYKELPEYKVIKESG 181

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           PDH+ +F V V I      +G   SK+ A+Q AA + +K
Sbjct: 182 PDHNKKFEVAVYIKSELLGKGAGNSKKEAQQFAAKQAMK 220


>gi|304413540|ref|ZP_07395013.1| ribonuclease III [Candidatus Regiella insecticola LSR1]
 gi|304284383|gb|EFL92776.1| ribonuclease III [Candidatus Regiella insecticola LSR1]
          Length = 235

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 114/211 (54%), Gaps = 7/211 (3%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M  +    LE R+GYAF  R+LL +ALTH S S ++ E   RLEFLGD IL   I+  L+
Sbjct: 1   MDPIIIKKLETRLGYAFKQRALLVQALTHRSASRTHNE---RLEFLGDAILNFFIAKALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F    EG++S    +LV  +T +++A E DL+ ++ +     K+  S   SI AD VE
Sbjct: 58  QRFSDINEGDMSRMRATLVRGKTLAEIAHEFDLSDYLYLGKGELKNGKSPRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  ++++R   +  G+ ++D KT LQE+  +     P Y VT
Sbjct: 118 ALIGGIFLDSDIQTTERLLLTWYEKRLAEISPGEKQKDPKTRLQEYLQSHHLPLPSYLVT 177

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQGMDCSKR 209
              G  H+ +F  ++    + P +  + +K+
Sbjct: 178 QVHGEAHEQKF--IIHCKFIIPCRENNLTKQ 206


>gi|309389054|gb|ADO76934.1| RNAse III [Halanaerobium praevalens DSM 2228]
          Length = 237

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 111/220 (50%), Gaps = 6/220 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSIS----HSYQESYERLEFLGDRILGLLISTLLFNHFD 64
            EK +   F N+ LLE+ALTH S      H   +  ERLEFLGD +L L IST +FN F 
Sbjct: 13  FEKSLDLNFNNKFLLERALTHKSYPNENRHLNLKDNERLEFLGDSVLSLSISTYIFNKFS 72

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EG+L+     +VSA   ++ A+ ++L  ++ +             SI AD +E++  
Sbjct: 73  DFPEGDLAKMRAVIVSAPILAEAAKRINLGQYLFLGKGEEMTGGRERDSILADTMEAIFG 132

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALK--SGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           ALYLD   +V   F+ +  K   +   +G   +D KT LQE         PEY+V    G
Sbjct: 133 ALYLDQSFKVVSDFILELLKVDIINVAAGNHIQDYKTMLQEVIQDMGNFRPEYEVIDEEG 192

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           PDH+  F V V+++  +   G   SK+ AEQ AA   L +
Sbjct: 193 PDHNKTFIVAVKMNEESLGSGQGSSKKEAEQEAAKVALDK 232


>gi|227500106|ref|ZP_03930177.1| ribonuclease III [Anaerococcus tetradius ATCC 35098]
 gi|227217821|gb|EEI83118.1| ribonuclease III [Anaerococcus tetradius ATCC 35098]
          Length = 239

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 68/220 (30%), Positives = 121/220 (55%), Gaps = 6/220 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ---ESYERLEFLGDRILGLLISTLLFNHFDS 65
            E++IGY+F ++ L++ A THSS ++  +   +S ERLEFLGD IL +++S +LF ++  
Sbjct: 14  FEEKIGYSFNDKELIDVAFTHSSYTNEVKGKKKSNERLEFLGDSILDMIVSEILFKNYSQ 73

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG L+   + LV   + ++   +  ++S++   +  ++        ++AD  E++ AA
Sbjct: 74  KPEGWLTKTRSRLVCTSSFAKACEKFQMSSYLNFGNGEKQGGGELKKHVKADTFEAVCAA 133

Query: 126 LYLDGGIEVAGTFVDKYWKQRAL---KSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           +YLD   E    F+   +K  AL          D KT+LQE+ +AK     +Y++T   G
Sbjct: 134 IYLDSSYENLFNFLVTNYKAEALHVINDDSIFNDYKTKLQEYHNAKDKKILKYELTKEEG 193

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           P+H   FT+ V++     A G+  +K+ AEQ+AA    ++
Sbjct: 194 PEHSKTFTMAVKLGNKILAYGVGKNKKQAEQMAAKAAFEK 233


>gi|212636523|ref|YP_002313048.1| ribonuclease III [Shewanella piezotolerans WP3]
 gi|226735379|sp|B8CQJ5|RNC_SHEPW RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|212558007|gb|ACJ30461.1| Ribonuclease III [Shewanella piezotolerans WP3]
          Length = 225

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 81/215 (37%), Positives = 117/215 (54%), Gaps = 5/215 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L + +GY FA ++LL++ALTH S S+ + E   RLEFLGD IL ++IS  L++ F  A E
Sbjct: 10  LCRTLGYEFAEQALLDQALTHRSASNKHNE---RLEFLGDSILSIVISDALYHQFPKATE 66

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV  +  +++A E  L  ++++     K       SI AD VE++I A+YL
Sbjct: 67  GDLSRMRATLVCGKMLAEIAIEFKLGDYLKLGPGELKSGGFRRESILADAVEAIIGAIYL 126

Query: 129 DGGIEVAGTFVDKYWKQRA-LKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDP 187
           D  IE     V  ++  R  +     ++D KT LQE         P YKV    G  H+ 
Sbjct: 127 DSDIEKCRKLVLNWYASRLRVIEPINQKDPKTLLQEHLQKFRKPLPIYKVVHTEGDAHEQ 186

Query: 188 RFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLK 221
            FTV   +  L  A  G+  S+R AEQ AAA+VL+
Sbjct: 187 TFTVECVVEDLRQAVVGVASSRRKAEQSAAAQVLE 221


>gi|294815350|ref|ZP_06773993.1| Ribonuclease 3 [Streptomyces clavuligerus ATCC 27064]
 gi|326443704|ref|ZP_08218438.1| ribonuclease III [Streptomyces clavuligerus ATCC 27064]
 gi|294327949|gb|EFG09592.1| Ribonuclease 3 [Streptomyces clavuligerus ATCC 27064]
          Length = 303

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 119/219 (54%), Gaps = 6/219 (2%)

Query: 2   SALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLL 59
           +A  ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L
Sbjct: 19  AASSHTLLEGRLGYRLES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTL 77

Query: 60  FNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVV 119
           +       EG+L+    ++V++   ++V R L+L +FIR+             SI AD +
Sbjct: 78  YRTHPDLPEGQLAKLRAAVVNSRALAEVGRGLELGAFIRLGRGEEGTGGRDKASILADTL 137

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKV 177
           E++I A+YLD G++ A   V + +     KS       D KT LQE   ++    PEY V
Sbjct: 138 EAVIGAVYLDQGLDAASELVHRLFDPLIEKSSNLGAGLDWKTSLQELTASEGLGVPEYLV 197

Query: 178 TFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           T  +GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 198 T-ETGPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 235


>gi|254392460|ref|ZP_05007640.1| ribonuclease 3 [Streptomyces clavuligerus ATCC 27064]
 gi|197706127|gb|EDY51939.1| ribonuclease 3 [Streptomyces clavuligerus ATCC 27064]
          Length = 300

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 119/219 (54%), Gaps = 6/219 (2%)

Query: 2   SALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLL 59
           +A  ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L
Sbjct: 16  AASSHTLLEGRLGYRLES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTL 74

Query: 60  FNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVV 119
           +       EG+L+    ++V++   ++V R L+L +FIR+             SI AD +
Sbjct: 75  YRTHPDLPEGQLAKLRAAVVNSRALAEVGRGLELGAFIRLGRGEEGTGGRDKASILADTL 134

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKV 177
           E++I A+YLD G++ A   V + +     KS       D KT LQE   ++    PEY V
Sbjct: 135 EAVIGAVYLDQGLDAASELVHRLFDPLIEKSSNLGAGLDWKTSLQELTASEGLGVPEYLV 194

Query: 178 TFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           T  +GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 195 T-ETGPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 232


>gi|139436972|ref|ZP_01771132.1| Hypothetical protein COLAER_00105 [Collinsella aerofaciens ATCC
           25986]
 gi|133776619|gb|EBA40439.1| Hypothetical protein COLAER_00105 [Collinsella aerofaciens ATCC
           25986]
          Length = 241

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 85/226 (37%), Positives = 115/226 (50%), Gaps = 3/226 (1%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSI--SHSYQESYERLEFLGDRILGLLISTLLFNH 62
           R +  ++ +G+ F N+ LL  ALTH S         SYERLEFLGD ILG +++  LF  
Sbjct: 6   RLTRAQEILGHEFNNKVLLRAALTHPSAVEGQPVSASYERLEFLGDSILGAVVARSLFES 65

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           +    EG+L+    SLVS  T S+V+ EL +   I   +         + S   +V ESL
Sbjct: 66  YPEFDEGKLTRLKVSLVSGATLSEVSHELGIDDIIIFGASETGTGARGLHSALENVYESL 125

Query: 123 IAALYLDGGIEVAGTFVDKYWKQR-ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           + ALYLD G +VA  F+ +  K   A +  +   + K+ LQE   A     P YK+    
Sbjct: 126 VGALYLDAGWDVAAEFIHRTLKPHLASERAEHPANPKSFLQECVQADGHEPPAYKLVGSE 185

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIWT 227
           GP H P FT VV I G+   +G   SK+ AE  AA E L R G  T
Sbjct: 186 GPAHAPTFTAVVLIDGIRQGRGTGSSKKEAEGAAALEALDRMGYTT 231


>gi|220904300|ref|YP_002479612.1| ribonuclease III [Desulfovibrio desulfuricans subsp. desulfuricans
           str. ATCC 27774]
 gi|219868599|gb|ACL48934.1| Ribonuclease III [Desulfovibrio desulfuricans subsp. desulfuricans
           str. ATCC 27774]
          Length = 243

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 116/217 (53%), Gaps = 12/217 (5%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSY---QESYERLEFLGDRILGLLISTLLFNHFDS 65
           ++K++G+ F  + LLE ALTHSS ++     QE  ER EFLGD +L L +S  L+  F S
Sbjct: 19  VKKQLGHGFIRKDLLELALTHSSWANECGPGQEHNERQEFLGDAVLELCVSWELYRRFPS 78

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
           A+EGEL+   +SLVSA + ++ AR++ L   +++             ++ +D +E+++AA
Sbjct: 79  AREGELTKMRSSLVSAVSLAERARDMGLDRLLKLGRGEESQGGRKRDAVLSDALEAVLAA 138

Query: 126 LYLDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +Y DGG     E  G      W  RA   GK  +D KT LQE +  +FG  P Y      
Sbjct: 139 IYEDGGFAAAQEAVGRIFADQWPSRA-GDGKASKDYKTRLQEASQQRFGQAPLYTRVGSH 197

Query: 182 GPDHDPRFTVVVEISGLA--PAQGMDCSKRAAEQVAA 216
           GP+H   F V + +   +   A G  C K  AEQ AA
Sbjct: 198 GPEHSKVFEVALRLPDGSEFSASGSSCKK--AEQQAA 232


>gi|326316027|ref|YP_004233699.1| ribonuclease 3 [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323372863|gb|ADX45132.1| Ribonuclease 3 [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 228

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/216 (35%), Positives = 112/216 (51%), Gaps = 6/216 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M +   S L+ R+ +AF++ SLL++A+TH S S  + E   RLEFLGD +L L +S+LL+
Sbjct: 1   MVSPSLSALQDRLQHAFSDPSLLQRAITHRSFSADHNE---RLEFLGDSVLSLAVSSLLY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
                  EG+LS    +LV  E    +A  L L   +R+     K       SI AD +E
Sbjct: 58  QRLRDLPEGDLSRVRANLVRQEALHDLALGLQLPQVLRLGEGETKSGGKQRPSILADALE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRAL--KSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI A+YLD G + A   V + +K   +  +     +DAKT LQEW   +    P+Y+V 
Sbjct: 118 ALIGAVYLDAGYQCAEALVHRLYKDVEINPRMQAAEKDAKTALQEWLQGRKMKLPQYRVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQ-GMDCSKRAAEQ 213
              G  H   F V  +I  L   + G+  S+RA EQ
Sbjct: 178 ATVGAAHRQTFDVECDIPELGLTERGIGGSRRAGEQ 213


>gi|325108661|ref|YP_004269729.1| RNAse III [Planctomyces brasiliensis DSM 5305]
 gi|324968929|gb|ADY59707.1| RNAse III [Planctomyces brasiliensis DSM 5305]
          Length = 335

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/216 (35%), Positives = 121/216 (56%), Gaps = 9/216 (4%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           E+ +GY F +++ L K+LTH+SI+ +  +S ER+EFLGD +LG ++   LF  F   +EG
Sbjct: 19  EQALGYQFQDKNWLLKSLTHASIAQTRLQSNERMEFLGDAVLGAVVCDRLFALFPEDEEG 78

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLD 129
           +++   + +VS   C+Q+A  L L  F+++   L +       S+ A V ES+IAA+YLD
Sbjct: 79  QMTQMKSEVVSRTACAQLALALGLDRFVQMGKGLHQSR-EIPLSVLAGVFESVIAAIYLD 137

Query: 130 GGIEVAGTFVDKYWK---QRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           GG + A  F+    +   Q A ++    R++K++LQ+        TP Y++   SGPDH 
Sbjct: 138 GGYKAAFDFISGKLEDLIQHAAETAHI-RNSKSQLQQLTQRTRSQTPTYELLQESGPDHS 196

Query: 187 PRFTV--VVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
             F V  +V      PA G   +K+ AEQ AA   L
Sbjct: 197 KCFLVQAIVGPDTYPPAWG--SNKKEAEQKAALNAL 230


>gi|325265084|ref|ZP_08131811.1| ribonuclease III [Clostridium sp. D5]
 gi|324029774|gb|EGB91062.1| ribonuclease III [Clostridium sp. D5]
          Length = 232

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 80/212 (37%), Positives = 114/212 (53%), Gaps = 5/212 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISH-SYQESY---ERLEFLGDRILGLLISTLLFNHFD 64
           LEK+IGY F + SLL +A+ HSS ++  + E Y   ERLEFLGD +L L+ S  LF    
Sbjct: 11  LEKKIGYKFRDFSLLRRAMMHSSFTNEKHLEKYHCNERLEFLGDAVLELVSSEYLFLESP 70

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EGEL+    S+V   + +  AR++DL S++ +             SI +D +E+LI 
Sbjct: 71  KVSEGELTKTRASMVCEPSLAFCARDIDLGSYLLLGRGEEATGGRARDSITSDALEALIG 130

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           A+YLDGG   A  F+ ++     L+  K   D+KT LQE   A+   +  Y++    GPD
Sbjct: 131 AIYLDGGFTNAKEFIHRFI-LTDLEDKKLFFDSKTILQEIVQARMAGSISYRLIKEEGPD 189

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           H+  F V V I       G   +K+AAEQ AA
Sbjct: 190 HNKAFFVEVMIEENGYGIGKGRTKKAAEQEAA 221


>gi|32129971|sp|Q9PB98|RNC_XYLFA RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
          Length = 227

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 80/225 (35%), Positives = 116/225 (51%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M + + S  ++RIGY F + SLL +AL H S    + E   RLEFLGD ++ LLI+  LF
Sbjct: 1   MISSKASDYQQRIGYVFTDPSLLLQALRHCSAGTPHNE---RLEFLGDSVVNLLIAEALF 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             +  A EG L+   + LV   + + +AR + L   + +     K       SI AD VE
Sbjct: 58  QRWPRADEGALTRARSELVRETSLASIARTMQLGEQLILGPGELKSGGHRRDSILADAVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           ++IAA+YLD  +    T V  +++    AL  GK  +D KT LQEW  A+    P Y++ 
Sbjct: 118 AVIAAIYLDADLATCRTVVLPWFETALTALPVGKPEKDPKTRLQEWLQARQWSLPVYELI 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
           F SG  H   F V   +  L    +G   S+R AEQ AA+  + +
Sbjct: 178 FESGDPHTKHFRVSCTLGELKLRTEGEGSSRRLAEQDAASHAIDQ 222


>gi|189425004|ref|YP_001952181.1| ribonuclease III [Geobacter lovleyi SZ]
 gi|189421263|gb|ACD95661.1| Ribonuclease III [Geobacter lovleyi SZ]
          Length = 228

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/217 (35%), Positives = 118/217 (54%), Gaps = 7/217 (3%)

Query: 13  IGYAFANRSLLEKALTHSS-ISHSYQES---YERLEFLGDRILGLLISTLLFNHFDSAKE 68
           +G++F N+ LL++ALTH S ++ + QE    Y+RLEFLGD +LG L++ LL  HF +  E
Sbjct: 9   LGHSFINQRLLQQALTHPSYLNEARQEGAADYQRLEFLGDAVLGFLLADLLCQHFPALPE 68

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS   +SLV     +++A +  +   I +     ++      SI ADV E+L+ A++ 
Sbjct: 69  GDLSRLRSSLVDQPRLARLAVDAGIPPLILMGKGAEREGGRTNPSILADVFEALLGAIHC 128

Query: 129 DGGIEVAGTFVDKYWKQ--RALKSG-KFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           D G       V   +     A+ +G     DAK+ELQE   A+    P Y +  + GPDH
Sbjct: 129 DAGFAAVQQVVKHIYAPLVNAIAAGTPAHHDAKSELQELLAARKQAAPVYNLVDQQGPDH 188

Query: 186 DPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           D  F + V + G+   QG   SK+AA+Q AA   L R
Sbjct: 189 DRLFCIEVSVDGMPLGQGQGRSKKAAQQSAAESALAR 225


>gi|325577735|ref|ZP_08148010.1| ribonuclease III [Haemophilus parainfluenzae ATCC 33392]
 gi|325160480|gb|EGC72606.1| ribonuclease III [Haemophilus parainfluenzae ATCC 33392]
          Length = 227

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 81/221 (36%), Positives = 115/221 (52%), Gaps = 13/221 (5%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE++IGY F++   L+ ALTH S S  + E   RLEFLGD IL  +I+  L++ F    E
Sbjct: 7   LERKIGYQFSDLKNLKLALTHRSASTQHNE---RLEFLGDSILNYVIADALYHQFPRCNE 63

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS    +LV   T + +AR  +L  ++ + S   K       SI AD VE++I A+ L
Sbjct: 64  GELSRMRATLVREPTLAMLARNFELGDYMSLGSGELKSGGFRRESILADCVEAVIGAMAL 123

Query: 129 DGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D   + A   V  ++K     +K G  ++DAKT LQE+   K    P Y+V    G  H 
Sbjct: 124 DSSFDKAADIVRSWYKTLLAEIKPGDNQKDAKTRLQEYLQGKHFALPTYEVIKIEGEAHC 183

Query: 187 PRFTVVVEISGLAP------AQGMDCSKRAAEQVAAAEVLK 221
             FTV   +  +        A+G   S+R AEQ AA ++LK
Sbjct: 184 QTFTVECTVKNVPNIDRTFIAKG--SSRRKAEQAAAEQILK 222


>gi|238753924|ref|ZP_04615284.1| Ribonuclease 3 [Yersinia ruckeri ATCC 29473]
 gi|238707912|gb|EEQ00270.1| Ribonuclease 3 [Yersinia ruckeri ATCC 29473]
          Length = 226

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 122/225 (54%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F  + LL +ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPIVITRLQRKLGYTFQQQELLLQALTHRSASSKHNE---RLEFLGDSILSFVIANELY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE DL   +R+     K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAEMAREFDLGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD GI+     +  +++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGVFLDSGIQTVERLILDWYRSRLDEISPGDKQKDPKTRLQEYLQGRHLPLPSYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SGL  P  G   S+R AEQ AA + LK+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGLGEPVVGTGSSRRKAEQAAAEQALKQ 222


>gi|301154741|emb|CBW14204.1| RNase III [Haemophilus parainfluenzae T3T1]
          Length = 227

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 81/221 (36%), Positives = 115/221 (52%), Gaps = 13/221 (5%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE++IGY F++   L+ ALTH S S  + E   RLEFLGD IL  +I+  L++ F    E
Sbjct: 7   LERKIGYQFSDLKNLKLALTHRSASTQHNE---RLEFLGDSILNYVIADALYHQFPRCNE 63

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS    +LV   T + +AR  +L  ++ + S   K       SI AD VE++I A+ L
Sbjct: 64  GELSRMRATLVREPTLAIIARNFELGDYMSLGSGELKSGGFRRESILADCVEAVIGAMAL 123

Query: 129 DGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D   + A   V  ++K     +K G  ++DAKT LQE+   K    P Y+V    G  H 
Sbjct: 124 DSSFDKAADIVRSWYKTLLAEIKPGDNQKDAKTRLQEYLQGKHFALPTYEVIKIEGEAHC 183

Query: 187 PRFTVVVEISGLAP------AQGMDCSKRAAEQVAAAEVLK 221
             FTV   +  +        A+G   S+R AEQ AA ++LK
Sbjct: 184 QTFTVECTVKNVPNIDRTFIAKG--SSRRKAEQAAAEQILK 222


>gi|213419257|ref|ZP_03352323.1| ribonuclease III [Salmonella enterica subsp. enterica serovar Typhi
           str. E01-6750]
          Length = 213

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 106/197 (53%), Gaps = 5/197 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F ++ LL++ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 20  MNPIVINRLQRKLGYTFNHQELLQQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 76

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE DL   +R+     K       SI AD VE
Sbjct: 77  HRFPRVDEGDMSRMRATLVRGNTLAELAREFDLGECLRLGPGELKSGGFRRESILADTVE 136

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  ++K R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 137 ALIGGVFLDSNIQTVEQLILNWYKTRLDEISPGDKQKDPKTRLQEYLQGRHLPLPSYLVV 196

Query: 179 FRSGPDHDPRFTVVVEI 195
              G  HD  FT+  ++
Sbjct: 197 QVRGEAHDQEFTIHCQV 213


>gi|28199176|ref|NP_779490.1| ribonuclease III [Xylella fastidiosa Temecula1]
 gi|182681907|ref|YP_001830067.1| ribonuclease III [Xylella fastidiosa M23]
 gi|32129967|sp|Q87C06|RNC_XYLFT RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|238691044|sp|B2I604|RNC_XYLF2 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|28057282|gb|AAO29139.1| ribonuclease III [Xylella fastidiosa Temecula1]
 gi|182632017|gb|ACB92793.1| Ribonuclease III [Xylella fastidiosa M23]
 gi|307578162|gb|ADN62131.1| ribonuclease III [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 227

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 80/225 (35%), Positives = 116/225 (51%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M + + S  ++RIGY F + SLL +AL H S    + E   RLEFLGD ++ LLI+  LF
Sbjct: 1   MISSKASDYQQRIGYVFTDPSLLLQALRHRSAGTPHNE---RLEFLGDSVVNLLIAEALF 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             +  A EG L+   + LV   + + +AR + L   + +     K       SI AD VE
Sbjct: 58  QRWPRADEGALTRARSELVRETSLASIARTMQLGEQLILGPGELKSGGHRRDSILADAVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           ++IAA+YLD  +    T V  +++    AL  GK  +D KT LQEW  A+    P Y++ 
Sbjct: 118 AVIAAIYLDADLATCRTVVLPWFETALTALPVGKPEKDPKTRLQEWLQARQWSLPVYELI 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
           F SG  H   F V   +  L    +G   S+R AEQ AA+  + +
Sbjct: 178 FESGDPHTKHFRVSCTLGELKLRTEGEGSSRRLAEQDAASHAIDQ 222


>gi|126667175|ref|ZP_01738149.1| ribonuclease III [Marinobacter sp. ELB17]
 gi|126628331|gb|EAZ98954.1| ribonuclease III [Marinobacter sp. ELB17]
          Length = 229

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 79/220 (35%), Positives = 115/220 (52%), Gaps = 6/220 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L++RIGY F ++  L  ALTH S  +   ++ ERLEFLGD I+ ++I+  LF  F  A+E
Sbjct: 10  LQRRIGYQFKSQERLLLALTHRSFGN---QNNERLEFLGDSIVNMVIAEHLFRRFPKARE 66

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS     +V   T +++ RE DL S++R+ S   K       SI AD VES+I A+YL
Sbjct: 67  GQLSRLRARMVKGVTLAEIGREFDLGSYLRLGSGELKSGGFRRESILADAVESVIGAIYL 126

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D         + +++  R   L     ++D KT LQE+  ++    P Y V    G  H+
Sbjct: 127 DSDFVTCQAQILRWFDLRLQNLDLQDTQKDPKTRLQEYLQSRQFPLPIYDVLSVDGEAHN 186

Query: 187 PRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKREGI 225
             F +   +S L     G   S+R AEQ AA   LK  G+
Sbjct: 187 QTFHISCALSSLGRKTTGSGNSRRIAEQQAARNALKELGV 226


>gi|239991059|ref|ZP_04711723.1| ribonuclease III [Streptomyces roseosporus NRRL 11379]
 gi|291448061|ref|ZP_06587451.1| ribonuclease III [Streptomyces roseosporus NRRL 15998]
 gi|291351008|gb|EFE77912.1| ribonuclease III [Streptomyces roseosporus NRRL 15998]
          Length = 274

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 118/219 (53%), Gaps = 6/219 (2%)

Query: 2   SALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLL 59
           +A  ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L
Sbjct: 16  TASSHTLLEGRLGYHLES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTL 74

Query: 60  FNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVV 119
           +       EG+L+    ++V++   ++V R L+L SFIR+             SI AD +
Sbjct: 75  YRTHPDLPEGQLAKLRAAVVNSRALAEVGRGLELGSFIRLGRGEEGTGGRDKASILADTL 134

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKV 177
           E++I A+YLD G+  A   V + +     +S       D KT LQE   ++    PEY V
Sbjct: 135 EAVIGAVYLDQGLSAASELVHRLFDPLIDRSSNLGAGLDWKTSLQELTASESLGVPEYLV 194

Query: 178 TFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           T  +GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 195 T-ETGPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 232


>gi|182435701|ref|YP_001823420.1| ribonuclease III [Streptomyces griseus subsp. griseus NBRC 13350]
 gi|178464217|dbj|BAG18737.1| putative ribonuclease III [Streptomyces griseus subsp. griseus NBRC
           13350]
          Length = 274

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 118/219 (53%), Gaps = 6/219 (2%)

Query: 2   SALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLL 59
           +A  ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L
Sbjct: 16  TASSHTLLEGRLGYHLES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTL 74

Query: 60  FNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVV 119
           +       EG+L+    ++V++   ++V R L+L SFIR+             SI AD +
Sbjct: 75  YRTHPDLPEGQLAKLRAAVVNSRALAEVGRGLELGSFIRLGRGEEGTGGRDKASILADTL 134

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKV 177
           E++I A+YLD G+  A   V + +     +S       D KT LQE   ++    PEY V
Sbjct: 135 EAVIGAVYLDQGLSAASELVHRLFDPLIDRSSNLGAGLDWKTSLQELTASESLGVPEYLV 194

Query: 178 TFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           T  +GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 195 T-ETGPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 232


>gi|326776326|ref|ZP_08235591.1| ribonuclease III [Streptomyces cf. griseus XylebKG-1]
 gi|326656659|gb|EGE41505.1| ribonuclease III [Streptomyces cf. griseus XylebKG-1]
          Length = 274

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 118/219 (53%), Gaps = 6/219 (2%)

Query: 2   SALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLL 59
           +A  ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L
Sbjct: 16  TASSHTLLEGRLGYHLES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTL 74

Query: 60  FNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVV 119
           +       EG+L+    ++V++   ++V R L+L SFIR+             SI AD +
Sbjct: 75  YRTHPDLPEGQLAKLRAAVVNSRALAEVGRGLELGSFIRLGRGEEGTGGRDKASILADTL 134

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKV 177
           E++I A+YLD G+  A   V + +     +S       D KT LQE   ++    PEY V
Sbjct: 135 EAVIGAVYLDQGLSAASELVHRLFDPLIDRSSNLGAGLDWKTSLQELTASESLGVPEYLV 194

Query: 178 TFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           T  +GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 195 T-ETGPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 232


>gi|90021888|ref|YP_527715.1| RNAse III [Saccharophagus degradans 2-40]
 gi|89951488|gb|ABD81503.1| RNAse III [Saccharophagus degradans 2-40]
          Length = 226

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 79/215 (36%), Positives = 118/215 (54%), Gaps = 10/215 (4%)

Query: 12  RIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGEL 71
           R+GY F ++SLL+ AL+H S     +++ ER+EFLGD +L  +I+  LF  F +AKEG+L
Sbjct: 10  RLGYTFKDKSLLKLALSHRSYG---KQNNERVEFLGDSLLNFIIAEALFAKFPTAKEGQL 66

Query: 72  SVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGG 131
           +    +LV  ET +++ARE  L  F+ +     K       SI AD VE+LI A+YLD  
Sbjct: 67  TQLRANLVKGETLAEIAREFGLGDFLLLGEGELKSGGFRRASILADAVEALIGAIYLDSN 126

Query: 132 IEVAGTFVDKY--WKQRALKSGKFR---RDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
             +  T  ++   W    L   + +   +DAKT LQE+   +    P Y V    G  H 
Sbjct: 127 SSMP-TCRERVLAWYATRLDKVELKATAKDAKTLLQEYLQERKMPLPTYTVLAEGGEAHS 185

Query: 187 PRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVL 220
            +FTV   I+G + P   +  SKR AE++AA ++L
Sbjct: 186 RQFTVECTITGKSKPCSAVGNSKRIAEKLAAEKML 220


>gi|291533418|emb|CBL06531.1| RNAse III [Megamonas hypermegale ART12/1]
          Length = 240

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 82/220 (37%), Positives = 119/220 (54%), Gaps = 8/220 (3%)

Query: 12  RIGYAFANRSLLEKALTHSSISHSYQES---YERLEFLGDRILGLLISTLLFNHFDSAKE 68
           R+G  F + +LL +ALTH+S ++  ++     ERLEFLGD +L L  ST LF  F    E
Sbjct: 17  RLGVKFNDLNLLNQALTHTSYANEAKDHSLHNERLEFLGDAVLELASSTYLFKTFTQMPE 76

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GE++    S+V   + +++A  L++  ++ +    R        SI AD  ES+I A+YL
Sbjct: 77  GEMTKARASVVCETSLAKLAMNLNVGQYLLLGKGERLTGGEHRPSILADAFESIIGAIYL 136

Query: 129 DGGIEVAGTFV-DKYWKQ-RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D G + A  +V DK  ++  A+K G   +D KT LQE   AK G   EYK+   +GPDH 
Sbjct: 137 DQGWQTAYEYVLDKLNEEFIAVKYGYNLKDYKTILQEVVQAK-GQHVEYKLLAETGPDHA 195

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226
             F   V +      +G   +K+ AEQ AA E LK+  IW
Sbjct: 196 KTFEFAVVVDKKIDGKGKGTTKKEAEQHAAYEALKK--IW 233


>gi|239944597|ref|ZP_04696534.1| ribonuclease III [Streptomyces roseosporus NRRL 15998]
          Length = 271

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 118/219 (53%), Gaps = 6/219 (2%)

Query: 2   SALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLL 59
           +A  ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L
Sbjct: 13  TASSHTLLEGRLGYHLES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTL 71

Query: 60  FNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVV 119
           +       EG+L+    ++V++   ++V R L+L SFIR+             SI AD +
Sbjct: 72  YRTHPDLPEGQLAKLRAAVVNSRALAEVGRGLELGSFIRLGRGEEGTGGRDKASILADTL 131

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKV 177
           E++I A+YLD G+  A   V + +     +S       D KT LQE   ++    PEY V
Sbjct: 132 EAVIGAVYLDQGLSAASELVHRLFDPLIDRSSNLGAGLDWKTSLQELTASESLGVPEYLV 191

Query: 178 TFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           T  +GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 192 T-ETGPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 229


>gi|313683639|ref|YP_004061377.1| RNAase iii [Sulfuricurvum kujiense DSM 16994]
 gi|313156499|gb|ADR35177.1| RNAse III [Sulfuricurvum kujiense DSM 16994]
          Length = 226

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 72/201 (35%), Positives = 108/201 (53%), Gaps = 10/201 (4%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L++R+GY F N+ LL +ALTH S    Y    ERLEFLGD +L L++   L+  F    E
Sbjct: 7   LQERLGYTFQNKELLIEALTHKSYKQPYNN--ERLEFLGDAVLDLIVGEYLYKKFRGYDE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    SLV+    + +A  L+L   I +S+    +     +S+ ++  E+++ A+YL
Sbjct: 65  GKLSKMRASLVNEGGFTSLANHLNLGEHIFLSNAEENNSGRTKSSLLSNAFEAVMGAMYL 124

Query: 129 DGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           + G+    E+  + ++      +L S    +D KT LQE   A +G TPEY++    GPD
Sbjct: 125 ETGLGKVQEITVSLLEHVHPDISLDS--LFKDYKTSLQELTQAHYGTTPEYQLIAAHGPD 182

Query: 185 HDPRFTVVVEISG--LAPAQG 203
           H   F V V I G   A AQG
Sbjct: 183 HKKEFEVAVIIDGKRYASAQG 203


>gi|254360744|ref|ZP_04976892.1| ribonuclease III [Mannheimia haemolytica PHL213]
 gi|153091314|gb|EDN73288.1| ribonuclease III [Mannheimia haemolytica PHL213]
          Length = 224

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 76/220 (34%), Positives = 118/220 (53%), Gaps = 6/220 (2%)

Query: 4   LRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           ++   L+K++GY F N   L +ALTH S +    ++ ERLEFLGD IL   I  +L++ F
Sbjct: 1   MQLERLQKKLGYQFHNLDYLIQALTHRSAA---TKNNERLEFLGDSILNFTIGKVLYDKF 57

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             A EGELS    +LV  +T + +AR+ DL  ++++     K       SI +D VE++I
Sbjct: 58  PKANEGELSRMRATLVREQTLAIIARKFDLGDYLKLGPGELKSGGFRRESILSDCVEAII 117

Query: 124 AALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           AA+YLD  +  A   V+ ++    + +  G  ++D KT LQE+   +    PEY V    
Sbjct: 118 AAIYLDQDMAKAMEKVEDWYSDLLKDISPGDSQKDPKTRLQEFLQGRKLPLPEYDVLDIK 177

Query: 182 GPDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVL 220
           G  H+  F V  ++  +     G+  S+R AEQ AA + L
Sbjct: 178 GEAHNQTFRVTCKVINVEEVFIGIGTSRRKAEQNAAEKAL 217


>gi|227484649|ref|ZP_03914965.1| ribonuclease III [Anaerococcus lactolyticus ATCC 51172]
 gi|227237369|gb|EEI87384.1| ribonuclease III [Anaerococcus lactolyticus ATCC 51172]
          Length = 237

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 71/224 (31%), Positives = 118/224 (52%), Gaps = 9/224 (4%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ---ESYERLEFLGDRILGLLISTLLFNHFDS 65
            EK IGY F +++L++ A THSS ++  +   +S ERLEFLGD IL +++S  LF ++  
Sbjct: 14  FEKSIGYTFNDKTLIDVAFTHSSFTNEARIKTKSNERLEFLGDTILDMVVSEYLFKNYKE 73

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG L+   + +V  ++ ++   + DL  ++R     +K        ++AD  E+  AA
Sbjct: 74  KPEGWLTRTRSRIVCTDSFAKACEKFDLTKYLRFGMGEKKQGGKLKKHVKADTFEAFCAA 133

Query: 126 LYLDGGIEVAGTFVDKYWKQRALK---SGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           +YLD   +    F+   + +  L+         D KT LQE+ +A       Y++    G
Sbjct: 134 IYLDSSYQRLFEFLKSNYSEEVLQIINDDSLFLDYKTRLQEYYNAHSKKNLSYELIKEVG 193

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAA---EVLKRE 223
           P+HD  FT+ V +   A AQG   +K+ AEQ+AA    E++K +
Sbjct: 194 PEHDKTFTMEVRLGNRALAQGEGKNKKTAEQMAAKAAYEIIKND 237


>gi|160947505|ref|ZP_02094672.1| hypothetical protein PEPMIC_01439 [Parvimonas micra ATCC 33270]
 gi|158446639|gb|EDP23634.1| hypothetical protein PEPMIC_01439 [Parvimonas micra ATCC 33270]
          Length = 237

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 77/222 (34%), Positives = 110/222 (49%), Gaps = 14/222 (6%)

Query: 13  IGYAFANRSLLEKALTHSSISHSYQE---SYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           +GY F +  LL  A  H S  +  ++   S ERLEFLGD ILG ++S  L+  F ++ EG
Sbjct: 17  LGYKFKDLELLNLAFVHRSYLNECKDATISNERLEFLGDVILGFIVSVELYEQFPNSDEG 76

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSF----MTSIQADVVESLIAA 125
            L+   + +V  E+ S  AR  +L  ++     L K   SF      SI AD  E+L  A
Sbjct: 77  YLTKIRSKVVCEESFSYAARTFNLGKYLL----LGKGEDSFGGRNRNSILADTFEALFGA 132

Query: 126 LYLDGGIEVAGTFVDKYWKQRA---LKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           LYLDGG++V     +KY+       +    F +D K+ LQE+ H        Y +    G
Sbjct: 133 LYLDGGMDVVTEIANKYFFDTVVYKIDKNIFIKDYKSYLQEYFHKNATTKISYTLVAERG 192

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           PDHD  F + V I  +    G   +K+ AEQ AA + L + G
Sbjct: 193 PDHDKEFDMCVNIDDVVKGYGTGKNKKQAEQQAARDALIKSG 234


>gi|320547232|ref|ZP_08041525.1| ribonuclease III [Streptococcus equinus ATCC 9812]
 gi|320448120|gb|EFW88870.1| ribonuclease III [Streptococcus equinus ATCC 9812]
          Length = 228

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 78/226 (34%), Positives = 118/226 (52%), Gaps = 8/226 (3%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLIS 56
           M AL  + L++  G  F + +LL+ A TH+S ++ ++       ERLEFLGD +L LLIS
Sbjct: 1   MQALD-TKLQRDFGITFKDTTLLDTAFTHTSYANEHRLLNISHNERLEFLGDAVLQLLIS 59

Query: 57  TLLFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA 116
             LF  +    EG+LS   + +V  E+ +  +R      FI++ +   K       +I  
Sbjct: 60  QYLFKKYPKKPEGDLSKMRSVIVREESLAGFSRYCGFDDFIKLGNGEEKSGGRNRDTILG 119

Query: 117 DVVESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPE 174
           D+ E+ + AL +D G+E    F+++    +  K G F R  D KT LQE       VT +
Sbjct: 120 DLFEAFLGALLMDQGVEAVNKFLNQVMIPQVEK-GNFERVKDYKTTLQELLQGHGDVTID 178

Query: 175 YKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
           Y+V+  SGP H   F V V ++  A +QG+  SK+ AEQ AA   L
Sbjct: 179 YRVSNESGPAHAKVFEVTVYVNDEAKSQGIGKSKKLAEQDAAKNAL 224


>gi|227112907|ref|ZP_03826563.1| ribonuclease III [Pectobacterium carotovorum subsp. brasiliensis
           PBR1692]
 gi|253689440|ref|YP_003018630.1| ribonuclease III [Pectobacterium carotovorum subsp. carotovorum
           PC1]
 gi|259491904|sp|C6DC00|RNC_PECCP RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|251756018|gb|ACT14094.1| ribonuclease III [Pectobacterium carotovorum subsp. carotovorum
           PC1]
          Length = 226

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 120/225 (53%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F    LL +ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPILINRLQRKLGYTFQQYELLLQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE +L   +R+     K       SI AD VE
Sbjct: 58  HRFPKVDEGDMSRMRATLVRGNTLAEIAREFELGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  +++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGIFLDSDIQTIERLILNWYQTRLDEISPGDKQKDPKTRLQEFLQGRHLPLPTYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQ-GMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SG + +  G   S+R AEQ AA + LK+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGFSESVIGTGSSRRKAEQAAAEQALKK 222


>gi|227328581|ref|ZP_03832605.1| ribonuclease III [Pectobacterium carotovorum subsp. carotovorum
           WPP14]
          Length = 226

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 120/225 (53%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F    LL +ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPILINRLQRKLGYTFQQYDLLLQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE +L   +R+     K       SI AD VE
Sbjct: 58  HRFPKVDEGDMSRMRATLVRGNTLAEIAREFELGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  +++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGIFLDSDIQTIERLILNWYQTRLDEISPGDKQKDPKTRLQEFLQGRHLPLPTYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQ-GMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SG + +  G   S+R AEQ AA + LK+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGFSESVIGTGSSRRKAEQAAAEQALKK 222


>gi|269123548|ref|YP_003306125.1| ribonuclease III [Streptobacillus moniliformis DSM 12112]
 gi|268314874|gb|ACZ01248.1| ribonuclease III [Streptobacillus moniliformis DSM 12112]
          Length = 233

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 71/228 (31%), Positives = 117/228 (51%), Gaps = 6/228 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLIS 56
           M  +    L  +I Y F N+ LL +ALTHSS  + +     +  ERLEFLGD ++ L+ +
Sbjct: 1   MKKMDLEKLMSKINYTFKNKKLLLEALTHSSYVNEHNFPNIKDNERLEFLGDSVMDLITT 60

Query: 57  TLLFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA 116
             ++ +   + EGELS   + ++S    S ++R+L+L ++I +S+           S+  
Sbjct: 61  EYIYKNNLKSNEGELSKIKSQIISETVFSTISRDLNLGNYIFLSNGENMSGGRERNSVLG 120

Query: 117 DVVESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFR--RDAKTELQEWAHAKFGVTPE 174
           DV E+++ A+YLD         V K  + +     K     D K+ LQE    K+ VTP 
Sbjct: 121 DVFEAMVGAIYLDSDYATTRDVVLKLLESKINNLDKIEWVSDYKSALQEITQLKYKVTPI 180

Query: 175 YKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           Y V    GPDHD  F + V +      +G+  SK+ AE++AA + +++
Sbjct: 181 YTVLSEIGPDHDKTFEIEVRVEERLYGKGVAKSKKMAEKIAAKQAIEK 228


>gi|329936742|ref|ZP_08286449.1| ribonuclease III [Streptomyces griseoaurantiacus M045]
 gi|329303972|gb|EGG47855.1| ribonuclease III [Streptomyces griseoaurantiacus M045]
          Length = 273

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 76/219 (34%), Positives = 117/219 (53%), Gaps = 6/219 (2%)

Query: 2   SALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLL 59
           +A  ++ LE R+GY     +LL +ALTH S ++      + ERLEFLGD +LGL+++  L
Sbjct: 23  AASSHTLLEGRLGYRLET-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTL 81

Query: 60  FNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVV 119
           +       EG+L+    ++V++   ++V R L+L SF+R+             SI AD +
Sbjct: 82  YRTHPDLPEGQLAKLRAAVVNSRALAEVGRGLELGSFVRLGRGEEGTGGRDKASILADTL 141

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKV 177
           E++I A+YLD G++ A   V + +     KS       D KT LQE    +    PEY V
Sbjct: 142 EAVIGAVYLDQGLDAASELVHRLFDPLIEKSSNLGAGLDWKTSLQELTATEGLGVPEYLV 201

Query: 178 TFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           +  +GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 202 S-ETGPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 239


>gi|325915827|ref|ZP_08178126.1| RNAse III [Xanthomonas vesicatoria ATCC 35937]
 gi|325537948|gb|EGD09645.1| RNAse III [Xanthomonas vesicatoria ATCC 35937]
          Length = 226

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 110/211 (52%), Gaps = 6/211 (2%)

Query: 13  IGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELS 72
           IG+AFA+  LL +AL H S    + E   RLEFLGD I+ LLI+  L+  +  A EG L+
Sbjct: 12  IGHAFADPGLLARALRHRSAGTPHNE---RLEFLGDGIVNLLIAEALYQRWPKADEGALT 68

Query: 73  VRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGI 132
                LV     + + R L+L   + +     K       SI AD VE+++AA+YLD G 
Sbjct: 69  RARAELVREGALAVIGRTLNLGERLTLGPGELKSGGHRRDSILADAVEAIVAAIYLDCGF 128

Query: 133 EVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFT 190
           E     V  +++    AL  GK  +D KT LQEW  A+    P Y +   SG +H  +F 
Sbjct: 129 ERCRAVVLPWFEPSLAALPVGKAEKDPKTRLQEWLQARQLPLPNYALISESGDEHAKQFH 188

Query: 191 VVVEI-SGLAPAQGMDCSKRAAEQVAAAEVL 220
           V   +   +A A+G   S+R AEQ AAA V+
Sbjct: 189 VACILEQPIARAEGQGTSRRLAEQQAAATVI 219


>gi|77919004|ref|YP_356819.1| RNase III [Pelobacter carbinolicus DSM 2380]
 gi|90101632|sp|Q3A4Q8|RNC_PELCD RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|77545087|gb|ABA88649.1| RNAse III [Pelobacter carbinolicus DSM 2380]
          Length = 232

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 72/222 (32%), Positives = 116/222 (52%), Gaps = 12/222 (5%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQE----SYERLEFLGDRILGLLISTLLFNHFD 64
           LE  I Y F N++LL +ALTH S S+   +      ERLEFLGD +LG+++S  +F  F 
Sbjct: 10  LEDTIDYVFDNQALLLEALTHKSFSNEQNDRTEPDNERLEFLGDAVLGVVVSHYIFRTFP 69

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EGEL+   + +VS +  + + + + L  ++R+     +      +S+ A+ +E+L+ 
Sbjct: 70  HLPEGELTRIRSEVVSEKGLTVIGKAICLGDYMRLGKGEERSGGRQKSSLLANTMEALLG 129

Query: 125 ALYLDGGIE-----VAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTF 179
           A++ DGG +     +   F+    +    K+G    D KT LQE   A+FG  P+Y +  
Sbjct: 130 AVFCDGGFDSVRRVIEALFIPHIQRAARRKTGV---DYKTRLQERLQARFGDVPQYVLIH 186

Query: 180 RSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
             GP H   ++V     G    QG   SK++AEQ AA + L+
Sbjct: 187 ADGPPHQRSYSVEAHFRGSCIGQGQGRSKKSAEQAAAKQALE 228


>gi|320008314|gb|ADW03164.1| ribonuclease III [Streptomyces flavogriseus ATCC 33331]
          Length = 274

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 118/219 (53%), Gaps = 6/219 (2%)

Query: 2   SALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLL 59
           +A  ++ LE R+GY   + +LL +ALTH S ++      + ERLEFLGD +LGL+++  L
Sbjct: 16  TASSHTLLEGRLGYHLES-ALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTL 74

Query: 60  FNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVV 119
           +       EG+L+    ++V++   ++V R L+L SFIR+             SI AD +
Sbjct: 75  YRTHPDLPEGQLAKLRAAVVNSRALAEVGRGLELGSFIRLGRGEEGTGGRDKASILADTL 134

Query: 120 ESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKV 177
           E++I A+YLD G+  A   V + +     +S       D KT LQE   ++    PEY V
Sbjct: 135 EAVIGAVYLDQGLGAASELVHRLFDPLIDRSSNLGAGLDWKTSLQELTASESLGVPEYLV 194

Query: 178 TFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           T  +GPDH+  FT    + G++   G   SK+ AEQ AA
Sbjct: 195 T-ETGPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAA 232


>gi|154173754|ref|YP_001409228.1| ribonuclease III [Campylobacter curvus 525.92]
 gi|189043298|sp|A7H186|RNC_CAMC5 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|112803490|gb|EAU00834.1| ribonuclease III [Campylobacter curvus 525.92]
          Length = 223

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 70/219 (31%), Positives = 118/219 (53%), Gaps = 8/219 (3%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAK 67
            L+K +GY F N  LL +ALTH S    Y  S ERLEFLGD ++ L++   LF  F    
Sbjct: 6   NLQKLLGYEFENTKLLNEALTHKSTKLPY--SNERLEFLGDAVMDLIVGEYLFKKFSKTN 63

Query: 68  EGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALY 127
           EG++S    +LV+ ++ + +AR L +  FI +S+    +      S+ +D  E+++ A+Y
Sbjct: 64  EGDMSKLRAALVNEKSFANMARHLQIGEFIHLSTAEANNGGREKASLLSDAFEAVMGAVY 123

Query: 128 LDGGI----EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           L+ G+    E+A   ++  + +  +      +D KT LQE   A  G TP Y++    GP
Sbjct: 124 LEAGLDKVREIAVRLLEICYPK--IDFSHLVKDYKTALQEITQASLGTTPIYELVRSFGP 181

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           DH   F + + ++    ++ +  SK+ A+Q+AA   L++
Sbjct: 182 DHKKEFEIALLLNDKEISRAIANSKKEAQQMAAKIALEK 220


>gi|160880576|ref|YP_001559544.1| ribonuclease III [Clostridium phytofermentans ISDg]
 gi|160429242|gb|ABX42805.1| Ribonuclease III [Clostridium phytofermentans ISDg]
          Length = 235

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 114/211 (54%), Gaps = 5/211 (2%)

Query: 10  EKRIGYAFANRSLLEKALTHSSISH----SYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           E++I YAF    LL +ALTHSS ++    S   + ERLEFLGD +L L  S  LF     
Sbjct: 14  EQKIDYAFTEPGLLRQALTHSSFANEKRLSKLANNERLEFLGDAVLELTTSEWLFEKHPK 73

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+L+    S+V  +T +  AREL L +++ +             SI +D +ES+I A
Sbjct: 74  MPEGDLTKLRASMVCEQTLALCARELHLGNYVFLGKGEDTTGGRDRDSILSDALESIIGA 133

Query: 126 LYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           +YLDGG   A  F+  Y     ++  K   D+KT LQE   +++     Y++   +GPDH
Sbjct: 134 IYLDGGFANAKEFISNYILSD-IEHKKLFYDSKTILQEIVQSEYKKHLSYELLQETGPDH 192

Query: 186 DPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           + +FTVV ++   +   G   +K+AAEQ AA
Sbjct: 193 NKKFTVVAKMDEESLEIGTGRTKKAAEQEAA 223


>gi|291563451|emb|CBL42267.1| RNAse III [butyrate-producing bacterium SS3/4]
          Length = 226

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 116/216 (53%), Gaps = 5/216 (2%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLISTLLF 60
           +   L++ IGY F +  LL  ALTHSS ++          ERLEFLGD +L ++ S  LF
Sbjct: 4   KLEKLQEMIGYQFKDPGLLTHALTHSSYANEKHWDKTRCNERLEFLGDAVLEVISSDFLF 63

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + ++S  EGE++    SLV   T +  A  + L  ++ +             S+ +D +E
Sbjct: 64  HTYESMPEGEMTKLRASLVCEPTLAYCADVIPLGDYLLLGKGEDLTGGRKRPSVVSDAME 123

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           ++I A+YLDGG+  A  F+ ++     ++  +   D+KT LQE   AK+  T  Y++   
Sbjct: 124 AVIGAIYLDGGLANAKEFIHRFI-LNDIEHKQLFYDSKTILQEMVQAKYKETLVYELLKE 182

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
            GPDH+  F V V+I      +G+  +K+AAEQVAA
Sbjct: 183 EGPDHNKSFEVCVKIGDEEIGRGLGRTKKAAEQVAA 218


>gi|261855986|ref|YP_003263269.1| ribonuclease III [Halothiobacillus neapolitanus c2]
 gi|261836455|gb|ACX96222.1| ribonuclease III [Halothiobacillus neapolitanus c2]
          Length = 243

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 86/227 (37%), Positives = 117/227 (51%), Gaps = 14/227 (6%)

Query: 1   MSALRYST--------LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILG 52
           MSAL+ S+        L + IG  FA+  LLE AL H S  +    + ERLEFLGD +L 
Sbjct: 1   MSALKPSSPFVTAPEKLAQHIGITFASPELLEMALRHRSAGNM---NNERLEFLGDAVLN 57

Query: 53  LLISTLLFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMT 112
           L+I+  L+     A EGELS    SLV  E+ + +ARELDL S++ +     K       
Sbjct: 58  LVIANQLYTMHSKATEGELSRWRASLVREESLAVIARELDLGSYLVLGPGELKSGGFRRD 117

Query: 113 SIQADVVESLIAALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFG 170
           SI AD +E+ I A+YLD G +VA + + + +++  + L      +D KT LQEW      
Sbjct: 118 SILADALEATIGAVYLDQGFDVAQSLLVRLFERMLQDLPDAASLKDPKTRLQEWLQGSKR 177

Query: 171 VTPEYKVTFRSGPDHDPRFTVVVEISGL-APAQGMDCSKRAAEQVAA 216
             P Y+VT   G  H   F V   +S     A G   S+R AEQ AA
Sbjct: 178 ELPSYEVTTIRGQAHKQVFEVTCTLSDTQQTAVGRGSSRRKAEQAAA 224


>gi|150021479|ref|YP_001306833.1| ribonuclease III [Thermosipho melanesiensis BI429]
 gi|149794000|gb|ABR31448.1| Ribonuclease III [Thermosipho melanesiensis BI429]
          Length = 231

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 79/231 (34%), Positives = 126/231 (54%), Gaps = 13/231 (5%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISH-SYQESYERLEFLGDRILGLLISTLL 59
           M   R   +E  IGY F N+ LL  ALTH+S ++ + ++SYERLEFLGD ++ +L+ T+L
Sbjct: 1   MERFREGEIEHVIGYRFRNKELLFTALTHTSYANENKKQSYERLEFLGDSVIDILVCTIL 60

Query: 60  FNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVV 119
           +  + +  EG ++   +++ S +   ++A++ +L  +I +    R+   S   SI ADVV
Sbjct: 61  YEQYQTLNEGTMAQIKSAVTSEDILFEIAKKFNLGKYILLGKGERRSRGSEKKSILADVV 120

Query: 120 ESLIAALYLDG--GIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEY 175
           ESLIAA+YLD    +++      K +K       +GK   D KT+LQE    KF   P Y
Sbjct: 121 ESLIAAIYLDSNKNLKLIENLFSKIFKDYIDIFLTGKRIFDYKTKLQELTQDKFKQLPVY 180

Query: 176 KVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAA---EVLKRE 223
           + T   G     +F   ++I+    ++    SK+ AE++AA    E LK E
Sbjct: 181 ETTTVGG-----KFITTLKINNKIYSKAKGSSKKDAEKLAAKIAYEKLKEE 226


>gi|157737847|ref|YP_001490531.1| ribonuclease III [Arcobacter butzleri RM4018]
 gi|315637636|ref|ZP_07892842.1| ribonuclease III [Arcobacter butzleri JV22]
 gi|189043289|sp|A8EV88|RNC_ARCB4 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|157699701|gb|ABV67861.1| ribonuclease III [Arcobacter butzleri RM4018]
 gi|315478090|gb|EFU68817.1| ribonuclease III [Arcobacter butzleri JV22]
          Length = 224

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 107/206 (51%), Gaps = 4/206 (1%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           YS LEK + Y F N++L+ +ALTH S    Y    ERLEFLGD +L L++   L+  F  
Sbjct: 4   YSKLEKCLDYQFKNKNLIIEALTHKSFKKPYNN--ERLEFLGDAVLNLIVGEYLYLKFPK 61

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
           + EGELS    SLV+    +++A E+ L  +I +S+   ++      SI +D  E+++ A
Sbjct: 62  SNEGELSKIRASLVNETGFTRLANEIKLGEYIFISTAEERNKGRTKASILSDAFEAIMGA 121

Query: 126 LYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           +YL+ G+      + +  ++    +       D KT LQE   A+F   PEYK+    GP
Sbjct: 122 IYLESGLNTLKPIILRILEESYDKINLDVLFSDYKTALQEITQARFASIPEYKIEGSYGP 181

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKR 209
           DH   F V + I G    +    SK+
Sbjct: 182 DHKKEFEVSIWIDGKNYGKASGKSKK 207


>gi|46445908|ref|YP_007273.1| putative ribonuclease III [Candidatus Protochlamydia amoebophila
           UWE25]
 gi|81627660|sp|Q6MEK1|RNC_PARUW RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|46399549|emb|CAF22998.1| putative Ribonuclease III [Candidatus Protochlamydia amoebophila
           UWE25]
          Length = 242

 Score =  115 bits (289), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 115/220 (52%), Gaps = 4/220 (1%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQE---SYERLEFLGDRILGLLISTLLFNHF 63
             +E ++GY F +  LL  A  H S  +  +E     ERLEFLGD +LG+LIS  L+   
Sbjct: 19  PAIEAKLGYTFKDPQLLVLAFVHRSFINENREVNQHNERLEFLGDSVLGMLISDYLYCKL 78

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
               EG+LS   + LV A +C    + LDL+ ++ +    R +      SI AD+ E++I
Sbjct: 79  PKTPEGQLSYLRSRLVEASSCVHYIQSLDLSGYLLLGKGERMNDGRGRESILADLFEAII 138

Query: 124 AALYLDGGIEVAGTFVDKYWKQRA-LKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
            A+YLDGG++ A  F+ K + Q   +      R+ K  LQ++    +  TP Y+V   SG
Sbjct: 139 GAIYLDGGLQAAKDFLFKNFHQHIEIILATPLRNWKALLQDYCQKNYQQTPLYQVLHESG 198

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           PDH   F + V I      +G   SK+ A+Q AAA+ L R
Sbjct: 199 PDHSKVFQISVWIQDRELGRGKGTSKKEAQQAAAADALSR 238


>gi|195952887|ref|YP_002121177.1| Ribonuclease III [Hydrogenobaculum sp. Y04AAS1]
 gi|226741373|sp|B4U7T8|RNC_HYDS0 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|195932499|gb|ACG57199.1| Ribonuclease III [Hydrogenobaculum sp. Y04AAS1]
          Length = 232

 Score =  115 bits (289), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 77/221 (34%), Positives = 118/221 (53%), Gaps = 7/221 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDS 65
           +  LE++IGY F +++L++KA TH S S S  E+YE LEFLGD ++  +   +L   F +
Sbjct: 4   FELLEEKIGYRFKDKNLVKKAFTHISFSKS-SENYEVLEFLGDALVNFMTVNILVEAFPN 62

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
            KEGELS   + L+S E  + +A+ L+   +I +S        +   SI  DV E+  AA
Sbjct: 63  KKEGELSQLKSFLISEEFLASLAKSLNFEKYILISKGEELKGSNKNPSILCDVFEAFWAA 122

Query: 126 LYLDGGIE--VAGTFVDKYWKQRALK---SGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           +Y+D G +  +  +  + ++K + L+   S   ++D KT LQE    K+   P Y V   
Sbjct: 123 IYIDSGYDCKLTKSLFEHHFKSQILEMVNSNSLKQDYKTALQEITQKKWKERPIYNVISV 182

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
            GP+H   FTV      L    G   SK+ AEQ AA  +L+
Sbjct: 183 EGPEHRKTFTVECLFKDLRTT-GKGNSKKYAEQEAAKNMLQ 222


>gi|118444155|ref|YP_878292.1| ribonuclease III [Clostridium novyi NT]
 gi|118134611|gb|ABK61655.1| ribonuclease III [Clostridium novyi NT]
          Length = 237

 Score =  115 bits (289), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 79/220 (35%), Positives = 118/220 (53%), Gaps = 6/220 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQE--SYERLEFLGDRILGLLISTLLFNHFD 64
           + +E ++   F + ++L+ ALTHSS  +  +   S ERLEFLGD IL L IS LL+N ++
Sbjct: 10  NEVENKLKVKFNDINILDTALTHSSFINENKNINSNERLEFLGDSILQLCISELLYNKYN 69

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EG L+ +   +V   +  +VA++ ++  +I +S            SI +D VE++IA
Sbjct: 70  DEPEGFLTKKRALIVCGNSLHEVAKKWNIGKYINMSKGEEMTGGRTRISILSDCVEAIIA 129

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALK--SGKFRRDAKTELQEWAHAKFG-VTPEYKVTFRS 181
           ++YLD G EVA  F+ + + +   K  S +   D KT+LQE    KFG    EY +    
Sbjct: 130 SIYLDQGYEVAKNFIIENFNEIIQKAHSNEIILDYKTKLQETIQ-KFGEYNIEYTLVSFE 188

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           GP H  +F   V I  L    G   SK+ +EQ AA E LK
Sbjct: 189 GPPHRRKFVTEVSIDSLVKGVGEGYSKKESEQNAAKEALK 228


>gi|210612575|ref|ZP_03289366.1| hypothetical protein CLONEX_01568 [Clostridium nexile DSM 1787]
 gi|210151500|gb|EEA82507.1| hypothetical protein CLONEX_01568 [Clostridium nexile DSM 1787]
          Length = 231

 Score =  115 bits (289), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 110/212 (51%), Gaps = 5/212 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLISTLLFNHFD 64
           L++RIGY F  + LL+ AL HSS ++       +  ERLEFLGD +L L+ S  LF    
Sbjct: 8   LQERIGYTFRRQELLKSALMHSSYTNETHLPKYKCNERLEFLGDAVLELVSSEFLFFADR 67

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EGEL+    S+V   + +  ARE++L  ++ +             SI +D +E+LI 
Sbjct: 68  KMPEGELTKTRASMVCEPSLAFCAREIELGKYLFMGRGEENTGGRERDSITSDALEALIG 127

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           A+YLDGG   A  F+ K+     L+  K   D+KT LQE   A F     Y +    GPD
Sbjct: 128 AIYLDGGFANAKEFILKFV-LNDLEHKKLFYDSKTILQEIVQAHFPYGVLYHLIKEEGPD 186

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           H+  FTV V I      +G   +K+AAEQ AA
Sbjct: 187 HNKSFTVAVHIGEECYGEGTGRTKKAAEQEAA 218


>gi|78044311|ref|YP_360276.1| ribonuclease III [Carboxydothermus hydrogenoformans Z-2901]
 gi|90101616|sp|Q3AC58|RNC_CARHZ RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|77996426|gb|ABB15325.1| ribonuclease III [Carboxydothermus hydrogenoformans Z-2901]
          Length = 235

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 80/225 (35%), Positives = 118/225 (52%), Gaps = 9/225 (4%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSISHSYQES----YERLEFLGDRILGLLISTLLFNHF 63
           +LEK +G+ F N S+L  A+TH S +  + E      ERLEFLGD +L L IS  LF  F
Sbjct: 8   SLEKILGFNFNNPSILLSAITHPSYAFEHPEEGIEHNERLEFLGDAVLELFISDYLFRTF 67

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
               EG+L+   + LV AE+  ++A +++L  F+R+     K   +   S  A+ VE++I
Sbjct: 68  PQKSEGDLTKLRSRLVCAESLYELAFKINLDKFLRLGKGEFKAGGNQRMSNLANAVEAVI 127

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSG--KFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
            A+Y D GIE A +F+ + + ++       +  +D KT LQE    +      Y++    
Sbjct: 128 GAVYFDCGIEAAFSFITRLYGEKLKPENLEQLPKDEKTTLQELLQKEKNNVLRYEILLEE 187

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAA---EVLKRE 223
           GP H   FT  V I+    A G   SK+ AEQ AA    E+LK E
Sbjct: 188 GPPHQKIFTAGVIINDKLIATGRGKSKKEAEQEAAKKALELLKNE 232


>gi|160938006|ref|ZP_02085363.1| hypothetical protein CLOBOL_02899 [Clostridium bolteae ATCC
           BAA-613]
 gi|158439000|gb|EDP16755.1| hypothetical protein CLOBOL_02899 [Clostridium bolteae ATCC
           BAA-613]
          Length = 234

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 69/212 (32%), Positives = 116/212 (54%), Gaps = 5/212 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESY----ERLEFLGDRILGLLISTLLFNHFD 64
           LE+RI Y F N++L  +ALTHSS ++ ++  +    ERLEFLGD +L ++ S  L+  ++
Sbjct: 8   LEERIAYEFKNKNLFTQALTHSSYANEHRLDHSRCNERLEFLGDAVLEIVTSEFLYRKYE 67

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
           +  EG+L+    S+V   T +  A +++L  ++ +             S+ +D +E+LI 
Sbjct: 68  TLPEGDLTKIRASIVCEPTLAYCAGDIELGQYLYLGKGEDATGGRNRNSVVSDAMEALIG 127

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           A+YLDGG   A  F+ ++     ++  +   D+KT LQE   ++      Y++    GPD
Sbjct: 128 AIYLDGGFANAKEFIHRFILND-IEHKQLFYDSKTILQEMVQSRQEAPLSYEIIREEGPD 186

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           H+  F V  +I      +G   +K+AAEQVAA
Sbjct: 187 HNKSFEVCAKIGDEEVGRGAGRTKKAAEQVAA 218


>gi|149374709|ref|ZP_01892483.1| ribonuclease III [Marinobacter algicola DG893]
 gi|149361412|gb|EDM49862.1| ribonuclease III [Marinobacter algicola DG893]
          Length = 229

 Score =  115 bits (288), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 114/220 (51%), Gaps = 6/220 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L++RIGY F     L  ALTH S  +   ++ ERLEFLGD I+ ++I+  L+ HF+ A+E
Sbjct: 10  LQRRIGYQFKTPERLLLALTHRSFGN---QNNERLEFLGDSIVNMVIAEYLYLHFEKARE 66

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS     +V   T +++ RE +L  ++R+ S   K       SI AD VES+I A+YL
Sbjct: 67  GQLSRLRARMVKGVTLAEIGREFELGKYLRLGSGEMKSGGFRRESILADAVESIIGAIYL 126

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D         V ++++ R   L     ++D KT LQE+  ++    P Y V    G  H 
Sbjct: 127 DSDFHTCREQVLRWFEVRLQKLDLQDTQKDPKTRLQEYLQSRQFPLPRYDVISVDGEAHA 186

Query: 187 PRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKREGI 225
             F V   +  L     G   S+R AEQ AA   LK+ G+
Sbjct: 187 QTFHVSCALPSLDRKTTGTGNSRRIAEQQAARNALKQLGV 226


>gi|218132444|ref|ZP_03461248.1| hypothetical protein BACPEC_00303 [Bacteroides pectinophilus ATCC
           43243]
 gi|217992554|gb|EEC58556.1| hypothetical protein BACPEC_00303 [Bacteroides pectinophilus ATCC
           43243]
          Length = 234

 Score =  115 bits (288), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 79/220 (35%), Positives = 116/220 (52%), Gaps = 6/220 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLISTLLFNH 62
           + L++ +GY+F + SLL+ ALTHSS ++  +     + ERLEFLGD +L L+ S  LFN 
Sbjct: 14  NELQQAMGYSFDDVSLLKHALTHSSYANELRINKTGNNERLEFLGDAVLELVSSEYLFNE 73

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
                EG LS    S+V   + +  AR++ L  +I +             SI +D +E++
Sbjct: 74  HKDVNEGSLSKLRASMVCEPSLAFCARDISLQKYIMLGKGEDATGGRQRDSITSDALEAV 133

Query: 123 IAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           I A+YLDGG E A  F+  +     L + K   D+KT LQE   A    TPEY++T   G
Sbjct: 134 IGAIYLDGGFEPAKKFIMAHVLND-LDNKKLFYDSKTILQEILQAD-NKTPEYRITGEEG 191

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           P+H   F+  V         G   +K+AAEQ AA + + R
Sbjct: 192 PEHSKTFSAEVLDGSTVLGHGSGHNKKAAEQQAAYDAILR 231


>gi|300854469|ref|YP_003779453.1| dsRNA-specific ribonuclease [Clostridium ljungdahlii DSM 13528]
 gi|300434584|gb|ADK14351.1| dsRNA-specific ribonuclease [Clostridium ljungdahlii DSM 13528]
          Length = 235

 Score =  115 bits (288), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 121/219 (55%), Gaps = 6/219 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHFDSA 66
           LEK+   +F+N+ ++E ALTHSS ++  +  +  ERLEFLGD +L L IS  LF  + S 
Sbjct: 10  LEKKFNMSFSNKEIIEVALTHSSYANGRKNIKFNERLEFLGDSVLQLCISEYLFLKYKSK 69

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EGEL+ + + +V   +   VA++ +L  +I++S           TSI AD VE++IAA+
Sbjct: 70  PEGELTKKRSLIVCENSLYHVAKKWNLGKYIKMSKGEEITGGRERTSILADCVEAIIAAI 129

Query: 127 YLDGGIEVAGTFVDKYWK---QRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           YL+ G E  G F+ + ++   + A+K+ +   D KT+LQE       V+ EY +    GP
Sbjct: 130 YLNFGYENTGKFIIENFQDIIENAIKN-RIIMDYKTKLQETLQKDGDVSIEYNLVKYEGP 188

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
            H  +F   V         G+  SK+ +EQ AA + L +
Sbjct: 189 PHRRKFYTEVCTEKNVLGSGVGYSKKESEQNAAQDALMK 227


>gi|288941442|ref|YP_003443682.1| ribonuclease III [Allochromatium vinosum DSM 180]
 gi|288896814|gb|ADC62650.1| ribonuclease III [Allochromatium vinosum DSM 180]
          Length = 225

 Score =  115 bits (288), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 78/217 (35%), Positives = 115/217 (52%), Gaps = 6/217 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L + +G+ F    LL +ALTH S+  S   + ERLEFLGD ++G +I+  L+  F  A E
Sbjct: 8   LAQALGHRFTREELLIQALTHRSVGSS---NNERLEFLGDALIGFVIAEALWERFPKADE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G LS    SLV  E+ +++AR+L L   +R+ +   +       SI AD +E+++ A+YL
Sbjct: 65  GTLSRMRASLVKRESLARLARDLKLGDSLRLGAGELRTGGHARDSILADALEAVLGAVYL 124

Query: 129 DGGIEVAGTFVDKYWKQRALKSGKFR--RDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D G E   T V + +  R  ++   R  +D KT LQEW  +     PEY V    G  HD
Sbjct: 125 DAGFERTRTVVLELFAARLEQTDAERAGKDPKTRLQEWLQSYKRPLPEYLVLSIDGDQHD 184

Query: 187 PRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKR 222
             F V  ++       +G   S+R AEQ AA  +L+R
Sbjct: 185 QTFIVSCQLQDADVTTRGTGTSRRRAEQAAAESMLER 221


>gi|260881779|ref|ZP_05893556.1| ribonuclease III [Mitsuokella multacida DSM 20544]
 gi|260847870|gb|EEX67877.1| ribonuclease III [Mitsuokella multacida DSM 20544]
          Length = 247

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 76/219 (34%), Positives = 116/219 (52%), Gaps = 5/219 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQES---YERLEFLGDRILGLLISTLLFNHFDS 65
           L +R+G  F + +LL++ALTH+S ++  + +    ERLEFLGD +L L  ST L+ HF  
Sbjct: 20  LSERLGVTFHDIALLDQALTHTSYANESKRNTAHNERLEFLGDAVLELASSTYLYEHFPE 79

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EGEL+    S+V + T +++A  L L  ++ +             +   DV E++I A
Sbjct: 80  MPEGELTKTRASIVCSTTLAKLATGLHLGDYLLLGRGEEMGGGRTRQTNLEDVFEAVIGA 139

Query: 126 LYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           +YLD G E A  +V +  +      + G   +D KT LQE    K G +  Y++   SGP
Sbjct: 140 VYLDQGWEAAQAYVVRQLRGEFENAEHGAILKDYKTILQEIVFRKEGQSIAYELVSESGP 199

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           DH   FT  V ++G    +G   SK+ AEQ AA   L++
Sbjct: 200 DHAKEFTFRVRVTGKVMGEGTGHSKKEAEQHAARRALEK 238


>gi|71892313|ref|YP_278047.1| RNase III [Candidatus Blochmannia pennsylvanicus str. BPEN]
 gi|90101614|sp|Q492D1|RNC_BLOPB RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|71796419|gb|AAZ41170.1| RNase III [Candidatus Blochmannia pennsylvanicus str. BPEN]
          Length = 229

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 75/221 (33%), Positives = 117/221 (52%), Gaps = 9/221 (4%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L++++GY F    LL +ALTH S S+ + E   RLEFLGD IL  +I+ LL++ F   
Sbjct: 4   NALQEKLGYIFNRYDLLLQALTHRSSSNQHNE---RLEFLGDAILNYVIANLLYHRFPHI 60

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG +S    +LV   T + +ARE +L  ++++     K       SI A+ +E+LI  +
Sbjct: 61  SEGGMSRMRANLVRENTLATLAREFNLGDYLQLGQGELKSGGYQRESILANTIEALIGGI 120

Query: 127 YLDGGIEVAGTFVDKYWKQR-----ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           +LD  I+     +  ++K R        S   ++D KT LQE+   +    P Y +    
Sbjct: 121 FLDSNIQTIEILIINWYKIRIDHMDPYASYDTQKDPKTRLQEYMQRRRLPLPVYWINQII 180

Query: 182 GPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLK 221
           G  H+  FT+  ++S L  P  G   S+R AEQ AAA+VL+
Sbjct: 181 GEAHNQIFTINCQVSELTQPIIGCGSSRRRAEQNAAAKVLE 221


>gi|21230730|ref|NP_636647.1| ribonuclease III [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66769274|ref|YP_244036.1| ribonuclease III [Xanthomonas campestris pv. campestris str. 8004]
 gi|188992425|ref|YP_001904435.1| ribonuclease III [Xanthomonas campestris pv. campestris str. B100]
 gi|24212269|sp|Q8PB52|RNC_XANCP RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|81304767|sp|Q4USF7|RNC_XANC8 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|21112323|gb|AAM40571.1| ribonuclease III [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66574606|gb|AAY50016.1| ribonuclease III [Xanthomonas campestris pv. campestris str. 8004]
 gi|167734185|emb|CAP52393.1| Ribonuclease III [Xanthomonas campestris pv. campestris]
          Length = 226

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 110/211 (52%), Gaps = 6/211 (2%)

Query: 13  IGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELS 72
           IG+AFA+  LL +AL H S    + E   RLEFLGD I+ LLI+  L+  +  A EG L+
Sbjct: 12  IGHAFADPGLLAQALRHRSAGTPHNE---RLEFLGDGIVNLLIAEALYQRWPKADEGALT 68

Query: 73  VRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGI 132
                LV     + + R L+L   + +     K       SI AD VE+++AA+YLD G 
Sbjct: 69  RARAELVREGALAVIGRTLNLGERLTLGPGELKSGGHRRDSILADAVEAIVAAIYLDCGF 128

Query: 133 EVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFT 190
           E     V  +++    AL  GK  +D KT LQEW  A+    P+Y +   SG +H  +F 
Sbjct: 129 ERCRAVVLPWFEPSLAALPVGKAEKDPKTRLQEWLQARQLPLPQYALISESGDEHAKQFH 188

Query: 191 VVVEISGLAP-AQGMDCSKRAAEQVAAAEVL 220
           V   +   A  A+G   S+R AEQ AAA V+
Sbjct: 189 VACILEQPAARAEGQGTSRRLAEQQAAATVI 219


>gi|254481213|ref|ZP_05094458.1| ribonuclease III [marine gamma proteobacterium HTCC2148]
 gi|214038376|gb|EEB79038.1| ribonuclease III [marine gamma proteobacterium HTCC2148]
          Length = 232

 Score =  115 bits (287), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 116/208 (55%), Gaps = 6/208 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L++ +GY FA++SLL+ ALTH S+      + ERLEFLGD I+  +I+  L+  F  A+E
Sbjct: 11  LQRALGYQFADKSLLQLALTHRSVG---GRNNERLEFLGDSIVNHIIAEALYRQFPDARE 67

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G++S    SLV  +T ++VARELDL   + +    RK       SI AD +E++  A+ +
Sbjct: 68  GDMSRMRASLVKGDTLAEVARELDLGEHLLLGPGERKSGGKRRGSILADGLEAVAGAILI 127

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  +    + V  ++++R   L      +DAKT LQE+   +    PEY++    G DH+
Sbjct: 128 DSDVAACRSCVLTWFRERLDLLSLDGADKDAKTLLQEYLQGRRSPLPEYELLGVVGEDHE 187

Query: 187 PRFTVVVEIS-GLAPAQGMDCSKRAAEQ 213
            +F V   I+  +   +G   S+R AEQ
Sbjct: 188 QQFHVACRIAKPVLVVEGDGSSRRKAEQ 215


>gi|253581846|ref|ZP_04859070.1| ribonuclease III [Fusobacterium varium ATCC 27725]
 gi|251836195|gb|EES64732.1| ribonuclease III [Fusobacterium varium ATCC 27725]
          Length = 235

 Score =  115 bits (287), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 71/229 (31%), Positives = 122/229 (53%), Gaps = 7/229 (3%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSY----QESYERLEFLGDRILGLLISTLLF 60
            Y  LE  +GY+F N+ LL+ +L H S  + +    + S ERLE LGD +L L+++  L+
Sbjct: 4   NYLELEGNLGYSFNNKELLKNSLIHRSFGNEHWRYKKISNERLELLGDAVLDLVVTEYLY 63

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
              +S+ EG+L+   + +VS    + +++++D+  ++ +S           +SI  D  E
Sbjct: 64  KSHESSTEGDLAKIKSMVVSEPVLASISKKMDVGKYLLLSKGEEMTGGRERSSILGDAFE 123

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKVT 178
           +++ A+YLD   E A  +   + K       K     D KT LQE++  ++ + P Y+V 
Sbjct: 124 AILGAIYLDSDFETAKKYALSHIKDSIDHVDKNEDILDFKTILQEYSQREYKIIPSYEVI 183

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIWT 227
             +GPDH   F + V I G    +G   +K++AEQ AA E+ K+ G+ T
Sbjct: 184 RETGPDHQKVFEIEVRI-GERTGRGTGKNKKSAEQSAAKELCKKLGVKT 231


>gi|241763850|ref|ZP_04761895.1| Ribonuclease III [Acidovorax delafieldii 2AN]
 gi|241366894|gb|EER61308.1| Ribonuclease III [Acidovorax delafieldii 2AN]
          Length = 227

 Score =  115 bits (287), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 78/211 (36%), Positives = 111/211 (52%), Gaps = 8/211 (3%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           S L+ R+ + F+N SLL++A+TH S S  + E   RLEFLGD +L L +++LL+      
Sbjct: 6   SALQDRLQHHFSNASLLQRAITHRSFSADHNE---RLEFLGDSVLNLAVASLLYQRLSDL 62

Query: 67  KEGELS-VRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
            EG+LS VR N LV  +T  Q+A  L ++  +R+     K       SI AD +E+LI A
Sbjct: 63  PEGDLSRVRAN-LVKQDTLHQLALRLQVSDVLRLGEGESKSGGQNRPSILADALEALIGA 121

Query: 126 LYLDGGIEVAGTFVDKYWKQRALKS--GKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           +YLD G   A   V + ++   +        +D KT LQEW   +    P Y V    G 
Sbjct: 122 VYLDAGYSRAEALVHRLFQGVEINPQMQAAAKDPKTALQEWLQGRKMKLPHYSVVATVGA 181

Query: 184 DHDPRFTVVVEISGLAPAQ-GMDCSKRAAEQ 213
            H   F V  EI+ L  A+ G+  S+RA EQ
Sbjct: 182 AHRQTFDVECEIAELGLAERGIGGSRRAGEQ 212


>gi|94263438|ref|ZP_01287251.1| Ribonuclease III [delta proteobacterium MLMS-1]
 gi|93456168|gb|EAT06307.1| Ribonuclease III [delta proteobacterium MLMS-1]
          Length = 233

 Score =  115 bits (287), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 76/201 (37%), Positives = 103/201 (51%), Gaps = 4/201 (1%)

Query: 13  IGYAFANRSLLEKALTHSSISHSYQE---SYERLEFLGDRILGLLISTLLFNHFDSAKEG 69
           +GY F   SLLE AL HSS +    +   S ERLEFLGD +LGL ++ LL+    +  EG
Sbjct: 15  MGYRFKRTSLLELALVHSSRAAEAGKGVSSNERLEFLGDAVLGLAVAALLYEAHPTMPEG 74

Query: 70  ELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLD 129
           +LS    +LV+ E  + +AR+L L  FIR+             SI A   E+L+ A+YLD
Sbjct: 75  DLSRHRAALVNEEHLAGMARQLALGEFIRLGRGEEATGGRDKPSILAATFEALVGAVYLD 134

Query: 130 GGIEVAGTFVDKYWKQRALKSGKFR-RDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPR 188
           GG E A   +   +          R  D+K+ LQE    + G  P Y +    GPDHD R
Sbjct: 135 GGYEPALALLRPLFAPWVANPPLPRISDSKSALQEVLQQRHGEGPVYYLENEEGPDHDKR 194

Query: 189 FTVVVEISGLAPAQGMDCSKR 209
           FTV VE+ G    +G    K+
Sbjct: 195 FTVRVELQGKVLGRGRGRGKK 215


>gi|261492470|ref|ZP_05989024.1| ribonuclease III [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261496943|ref|ZP_05993311.1| ribonuclease III [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261307467|gb|EEY08802.1| ribonuclease III [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261311833|gb|EEY12982.1| ribonuclease III [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 224

 Score =  115 bits (287), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 118/220 (53%), Gaps = 6/220 (2%)

Query: 4   LRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           ++   L+K++GY F N   L +ALTH S +    ++ ERLEFLGD IL   I  +L++ F
Sbjct: 1   MQLERLQKKLGYQFHNLDYLIQALTHRSAA---TKNNERLEFLGDSILNFTIGKVLYDKF 57

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             + EGELS    +LV  +T + +AR+ DL  ++++     K       SI +D VE++I
Sbjct: 58  PKSNEGELSRMRATLVREQTLAIIARKFDLGDYLKLGPGELKSGGFRRESILSDCVEAII 117

Query: 124 AALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           AA+YLD  +  A   V+ ++    + +  G  ++D KT LQE+   +    PEY V    
Sbjct: 118 AAIYLDQDMAKAMEKVEDWYSDLLKDISPGDSQKDPKTRLQEFLQGRKLPLPEYDVLDIK 177

Query: 182 GPDHDPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVL 220
           G  H+  F V  ++  +     G+  S+R AEQ AA + L
Sbjct: 178 GEAHNQTFRVTCKVINVEEVFIGIGTSRRKAEQNAAEKAL 217


>gi|51892591|ref|YP_075282.1| ribonuclease III [Symbiobacterium thermophilum IAM 14863]
 gi|81388984|sp|Q67PF5|RNC_SYMTH RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|51856280|dbj|BAD40438.1| ribonuclease III [Symbiobacterium thermophilum IAM 14863]
          Length = 235

 Score =  115 bits (287), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 114/217 (52%), Gaps = 9/217 (4%)

Query: 13  IGYAFANRSLLEKALTHSSIS--HSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGE 70
           +GY F + SLL +ALTH++ +  H    + ERLEFLGD +LG++I+  L+  +    EGE
Sbjct: 18  LGYEFRDESLLLEALTHTTYANEHPRARANERLEFLGDSVLGMVIAAHLYERYPDLPEGE 77

Query: 71  LSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMT--SIQADVVESLIAALYL 128
           L+    ++V   + ++ AR L +   +R     R +  S     S  +D  E+++ ALYL
Sbjct: 78  LTKIRAAVVCEPSLAERARVLGIGRHMRFG---RGEAVSGRDRDSTLSDAFEAVVGALYL 134

Query: 129 DGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           DGG+E A  FV +   Q   A + G  R D KT+LQE    +    P+Y++    GP H 
Sbjct: 135 DGGLEAAQRFVLRELGQLVEAARQGLVRVDYKTQLQEQLQRQGAAAPQYRLLVEEGPAHL 194

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKRE 223
            RF V V   G     G   +K+ AEQ AA + L  E
Sbjct: 195 RRFQVGVYFEGRLLGTGWGRNKKEAEQEAARQALMPE 231


>gi|317491018|ref|ZP_07949454.1| ribonuclease III [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316920565|gb|EFV41888.1| ribonuclease III [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 226

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 123/225 (54%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L+K++GY F  + LL +ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPIVTNRLQKKLGYTFQQQELLLQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE DL   +R+     K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAEMAREFDLGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  +++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGIFLDSDIQTIERLILDWYRSRLDEISPGDKQKDPKTRLQEFLQGRHLPLPSYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SGL+ P  G+  S+R AEQ AA + LK+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGLSEPVIGVGSSRRKAEQAAAEQALKQ 222


>gi|90580325|ref|ZP_01236132.1| ribonuclease III [Vibrio angustum S14]
 gi|90438627|gb|EAS63811.1| ribonuclease III [Vibrio angustum S14]
          Length = 224

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 111/204 (54%), Gaps = 6/204 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L++++GY F N  L+  ALTH S + ++ E   RLEFLGD IL  +I+  L++ F S  E
Sbjct: 8   LQRKLGYQFNNCELMTLALTHRSANGTHNE---RLEFLGDSILSFVIADDLYHRFPSVDE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G++S    +LV  +T +++ RE +L   + +     K       SI AD VE++I A+YL
Sbjct: 65  GDMSRMRATLVRGKTLAELGREFELGDHLLLGPGELKSGGFRRDSILADCVEAIIGAIYL 124

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  +E   + V  ++K R   ++ G  ++D KT LQE    +    P Y VT   G  H+
Sbjct: 125 DSDVEQVRSIVLAWYKTRLDTIEPGINQKDPKTRLQECLQGRRLPLPAYTVTKVQGEAHN 184

Query: 187 PRFTVVVEISGL-APAQGMDCSKR 209
             FTV  +++GL  P  G   S+R
Sbjct: 185 QEFTVQCDVTGLDKPVIGKGGSRR 208


>gi|77416567|sp|Q7UGZ7|RNC_RHOBA RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
          Length = 266

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 119/213 (55%), Gaps = 9/213 (4%)

Query: 13  IGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELS 72
           +GY F +  LL  ALTH+S +     S ERLEFLGD +LGL +   LFN +    EG+L+
Sbjct: 41  LGYDFRDLDLLRSALTHASGASHRLASNERLEFLGDSVLGLTVCEWLFNEYPEYSEGDLT 100

Query: 73  VRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGI 132
              +++VS  +C +VA +L L   + V   + ++  S+  S+ +DV E++IAALY+DGG 
Sbjct: 101 KIKSAVVSRRSCGKVACKLGLDQCLIVGRGVTRNR-SYPKSLVSDVFEAVIAALYIDGGP 159

Query: 133 EVAGTFVDKYWKQRALK---SGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
           E+    + K W    +      +   + K+ LQ++A  +   TP YK+   +GPDH   F
Sbjct: 160 EIVRDRL-KLWLAEEVNLAVDTQGSGNHKSVLQQFAQRELSATPVYKLIRETGPDHRKMF 218

Query: 190 TV--VVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
            +  +V+    APA G +  K+ AEQ AAA  L
Sbjct: 219 LMGAMVDDRRFAPAWGNN--KKDAEQRAAANAL 249


>gi|320161647|ref|YP_004174872.1| ribonuclease III [Anaerolinea thermophila UNI-1]
 gi|319995501|dbj|BAJ64272.1| ribonuclease III [Anaerolinea thermophila UNI-1]
          Length = 237

 Score =  114 bits (286), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 121/220 (55%), Gaps = 5/220 (2%)

Query: 11  KRIGYAFANRSLLEKALTHSSISHSYQESYE---RLEFLGDRILGLLISTLLFNHFDSAK 67
            R+G +F +  LL +ALTH S  + + E+ E   RLEFLGD +L  ++   L+N +    
Sbjct: 15  NRLGLSFKSFFLLSRALTHRSYLNEHPEAIEDNERLEFLGDAVLDFVVGAWLYNRYPDMP 74

Query: 68  EGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALY 127
           EG+L+   + LVS E  S+ AR++DL   +R+     +       ++  D  E++I A+Y
Sbjct: 75  EGDLTRMRSVLVSTEQLSEFARKVDLGRALRLGKGETQAGGRDRPALLCDAFEAVIGAIY 134

Query: 128 LDGGIEVAGTFVDKYWKQRA--LKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           LD GIE    F++   ++ A  + + +   D K+ LQEWA  +    P Y V   SGP+H
Sbjct: 135 LDSGIEGVRRFIEPMLEKAADEILARQTIEDPKSMLQEWAQGQGFQAPRYIVRSSSGPEH 194

Query: 186 DPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
             +F V V I+G     G+  SK+AA + AAA+ LKR G+
Sbjct: 195 SKQFEVDVLINGQIYGSGIGSSKQAATKAAAADALKRLGL 234


>gi|302338403|ref|YP_003803609.1| ribonuclease III [Spirochaeta smaragdinae DSM 11293]
 gi|301635588|gb|ADK81015.1| ribonuclease III [Spirochaeta smaragdinae DSM 11293]
          Length = 244

 Score =  114 bits (286), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 114/214 (53%), Gaps = 5/214 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISH---SYQESYERLEFLGDRILGLLISTLLFNHFDS 65
            EK +G  F     L  A +H S ++   +  ++ E+LEFLGD +LGL++S  LF     
Sbjct: 20  FEKHVGIRFRKLEFLNLAFSHRSFANEQGTNVDNNEKLEFLGDSVLGLVVSEYLFALLPD 79

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
             EG+L+   + +VS ++ +++AR++ + ++I +             +I AD +E++I +
Sbjct: 80  KAEGDLARVKSFVVSEDSLAEIARKIKVDNYILIGKGEEYSGGRNKKAILADCMEAIIGS 139

Query: 126 LYLDGGIEVAGTFVDKYWKQRALK--SGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
            YLD G + A +FV KY      K    + ++D KT LQE+   +F   P Y +  ++GP
Sbjct: 140 FYLDSGFKAARSFVLKYLIPEINKVLENRHKKDYKTLLQEYVQKQFKSYPRYSLVKKTGP 199

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAA 217
           DHD  F + V+I G     G   +K+ AEQ AA 
Sbjct: 200 DHDRTFWIEVKIDGKVYGPGKGKNKKEAEQHAAG 233


>gi|238762797|ref|ZP_04623766.1| Ribonuclease 3 [Yersinia kristensenii ATCC 33638]
 gi|238699102|gb|EEP91850.1| Ribonuclease 3 [Yersinia kristensenii ATCC 33638]
          Length = 226

 Score =  114 bits (286), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 112/212 (52%), Gaps = 6/212 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F  + LL +ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPIVINRLQRKLGYTFQQQELLLQALTHRSASSKHNE---RLEFLGDSILSFVIANELY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE DL   +R+     K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAEMAREFDLGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I   G  +  +++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGIFLDSDIHTVGRLILDWYRSRLDEISPGDKQKDPKTRLQEYLQGRHLPLPSYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKR 209
              G  HD  FT+  ++SGL  P  G   S+R
Sbjct: 178 QVRGEAHDQEFTIHCQVSGLNEPVIGTGSSRR 209


>gi|32473407|ref|NP_866401.1| ribonuclease III [Rhodopirellula baltica SH 1]
 gi|32398087|emb|CAD78182.1| ribonuclease III [Rhodopirellula baltica SH 1]
          Length = 297

 Score =  114 bits (286), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 119/213 (55%), Gaps = 9/213 (4%)

Query: 13  IGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELS 72
           +GY F +  LL  ALTH+S +     S ERLEFLGD +LGL +   LFN +    EG+L+
Sbjct: 72  LGYDFRDLDLLRSALTHASGASHRLASNERLEFLGDSVLGLTVCEWLFNEYPEYSEGDLT 131

Query: 73  VRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGI 132
              +++VS  +C +VA +L L   + V   + ++  S+  S+ +DV E++IAALY+DGG 
Sbjct: 132 KIKSAVVSRRSCGKVACKLGLDQCLIVGRGVTRNR-SYPKSLVSDVFEAVIAALYIDGGP 190

Query: 133 EVAGTFVDKYWKQRALK---SGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
           E+    + K W    +      +   + K+ LQ++A  +   TP YK+   +GPDH   F
Sbjct: 191 EIVRDRL-KLWLAEEVNLAVDTQGSGNHKSVLQQFAQRELSATPVYKLIRETGPDHRKMF 249

Query: 190 TV--VVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
            +  +V+    APA G +  K+ AEQ AAA  L
Sbjct: 250 LMGAMVDDRRFAPAWGNN--KKDAEQRAAANAL 280


>gi|15601926|ref|NP_244998.1| ribonuclease III [Pasteurella multocida subsp. multocida str. Pm70]
 gi|13431826|sp|P57805|RNC_PASMU RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|12720269|gb|AAK02145.1| Rnc [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 225

 Score =  114 bits (286), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 112/217 (51%), Gaps = 8/217 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L+++IGY F   +LL++ALTH S +  + E   RLEFLGD IL  +I+  L++ F    E
Sbjct: 8   LQRQIGYQFNQPALLKQALTHRSAAVKHNE---RLEFLGDAILNFIIAEALYHQFPKCNE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           GELS    +LV   T + +AR+ +L  ++ +     K       SI AD VE++I A+ L
Sbjct: 65  GELSRMRATLVREPTLASLARQFELGDYLSLGPGELKSGGFRRESILADCVEAIIGAISL 124

Query: 129 DGGIEVAGTFVDKYWKQRALK---SGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDH 185
           D  +      V ++W Q  LK    G  ++D KT LQE+   K    P Y V    G  H
Sbjct: 125 DSDLATTTKIV-QHWYQAQLKQIQPGDNQKDPKTRLQEYLQGKRLPLPTYNVVEIKGEAH 183

Query: 186 DPRFTVVVEISGLAPA-QGMDCSKRAAEQVAAAEVLK 221
              FTV   +  +     G   S+R AEQ AA ++L+
Sbjct: 184 CQTFTVECYVKNIDRTFMGSGASRRKAEQAAAEKILQ 220


>gi|168188027|ref|ZP_02622662.1| ribonuclease III [Clostridium botulinum C str. Eklund]
 gi|169294133|gb|EDS76266.1| ribonuclease III [Clostridium botulinum C str. Eklund]
          Length = 237

 Score =  114 bits (286), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 79/220 (35%), Positives = 118/220 (53%), Gaps = 6/220 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQE--SYERLEFLGDRILGLLISTLLFNHFD 64
           + +E ++   F + ++L+ ALTHSS  +  +   S ERLEFLGD IL L IS LL+N + 
Sbjct: 10  NEVENKLKVKFNDINILDTALTHSSFINENKNINSNERLEFLGDSILQLCISELLYNKYK 69

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EG L+ +   +V   +  +VA++ ++  +I +S           TSI +D VE++IA
Sbjct: 70  DEPEGFLTKKRALIVCGNSLHEVAKKWNIGKYINMSKGEEMTGGRTRTSILSDCVEAIIA 129

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALK--SGKFRRDAKTELQEWAHAKFG-VTPEYKVTFRS 181
           ++YLD G EVA  F+ + + +   K  S +   D KT+LQE    KFG    EY +    
Sbjct: 130 SIYLDQGYEVAKNFILENFDEIIQKAHSNEIILDYKTKLQEIIQ-KFGEYNIEYTLISFE 188

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           GP H  +F   V +  L    G   SK+ +EQ AA E LK
Sbjct: 189 GPPHRRKFVTEVSVDSLVKGIGEGYSKKESEQNAAREALK 228


>gi|218885347|ref|YP_002434668.1| ribonuclease III [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|226735370|sp|B8DPB3|RNC_DESVM RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|218756301|gb|ACL07200.1| Ribonuclease III [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 230

 Score =  114 bits (286), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 77/221 (34%), Positives = 115/221 (52%), Gaps = 5/221 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYE---RLEFLGDRILGLLISTLLFNH 62
           +  L+  I YAF +  LL  A+THSS ++  QE  E   RLEFLGD +L L +S  LF  
Sbjct: 2   FEKLQSDIHYAFNDAGLLATAMTHSSWANEQQEHVEHNERLEFLGDAVLELCVSEELFAR 61

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           F  A+EG+L+     LVS    +++AR+L L  ++R+            +S+ +D +E++
Sbjct: 62  FPGAREGDLTRMRARLVSKPALAELARDLQLELYLRLGRGEESQGGRERSSLLSDALEAM 121

Query: 123 IAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFR 180
           + A++LDGG E A   V      R      GK  +D K+ LQE   + F   P Y +   
Sbjct: 122 LGAVFLDGGYERARAVVRHVLAARWPCDADGKRSKDYKSRLQELTQSLFRERPVYALMGS 181

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           SGP+H+ RF V + +        +  S + AEQ+AA   LK
Sbjct: 182 SGPEHEKRFEVRLTLPDGTVFTAIGPSVKRAEQMAAGLALK 222


>gi|294102050|ref|YP_003553908.1| ribonuclease III [Aminobacterium colombiense DSM 12261]
 gi|293617030|gb|ADE57184.1| ribonuclease III [Aminobacterium colombiense DSM 12261]
          Length = 240

 Score =  114 bits (286), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 116/222 (52%), Gaps = 5/222 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESY--ERLEFLGDRILGLLISTLLFNHFD 64
           ++ ++R+GY F+ + +L++ALTH+S +H     +  ERLEFLGD +L L++S  LFN + 
Sbjct: 17  ASFQERLGYLFSKKEILQEALTHASYAHEKGLHFHNERLEFLGDAVLELIVSANLFNGYP 76

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EG L+   ++LV     S   + + L   IR+   L +   S   SI AD  E+++ 
Sbjct: 77  DVDEGTLTRYRSNLVCKNALSVWGKSIGLPQIIRLGKGLEQQGAS--ASIIADTSEAVLG 134

Query: 125 ALYLDGGIEVAGTFVDKY-WKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           A++ DGG   A   V +Y + Q  + +     D K+ +QE    +    P Y V    GP
Sbjct: 135 AVFSDGGFAAAQNVVRRYLFFQSNINAYDKNSDPKSLIQEETQKRGLGQPCYVVISTEGP 194

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGI 225
            H P FTV ++I G     G   S + AE +AA   LK+ G+
Sbjct: 195 PHMPIFTVQLKIDGQLYGSGQGHSIKVAETLAAQRALKQVGL 236


>gi|269792704|ref|YP_003317608.1| ribonuclease III [Thermanaerovibrio acidaminovorans DSM 6589]
 gi|269100339|gb|ACZ19326.1| ribonuclease III [Thermanaerovibrio acidaminovorans DSM 6589]
          Length = 226

 Score =  114 bits (286), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 118/217 (54%), Gaps = 11/217 (5%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESY--ERLEFLGDRILGLLISTLLFNHFDSA 66
           L+ R+GY FA+  LL +ALTHSS ++  Q  Y  ERLEFLGD +LGL ++  L+    S 
Sbjct: 14  LQDRVGYRFADTQLLIEALTHSSFANQAQLGYCNERLEFLGDSVLGLCVAEELYRRHPSE 73

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           +EG L+   ++ VS+   ++  R L L   +RV   ++      M    AD +E+LI A+
Sbjct: 74  REGRLTKLKSTGVSSHNLARSGRVLGLDRVLRVGKAIKGGPSEGMV---ADAMEALIGAV 130

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVT-PEYKVTFRSGPDH 185
           YLDGG+E A   V ++    +L S    +D K+ LQE A  + G+  P Y++    GP+H
Sbjct: 131 YLDGGLEAARGIVSRHVSLDSLSS----QDPKSALQEMAQ-RLGIPLPSYRLVEVRGPEH 185

Query: 186 DPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
              F V V + G     G   S+R AE  AA+  L R
Sbjct: 186 RATFVVQVWLKGELMGVGNGGSRREAESKAASAALNR 222


>gi|167771632|ref|ZP_02443685.1| hypothetical protein ANACOL_03004 [Anaerotruncus colihominis DSM
           17241]
 gi|167666272|gb|EDS10402.1| hypothetical protein ANACOL_03004 [Anaerotruncus colihominis DSM
           17241]
          Length = 232

 Score =  114 bits (286), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 85/226 (37%), Positives = 119/226 (52%), Gaps = 13/226 (5%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQE---SYERLEFLGDRILGLLISTLLFNHF 63
           S LE RIGY F N   L+ ALTHSS ++  ++   S ER EFLGD +L +++S  LF+ +
Sbjct: 11  SALEGRIGYTFQNGRYLDIALTHSSYANEVKKNISSNERQEFLGDAVLSIVVSDYLFHTY 70

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             A EG+L+    +LV  ++  + ++ L L  F+++             SI AD  E+LI
Sbjct: 71  HLA-EGDLTKLRAALVCEKSLWEFSQALGLGDFLKLGRGEEMMGGRTRPSILADAFEALI 129

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKFR-RDAKTELQEWAHAKFGVTPEYKVTF--- 179
           AA+YLDGGIE A  FV  Y              D KT LQE         PE ++++   
Sbjct: 130 AAIYLDGGIEPARRFVLGYIVDALENRDDLAFSDYKTMLQEIIQK----NPEERLSYVLV 185

Query: 180 -RSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
             SGPDH+ +F V V ++      G   SK++AEQ AA E LK  G
Sbjct: 186 NESGPDHNKKFLVEVRLNSNVIGVGCGGSKKSAEQAAAREALKLMG 231


>gi|327538797|gb|EGF25444.1| ribonuclease III [Rhodopirellula baltica WH47]
          Length = 297

 Score =  114 bits (285), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 119/213 (55%), Gaps = 9/213 (4%)

Query: 13  IGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELS 72
           +GY F +  LL  ALTH+S +     S ERLEFLGD +LGL +   LFN +    EG+L+
Sbjct: 72  LGYDFRDLDLLRSALTHASGASHRLASNERLEFLGDSVLGLTVCEWLFNEYPEYSEGDLT 131

Query: 73  VRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGI 132
              +++VS  +C +VA +L L   + V   + ++  S+  S+ +DV E++IAALY+DGG 
Sbjct: 132 KIKSAVVSRRSCGKVACKLGLDQCLIVGRGVTRNR-SYPKSLVSDVFEAVIAALYIDGGP 190

Query: 133 EVAGTFVDKYWKQRALK---SGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
           E+    + K W    +      +   + K+ LQ++A  +   TP YK+   +GPDH   F
Sbjct: 191 EIVRDRL-KLWLAEEVNLAVDTQGSGNHKSVLQQFAQRELSATPVYKLIRETGPDHRKMF 249

Query: 190 TV--VVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
            +  +V+    APA G +  K+ AEQ AAA  L
Sbjct: 250 LMGAMVDDRRFAPAWGNN--KKDAEQRAAANAL 280


>gi|253682200|ref|ZP_04862997.1| ribonuclease III [Clostridium botulinum D str. 1873]
 gi|253561912|gb|EES91364.1| ribonuclease III [Clostridium botulinum D str. 1873]
          Length = 236

 Score =  114 bits (285), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 79/220 (35%), Positives = 115/220 (52%), Gaps = 6/220 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESY--ERLEFLGDRILGLLISTLLFNHFD 64
           + +E ++   F + +LL+ ALTHSS  +  +  Y  ERLEFLGD IL L IS  L+N ++
Sbjct: 10  NEVENKLNVKFNDINLLDTALTHSSFVNENKNIYSNERLEFLGDSILQLCISEFLYNKYE 69

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EG L+ +   +V   +  +VA+E ++  +I +S           TSI +D VE++IA
Sbjct: 70  QEPEGFLTKKRALIVCGNSLHEVAKEWNIGKYINMSKGEEMTGGRTRTSILSDCVEAIIA 129

Query: 125 ALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFG-VTPEYKVTFRS 181
           ++YLD G   A  F+   + +  +   S +   D KT+LQE    KFG    EYK+    
Sbjct: 130 SIYLDQGYATAKKFIIDNFNEIIQKANSDQIILDYKTKLQETIQ-KFGDYNIEYKLVSFD 188

Query: 182 GPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           GP H  +F   V I       G   SK+ AEQ AA E LK
Sbjct: 189 GPPHRRKFITEVLIDSEVKGVGEGYSKKEAEQNAAKEALK 228


>gi|258514469|ref|YP_003190691.1| ribonuclease III [Desulfotomaculum acetoxidans DSM 771]
 gi|257778174|gb|ACV62068.1| ribonuclease III [Desulfotomaculum acetoxidans DSM 771]
          Length = 259

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 113/214 (52%), Gaps = 6/214 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISH----SYQESYERLEFLGDRILGLLISTLLFNHFD 64
           L +++G A+ + +LL +ALTHSS  +    +   + +RLEFLGD +L LL+S  L++ + 
Sbjct: 11  LMQQVGVAWNDENLLWQALTHSSYVYESGSAAHTNNQRLEFLGDAVLELLVSGYLYSSYP 70

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EGEL+    ++V   + ++VAR+L+L   +R+     +       SI AD  E+L+ 
Sbjct: 71  ECAEGELTKLRAAIVCEPSLAKVARQLNLGYCLRMGKGEERSGGRERPSILADSFEALLG 130

Query: 125 ALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           A+YLD G+E    F  K+       +  G+  RD KTELQE    K      Y +    G
Sbjct: 131 AVYLDQGLEKTRMFALKFLAPVINDVLEGRVDRDYKTELQEMLQKKSPEPISYVILNEEG 190

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           PDH   FT  V   G+   QG   SK+ AEQ AA
Sbjct: 191 PDHQKLFTAGVVYCGIIIGQGTGRSKKEAEQQAA 224


>gi|153853253|ref|ZP_01994662.1| hypothetical protein DORLON_00647 [Dorea longicatena DSM 13814]
 gi|149754039|gb|EDM63970.1| hypothetical protein DORLON_00647 [Dorea longicatena DSM 13814]
          Length = 235

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 110/212 (51%), Gaps = 5/212 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLISTLLFNHFD 64
           LE +IGY F + +L  KA+ HSS ++       E  ERLEFLGD +L L+ S  LF++  
Sbjct: 12  LEGKIGYKFDDFTLFTKAMIHSSYANEKHLPKYECNERLEFLGDAVLELVSSEFLFHNNP 71

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EGEL+    S+V     +  AR+LDL  ++ +             S+ +D +E+LI 
Sbjct: 72  KLPEGELTKTRASMVCEPALAFCARDLDLGEYLLLGKGEDATGGRKRESVTSDAMEALIG 131

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           A+YLDGG   A  F+ ++   + L++ K   D+KT LQE   A F     Y +    GPD
Sbjct: 132 AIYLDGGFANAKEFIHRFI-LKDLENKKLFFDSKTILQEIVQANFKEVISYHLIGEEGPD 190

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           H+  F V V I       G   +K+AAEQ AA
Sbjct: 191 HNKIFRVAVHIGEEEYGVGEGRTKKAAEQEAA 222


>gi|156740401|ref|YP_001430530.1| ribonuclease III [Roseiflexus castenholzii DSM 13941]
 gi|254807896|sp|A7NGC5|RNC_ROSCS RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|156231729|gb|ABU56512.1| Ribonuclease III [Roseiflexus castenholzii DSM 13941]
          Length = 234

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 75/221 (33%), Positives = 115/221 (52%), Gaps = 8/221 (3%)

Query: 12  RIGYAFANRSLLEKALTHSSISHSYQE------SYERLEFLGDRILGLLISTLLFNHFDS 65
           R+   F+++ LL +ALTH S  +   +      S ERLEFLGD I+  L +TL+F  F  
Sbjct: 11  RLDVTFSDQRLLWQALTHRSFLNERVDERLSLFSNERLEFLGDAIVNFLATTLVFERFPD 70

Query: 66  AKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAA 125
           A EG L+    +L+  ET +  AR  DL S   ++            S+ AD  E+++AA
Sbjct: 71  AGEGYLTAWRAALIRTETLASFARRYDLGSHTLLARGEESSGARQRPSLLADTFEAVVAA 130

Query: 126 LYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGP 183
           +++D G++    F+   +++    L+      D K++LQ    A+ G+TP Y++  RSGP
Sbjct: 131 IFIDQGLDAVRKFLLPLFEETLATLQEQGLPVDYKSKLQARIQAERGITPRYRMIERSGP 190

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
           +H P FT        +   G   SK+AAEQ AA + L R G
Sbjct: 191 EHQPEFTFEALAGDESLGTGRGASKQAAEQDAARDALDRLG 231


>gi|330721516|gb|EGG99556.1| Ribonuclease III [gamma proteobacterium IMCC2047]
          Length = 210

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 109/208 (52%), Gaps = 8/208 (3%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L + +GY F + SLL+ ALTHSS    + E   RLEFLGD ILG +I+  LF  F  A
Sbjct: 6   AKLSQSLGYQFRDESLLQTALTHSSFGQGHNE---RLEFLGDSILGWVIADALFKRFPHA 62

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           +EG+LS     LV   T ++VAREL L  ++R+     K       SI AD  E++I A+
Sbjct: 63  REGQLSRLRAGLVKGVTLAKVARELQLGHYLRLGQGEMKSGGFRRDSILADAFEAIIGAI 122

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           +LD  I      +   +  R  A       +D KT LQE+  ++    P+Y++   SG D
Sbjct: 123 FLDSDIATCQQIILVLFAGRLDAQTLDDTLKDPKTRLQEFLQSRKQPLPDYRILSTSGKD 182

Query: 185 HDPRFTVVVEISGLA---PAQGMDCSKR 209
           H+  F V  E+  +A    A+G + + R
Sbjct: 183 HEQVFRVACEVESIAEPFEAEGTESTLR 210


>gi|239814409|ref|YP_002943319.1| ribonuclease III [Variovorax paradoxus S110]
 gi|259646554|sp|C5CSF5|RNC_VARPS RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|239800986|gb|ACS18053.1| ribonuclease III [Variovorax paradoxus S110]
          Length = 228

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 78/219 (35%), Positives = 116/219 (52%), Gaps = 6/219 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           + L++R+ ++F++  LL+ ALTH S S  + E   RLEFLGD +L L +S LL+    + 
Sbjct: 6   TALQERLKHSFSDTRLLQLALTHRSFSADHNE---RLEFLGDSVLNLAVSHLLYTRLSAL 62

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG+LS    +LV  +T  ++A EL L+  +R+     +       SI AD +E+LI A+
Sbjct: 63  PEGDLSRVRANLVKQDTLHRLALELQLSPLLRLGEGEARSGGPNRPSILADALEALIGAV 122

Query: 127 YLDGGIEVAGTFVDKYWKQRAL--KSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLD G   A   V + ++   +  +     +D KTELQEW        P Y+V    G  
Sbjct: 123 YLDAGFSAAEALVRRLYESVEINPRMDAVAKDPKTELQEWLQGHKMKLPVYRVAATLGAA 182

Query: 185 HDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
           H   F V  E+  L    +G+  S+RA EQ AAA +L R
Sbjct: 183 HKQTFDVECEVPELGLRERGIGGSRRAGEQAAAAAMLIR 221


>gi|325275444|ref|ZP_08141375.1| ribonuclease III [Pseudomonas sp. TJI-51]
 gi|324099420|gb|EGB97335.1| ribonuclease III [Pseudomonas sp. TJI-51]
          Length = 229

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 82/220 (37%), Positives = 113/220 (51%), Gaps = 6/220 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE+++GY F N+  +  ALTH S +     + ERLEFLGD IL  +    LF  F  A+E
Sbjct: 8   LERKLGYTFKNQDQMLLALTHRSYAG---RNNERLEFLGDAILNFVAGEALFERFPQARE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS     LV  ET +++AR  DL  ++R+ S   K       SI AD +E+LI A+YL
Sbjct: 65  GQLSRLRARLVKGETLARLARGFDLGEYLRLGSGELKSGGFRRESILADALEALIGAIYL 124

Query: 129 DGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  +E A   V  +       L      +D KT LQE+  ++    P Y+V    G  H 
Sbjct: 125 DADMETARERVLAWLANEFEGLTLVDTNKDPKTRLQEFLQSRSCELPRYEVVDIQGEPHC 184

Query: 187 PRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKREGI 225
             F V  E+  L   ++G   S+R AEQVAAA  L   G+
Sbjct: 185 RTFFVECEVVLLNNKSRGQGVSRRIAEQVAAASALIALGV 224


>gi|332799147|ref|YP_004460646.1| Ribonuclease 3 [Tepidanaerobacter sp. Re1]
 gi|332696882|gb|AEE91339.1| Ribonuclease 3 [Tepidanaerobacter sp. Re1]
          Length = 238

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 112/220 (50%), Gaps = 6/220 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHS----YQESYERLEFLGDRILGLLISTLLFNHFD 64
           L++ IG  F N + L +A  H S+++     YQE+ +RLEFLGD +L L IS  L+ H+D
Sbjct: 14  LQENIGIQFNNLNTLNQAFIHPSLTNEKEKPYQENNQRLEFLGDAVLELAISEYLYRHYD 73

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EG+++      V   + +Q+AR+L L  ++ +S            SI AD +E+LI 
Sbjct: 74  FLTEGQMTKIRAFTVCESSLAQIARQLFLGDYLILSKGEENTGGREKVSILADTLEALIG 133

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKS--GKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182
           A+Y+D   +    F+ K  +    K+  G++  D KT+LQE           Y V   SG
Sbjct: 134 AIYIDKNYKTTYDFIIKNLEAIIFKAIQGEWGTDYKTDLQELLQKFDEDKILYNVVNESG 193

Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           PDHD  F V V         G+  SK+ AEQ AA E L R
Sbjct: 194 PDHDKLFCVEVVWKNKILGTGIGKSKKQAEQNAAKEALDR 233


>gi|163750600|ref|ZP_02157837.1| ribonuclease III [Shewanella benthica KT99]
 gi|161329595|gb|EDQ00586.1| ribonuclease III [Shewanella benthica KT99]
          Length = 230

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 115/215 (53%), Gaps = 5/215 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L + +GY F  ++LL++ALTH S +  + E   RLEFLGD IL ++IS  L++ F    E
Sbjct: 15  LCRTLGYQFNQQALLDQALTHRSANSKHNE---RLEFLGDSILSIIISDALYHQFPKVTE 71

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV  +  +++  E  L  ++++     K       SI AD VE++I A+YL
Sbjct: 72  GDLSRMRATLVCGKMLAEIGFEFKLGDYLKLGPGELKSGGFRRESIIADGVEAIIGAIYL 131

Query: 129 DGGIEVAGTFVDKYWKQR-ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDP 187
           D   E     V  +++ R A+     ++D KT LQE         P YKVT   G  H  
Sbjct: 132 DADFETCRARVLSWYESRLAIIEPINQKDPKTLLQELLQGFKKPLPVYKVTDIKGEAHAQ 191

Query: 188 RFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLK 221
            FTV   +  L  P  G+  S+R AEQ+AAA+VL+
Sbjct: 192 TFTVECSVEELKKPLVGVASSRRKAEQIAAAKVLE 226


>gi|327479794|gb|AEA83104.1| ribonuclease III [Pseudomonas stutzeri DSM 4166]
          Length = 229

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 83/220 (37%), Positives = 116/220 (52%), Gaps = 6/220 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           LE+++GY F ++ L+  ALTH S +     + ERLEFLGD IL  +    LFNHF  A+E
Sbjct: 8   LERKLGYQFKDQELMLLALTHRSYA---GRNNERLEFLGDAILNFVAGEALFNHFPQARE 64

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS     LV  ET + +AR  +L   +R+ S   K       SI AD +E+LI A+YL
Sbjct: 65  GQLSRLRARLVKGETLAVLARGFELGDHLRLGSGELKSGGYRRESILADTLEALIGAIYL 124

Query: 129 DGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D G++VA   V  +     + L      +D KT LQE+  ++    P Y+V    G  H 
Sbjct: 125 DAGMDVARERVIAWLANELQGLTLVDTNKDPKTRLQEFLQSRACELPRYEVVDIQGEPHC 184

Query: 187 PRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKREGI 225
             F V  +++ L     G   S+R AEQVAAA  L   G+
Sbjct: 185 RTFFVECQVALLNDKTHGQGASRRIAEQVAAAAALIALGV 224


>gi|58700160|ref|ZP_00374668.1| ribonuclease III [Wolbachia endosymbiont of Drosophila ananassae]
 gi|58533321|gb|EAL57812.1| ribonuclease III [Wolbachia endosymbiont of Drosophila ananassae]
          Length = 183

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 96/178 (53%)

Query: 47  GDRILGLLISTLLFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKD 106
           GD +L +++S  LF  F   KEG L+ R   LV   T + VA+E+ L SFI +++  R +
Sbjct: 1   GDSVLNMVVSATLFKLFPEEKEGALAKRKTDLVCGNTIANVAKEIKLGSFIIMNNSERCN 60

Query: 107 VCSFMTSIQADVVESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAH 166
                     + +E+LI A+Y+DGG+E    F+ +YW++ A       +D KT LQEW  
Sbjct: 61  GGRCNLKNLENSLEALIGAIYIDGGLENVEKFIIQYWEKLAKGMLDPPQDPKTSLQEWTQ 120

Query: 167 AKFGVTPEYKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
                 PEY++  ++GP H+P FT+ V I           SK+ AEQ AA  +L++ G
Sbjct: 121 KNKLPLPEYELVKQTGPAHNPEFTISVCIEDYGKVSACASSKKIAEQKAAELMLEKIG 178


>gi|77457221|ref|YP_346726.1| ribonuclease III [Pseudomonas fluorescens Pf0-1]
 gi|90101638|sp|Q3KHL9|RNC_PSEPF RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|77381224|gb|ABA72737.1| ribonuclease III [Pseudomonas fluorescens Pf0-1]
          Length = 229

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 87/230 (37%), Positives = 122/230 (53%), Gaps = 22/230 (9%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           S LE+++GY F ++ L+  ALTH S +     + ERLEFLGD IL  +    LF+ F  A
Sbjct: 6   SRLERQLGYTFKDQELMVLALTHRSFAG---RNNERLEFLGDAILNFVAGEALFDRFPLA 62

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           +EG+LS     LV  ET + +AR  DL  ++R+ S   K       SI AD +E+LI A+
Sbjct: 63  REGQLSRLRARLVKGETLAVLARGFDLGDYLRLGSGELKSGGFRRESILADALEALIGAI 122

Query: 127 YLDGGIEVAGTFVDKYWKQRALK--SGKF--------RRDAKTELQEWAHAKFGVTPEYK 176
           YLD G+EVA        ++R L   +G+F         +D KT LQE+  ++    P Y+
Sbjct: 123 YLDAGMEVA--------RERVLAWLAGEFEGLTLVDTNKDPKTRLQEFLQSRGCELPRYE 174

Query: 177 VTFRSGPDHDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKREGI 225
           V    G  H   F V  E+  L   ++G   S+R AEQVAAA  L   G+
Sbjct: 175 VVDIQGEPHCRTFFVECEVVLLNEKSRGQGVSRRIAEQVAAAAALIALGV 224


>gi|332529447|ref|ZP_08405406.1| ribonuclease III [Hylemonella gracilis ATCC 19624]
 gi|332041093|gb|EGI77460.1| ribonuclease III [Hylemonella gracilis ATCC 19624]
          Length = 223

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 77/216 (35%), Positives = 116/216 (53%), Gaps = 6/216 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L+  +   F + +LL++ALTH S    + E   RLEFLGD +L L ++ LL+    +  E
Sbjct: 3   LQDHLQRPFTDAALLQRALTHRSFCADHNE---RLEFLGDSVLNLAVADLLYQRLHALPE 59

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV  ET  Q+A EL L+  +R+     +   +   SI AD +E+LI A+YL
Sbjct: 60  GDLSRIRANLVKQETLHQLAMELGLSDLLRLGEGELRSGGNKRPSILADALEALIGAVYL 119

Query: 129 DGGIEVAGTFVDKYWKQRAL--KSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D G   A   V   +++  +  +     +D KTELQEW  A+    P+Y+V   +G  H 
Sbjct: 120 DAGYAAAQALVHHLYEKVEVTPQMQASAKDPKTELQEWLQARKLKLPQYRVVATTGAAHR 179

Query: 187 PRFTVVVEISGLAPAQ-GMDCSKRAAEQVAAAEVLK 221
             F V  E+S     + G+  S+RA EQ AAA +L+
Sbjct: 180 QTFDVECEVSEFQLTERGIGGSRRAGEQAAAAAMLQ 215


>gi|294139709|ref|YP_003555687.1| ribonuclease III [Shewanella violacea DSS12]
 gi|293326178|dbj|BAJ00909.1| ribonuclease III [Shewanella violacea DSS12]
          Length = 225

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 115/215 (53%), Gaps = 5/215 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L + +GY F  ++ L++ALTH S S  + E   RLEFLGD IL ++IS  L++ F    E
Sbjct: 10  LCRTLGYQFTQQAHLDQALTHRSASSKHNE---RLEFLGDSILSIIISDALYHQFPKVTE 66

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G+LS    +LV  +  +++  E  L  ++++     K       SI AD VE++I A+YL
Sbjct: 67  GDLSRMRATLVCGKMLAEIGFEFKLGDYLKLGPGELKSGGFRRESIIADGVEAIIGAIYL 126

Query: 129 DGGIEVAGTFVDKYWKQR-ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDP 187
           D  +E     V  +++ R A+     ++D KT LQE         P YKVT   G  H  
Sbjct: 127 DADLETCRARVLSWYESRLAIIEPINQKDPKTLLQELLQGFKKPLPVYKVTDIKGEAHAQ 186

Query: 188 RFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLK 221
            FTV   +  L  P  G+  S+R AEQ+AAA+VL+
Sbjct: 187 TFTVECSVEELKKPLVGVASSRRKAEQIAAAQVLE 221


>gi|302386299|ref|YP_003822121.1| ribonuclease III [Clostridium saccharolyticum WM1]
 gi|302196927|gb|ADL04498.1| ribonuclease III [Clostridium saccharolyticum WM1]
          Length = 233

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 113/212 (53%), Gaps = 5/212 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLISTLLFNHFD 64
           LE+RIGY F++R L+ +A+THSS ++ ++    E  ERLEFLGD +L ++ S  L++ + 
Sbjct: 8   LEERIGYRFSDRHLMTQAMTHSSYANEHRLNKLECNERLEFLGDSVLEVVSSDCLYHKYP 67

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EG+L+    S+V   T +  A  + L  ++ +             SI +D +E+LI 
Sbjct: 68  EKPEGDLTKIRASIVCEPTLAYCAESIRLGEYLLLGKGEEATGGRGRASIVSDAMEALIG 127

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           A+YLDGG   A  F+ ++     L+  +   D+KT LQE    K      Y++    GPD
Sbjct: 128 AIYLDGGFANAKEFILRFI-MNDLEHKQLFYDSKTILQEIVQRKTDEPLSYELLREEGPD 186

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           H+  F   V I      QG   +K+AAEQVAA
Sbjct: 187 HNKVFEAQVLIGQEVIGQGTGRTKKAAEQVAA 218


>gi|329894313|ref|ZP_08270183.1| Ribonuclease III [gamma proteobacterium IMCC3088]
 gi|328923109|gb|EGG30432.1| Ribonuclease III [gamma proteobacterium IMCC3088]
          Length = 221

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 80/226 (35%), Positives = 119/226 (52%), Gaps = 14/226 (6%)

Query: 4   LRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHF 63
           ++ S L++ IGY F + SL+E AL H S+     ++ ERLEFLGD ++  +++  LF  +
Sbjct: 1   MQLSALQQAIGYQFKDLSLIELALAHRSVG---AKNNERLEFLGDSLVNHVVAEALFKRY 57

Query: 64  DSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLI 123
             A EGE+S R   LV  ET + +ARE +L  F+ +    RK       SI AD +E++ 
Sbjct: 58  PKAPEGEMSRRRAYLVKGETLAAIAREKNLGDFVELGQGERKSGGHRRKSILADALEAVA 117

Query: 124 AALYLDGGIEVAGTFVDKYWKQRALKSGKF--RRDAKTELQEWAHAKFGVTPEYKVTFRS 181
           AA+ LD   E A   V  +++ R      F   +DAKT LQEW   +    PEY +    
Sbjct: 118 AAILLDSDFETAKQVVFAWFRDRLNDETSFAASKDAKTSLQEWLQGRGLALPEYHLVATR 177

Query: 182 GPDHDPRFTVVVEISGLAPAQGMD-----CSKRAAEQVAAAEVLKR 222
           G DH   F V   +    P++G+       S+R AEQ +A ++L R
Sbjct: 178 GEDHQKVFVVECRV----PSKGLKETASASSRRRAEQTSAQQILDR 219


>gi|225850066|ref|YP_002730300.1| ribonuclease III [Persephonella marina EX-H1]
 gi|225645108|gb|ACO03294.1| ribonuclease III [Persephonella marina EX-H1]
          Length = 249

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/220 (33%), Positives = 115/220 (52%), Gaps = 8/220 (3%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSYQE---SYERLEFLGDRILGLLISTLLFN 61
           R   LE+++GY F +++L   ALTHSS +  Y +    YE LEFLGD +L L++S +L  
Sbjct: 12  RIKKLEQKLGYVFKDKNLPLTALTHSSFAAEYHKEIKDYEVLEFLGDAVLSLIVSEILIK 71

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVES 121
            F  A EGELS   ++++S    S++AR L L   + +S            S+  DV ES
Sbjct: 72  TFPEASEGELSQTRSAVISEAYLSRLARILGLNELVLLSRGEIAQKGMERESLLCDVFES 131

Query: 122 LIAALYLDG--GIEVAGTFVDKYWKQ---RALKSGKFRRDAKTELQEWAHAKFGVTPEYK 176
           +  A+Y+D    I++     ++++K     ++K G   RD K+ LQ      FGV P+Y 
Sbjct: 132 VFGAVYVDCDYDIKIPREIFNRFFKDYLIESIKKGNIPRDYKSILQIMTQRLFGVVPKYS 191

Query: 177 VTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           +    GP+H+  FT+   +  +    G   SK+ AE  AA
Sbjct: 192 MVSAEGPEHEKIFTMECSVDNVVRTFGTGKSKKEAETEAA 231


>gi|257468859|ref|ZP_05632953.1| ribonuclease III [Fusobacterium ulcerans ATCC 49185]
 gi|317063109|ref|ZP_07927594.1| ribonuclease III [Fusobacterium ulcerans ATCC 49185]
 gi|313688785|gb|EFS25620.1| ribonuclease III [Fusobacterium ulcerans ATCC 49185]
          Length = 235

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 70/229 (30%), Positives = 123/229 (53%), Gaps = 7/229 (3%)

Query: 5   RYSTLEKRIGYAFANRSLLEKALTHSSISHSY----QESYERLEFLGDRILGLLISTLLF 60
            Y  LE  +GY+F N+ LL+ +L H S  + +    + S ERLE LGD +L L+++  L+
Sbjct: 4   NYLELEGNLGYSFNNKELLKNSLIHRSFGNEHWRYKKISNERLELLGDAVLDLVVTEYLY 63

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
              +S+ EG+L+   + +VS    + +++++D+  ++ +S           +SI  D  E
Sbjct: 64  KSHESSTEGDLAKIKSMVVSEPVLASISKKMDVGKYLLLSKGEEMTGGRERSSILGDAFE 123

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKVT 178
           +++ A+YLD   E A  +   + +       K     D KT LQE++  ++ + P Y+V 
Sbjct: 124 AILGAIYLDSDFETAKKYALSHIQDSIDHVDKNEDILDFKTILQEYSQREYKIIPSYEVI 183

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIWT 227
             +GPDH   F + V+I G    +G   +K++AEQ AA E+ K+ G+ T
Sbjct: 184 RETGPDHQKIFEIEVKI-GDRTGRGTGKNKKSAEQSAAKELCKKLGVKT 231


>gi|223041196|ref|ZP_03611448.1| ribonuclease III [Campylobacter rectus RM3267]
 gi|222877555|gb|EEF12684.1| ribonuclease III [Campylobacter rectus RM3267]
          Length = 222

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/217 (33%), Positives = 113/217 (52%), Gaps = 6/217 (2%)

Query: 8   TLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAK 67
            LE+++GY F +  LL+ ALTH S+        ERLEFLGD ++ L+I   LF+ F    
Sbjct: 3   NLEEKLGYKFKDEKLLKTALTHKSVKGGANN--ERLEFLGDAVMDLVIGDYLFHKFSRLS 60

Query: 68  EGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALY 127
           EG+LS    +LV+ ++ +++A+ L+L   I +S     +      SI +D  E+L+ A+Y
Sbjct: 61  EGDLSKLRAALVNEKSFAELAKYLNLGQLINISPAEEHNGGRLKASILSDAFEALMGAIY 120

Query: 128 LDGGIEVAGTFVDKYWKQRALKSGKFRR---DAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           L+ G +       K + +R      F R   D KT LQE   A+F   P+Y +    GPD
Sbjct: 121 LESGFDAVRAASLKAF-ERCYPDINFDRMVKDYKTALQELTQARFAEIPKYVLVGSKGPD 179

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221
           H   F + + ++    ++    SK+ AEQ AA   L+
Sbjct: 180 HKKEFEIALMLNEREISRAAGKSKKEAEQKAAKTALE 216


>gi|239624036|ref|ZP_04667067.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239522067|gb|EEQ61933.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 235

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 116/212 (54%), Gaps = 5/212 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESY----ERLEFLGDRILGLLISTLLFNHFD 64
           LE+RI Y F ++SL  +ALTHSS ++ ++  +    ERLEFLGD +L ++ S  L++ + 
Sbjct: 8   LEERIDYQFKDQSLFSQALTHSSYANEHRLDHSRCNERLEFLGDAVLEIVTSDFLYHKYA 67

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
           +  EG+L+    S+V   T +  A ++ L  ++ +             S+ +D +E+LI 
Sbjct: 68  TLPEGDLTKIRASIVCEPTLAYCAGDIRLGEYLFLGKGEDATGGRGRNSVVSDAMEALIG 127

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           A+YLDGG   A  F+ ++     ++  +   D+KT LQE   ++      Y++    GPD
Sbjct: 128 AIYLDGGFANAKEFIHRFILND-IEHKQLFYDSKTILQEMVQSRQAEALSYEILREEGPD 186

Query: 185 HDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           H+  F V  +I      +GM  +K+AAEQVAA
Sbjct: 187 HNKSFEVCAKIGDAEIGRGMGRTKKAAEQVAA 218


>gi|217967335|ref|YP_002352841.1| Ribonuclease III [Dictyoglomus turgidum DSM 6724]
 gi|217336434|gb|ACK42227.1| Ribonuclease III [Dictyoglomus turgidum DSM 6724]
          Length = 238

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 115/210 (54%), Gaps = 5/210 (2%)

Query: 16  AFANRSLLEKALTHSSISH---SYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELS 72
           +F ++ LL +ALTH S  H   ++++  +RLEFLGD +L ++I+ +LF  +  A EG L+
Sbjct: 25  SFNDKDLLIEALTHPSFKHENPNFKQDNQRLEFLGDAVLNMIITEILFQRYREASEGFLT 84

Query: 73  VRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGI 132
            +   LV  ET  + A+ LDL   I +     K       SI +D+ E+ I ALYLD G 
Sbjct: 85  QKRIYLVKEETLYKKAKSLDLGELILLGVGEEKQGGRDKISILSDLFEAFIGALYLDKGY 144

Query: 133 EVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVV 192
           E    FV++ +K+  ++S +   D K  LQ +   K G  P+Y V+   GP+HD  F V 
Sbjct: 145 EYTKNFVEEIFKE-EIESIEMEVDWKNLLQTYLQ-KEGKKPQYIVSREVGPEHDKTFYVE 202

Query: 193 VEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
           + I     ++G   +KR AE  AA + L++
Sbjct: 203 LWIDDEKISEGEGKNKREAEIKAAQKALEK 232


>gi|242280465|ref|YP_002992594.1| ribonuclease III [Desulfovibrio salexigens DSM 2638]
 gi|242123359|gb|ACS81055.1| ribonuclease III [Desulfovibrio salexigens DSM 2638]
          Length = 234

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/220 (33%), Positives = 117/220 (53%), Gaps = 5/220 (2%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYE---RLEFLGDRILGLLISTLLFNH 62
           +S L++ I Y F+    L  ALTHSS ++   E  E   RLEFLGD +L L ++  LF  
Sbjct: 5   FSRLQQGIHYRFSQVKHLATALTHSSWANEQPEPVEDNERLEFLGDAVLELCVTEELFKR 64

Query: 63  FDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESL 122
           F  A EG+L+   + LV  ++ + +ARELD+  F+++            +S+ AD +E++
Sbjct: 65  FKGAHEGQLTKIRSKLVKEKSLATIARELDINDFLKLGRGEEAQGGRNRSSLLADAMEAV 124

Query: 123 IAALYLDGGIEVAGTFVDKYWKQRALKSGKFR--RDAKTELQEWAHAKFGVTPEYKVTFR 180
           I A++LDGG   A  F+ + +  +   + K    +D K++LQE   A+F   P Y +T  
Sbjct: 125 IGAVFLDGGYAEAQKFIMRIFANKWPATFKIESSKDFKSKLQEVTQARFKERPTYVLTGT 184

Query: 181 SGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220
            GP+H+  F V + +           S + AEQ AAA+ L
Sbjct: 185 KGPEHEKIFMVNLNLPDGKSFDSEGSSLKKAEQTAAAKAL 224


>gi|257791118|ref|YP_003181724.1| ribonuclease III [Eggerthella lenta DSM 2243]
 gi|317488154|ref|ZP_07946728.1| ribonuclease III [Eggerthella sp. 1_3_56FAA]
 gi|257475015|gb|ACV55335.1| ribonuclease III [Eggerthella lenta DSM 2243]
 gi|316912741|gb|EFV34276.1| ribonuclease III [Eggerthella sp. 1_3_56FAA]
          Length = 281

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 81/215 (37%), Positives = 109/215 (50%), Gaps = 4/215 (1%)

Query: 13  IGYAFANRSLLEKALTHSSISH--SYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGE 70
           +GY FA+  LL  A+TH S +   S + SYERLEFLGD ILG +++T+ F+ F    EG 
Sbjct: 18  LGYRFADEQLLLSAITHPSATEGKSVKYSYERLEFLGDSILGAIVATIAFDRFHDLDEGG 77

Query: 71  LSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDG 130
           L+    +LVS  + S VA  L  A  I   S         + S   +V E+++AAL+LDG
Sbjct: 78  LTRIKVALVSGASLSDVAERLGFADVIVFGSSETGTGRRGLHSALENVYEAVVAALFLDG 137

Query: 131 GIEVAGTFVDKYWKQR-ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
           GIE A  FV      R +    +   + K+ LQE      G+TP YK+    GP HD  F
Sbjct: 138 GIEAAEGFVRATLIPRMSADMAREPENPKSALQEKLQED-GITPTYKLVETQGPPHDRTF 196

Query: 190 TVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
              V       A+G   +K+ AE  AA   L R G
Sbjct: 197 VAQVFAGSQGLARGTGRTKKEAESQAAKSTLARLG 231


>gi|237748853|ref|ZP_04579333.1| ribonuclease III [Oxalobacter formigenes OXCC13]
 gi|229380215|gb|EEO30306.1| ribonuclease III [Oxalobacter formigenes OXCC13]
          Length = 277

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 114/223 (51%), Gaps = 6/223 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           ++ +  + L++RIGY+F    LL+ ALTH S S  + E   RLEFLGD +L  + +  L+
Sbjct: 9   IAMMNVNVLQERIGYSFRQIDLLQTALTHRSFSSHHNE---RLEFLGDSLLNCVTAINLY 65

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             +    EG LS   +SLV  +   ++A++LD++SF+R+     K       SI AD +E
Sbjct: 66  ERYVELNEGNLSRLRSSLVRQQALYEIAQKLDMSSFLRLGEGELKAGGFKRPSILADAME 125

Query: 121 SLIAALYLDGGIEVAGTFVDKYWK--QRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +L  A++LD   E     + + +    + L    F +DAKT+LQE+        PEY+V 
Sbjct: 126 ALFGAIFLDSDFETVRRVITQLFTDMMKGLDPETFGKDAKTQLQEYLQGHKLALPEYQVV 185

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVL 220
              G  H+  F +   I        G   S+RA EQ AA + L
Sbjct: 186 ATHGAAHNQEFEIECTIGKFGIHVFGTGSSRRAGEQEAAQKAL 228


>gi|327470651|gb|EGF16107.1| ribonuclease III [Streptococcus sanguinis SK330]
          Length = 232

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 77/229 (33%), Positives = 118/229 (51%), Gaps = 8/229 (3%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLIS 56
           M  L+ + LE +    F++ +LLE A TH+S ++ ++       ERLEFLGD +L L+IS
Sbjct: 1   MENLKKALLE-QFDLVFSDETLLETAFTHTSYANEHRLLKISHNERLEFLGDAVLQLIIS 59

Query: 57  TLLFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA 116
             L+  +    EG+LS   + +V  E+ +  AR+     FI++     K       +I  
Sbjct: 60  EYLYTKYPKRPEGDLSKLRSMIVREESLAGFARDCQFDQFIKLGRGEEKSGGRNRDTILG 119

Query: 117 DVVESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPE 174
           D+ E+ + AL LD G+E   +F+ +    + +++G F R  D KT+LQE       V   
Sbjct: 120 DLFEAFLGALLLDKGVEAVKSFLYQVMIPK-VEAGDFERVTDYKTKLQELLQINGDVEIA 178

Query: 175 YKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKRE 223
           Y+V   +GP H   F V V I+G    QG   SK+ AEQ AA    K+E
Sbjct: 179 YQVVSETGPAHAKNFEVAVLINGCKSGQGQGRSKKLAEQEAAKNAFKKE 227


>gi|187251071|ref|YP_001875553.1| ribonuclease III [Elusimicrobium minutum Pei191]
 gi|186971231|gb|ACC98216.1| Ribonuclease III [Elusimicrobium minutum Pei191]
          Length = 221

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/216 (32%), Positives = 117/216 (54%), Gaps = 4/216 (1%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHFDSA 66
           +E+ + Y+F N+ L+ +ALTH S +   +  +  ERLEFLGD +LGL+ +  +++ +   
Sbjct: 5   IEQVLDYSFKNKELIREALTHKSFTGERRSVKHNERLEFLGDSVLGLVAAEYIYSKYPEV 64

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           +EG LS   + LVS       A ELDL +++ + +           SI ++ +E+++ A+
Sbjct: 65  EEGVLSKIKSGLVSRHNLYLWASELDLGAYLALGAGEAATGGRTRESILSNAMEAVLGAV 124

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           YLDGG E     ++K+   ++L   +   D K+ LQE    K+   PEY+V    GP+H+
Sbjct: 125 YLDGGFESVKNIINKWISTQSLT--EVSSDYKSTLQEIVQKKYKSVPEYEVIQTVGPEHE 182

Query: 187 PRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222
             FTVVV        +G   +K+ AEQ AA   L+ 
Sbjct: 183 KIFTVVVSSLKKELGRGRGKNKKLAEQDAAKNALEN 218


>gi|315221419|ref|ZP_07863340.1| ribonuclease III [Streptococcus anginosus F0211]
 gi|315189538|gb|EFU23232.1| ribonuclease III [Streptococcus anginosus F0211]
          Length = 232

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 113/224 (50%), Gaps = 7/224 (3%)

Query: 6   YSTLEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLISTLLFN 61
           +  L ++ G  F +  LLE A TH+S ++ ++       ERLEFLGD +L LLIS  L+ 
Sbjct: 5   HKVLSQQFGIVFQDEKLLETAFTHTSYANEHRLLNISHNERLEFLGDAVLQLLISEYLYK 64

Query: 62  HFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVES 121
            +    EG+LS   +++V  E+ +  +R+     FI++     K       +I  D+ E+
Sbjct: 65  KYPKKPEGDLSKLRSTIVREESLAGFSRDCQFDQFIKLGRGEEKSGGRNRDTILGDLFEA 124

Query: 122 LIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEWAHAKFGVTPEYKVTF 179
            + AL LD G+E    F+ +    + ++ G F +  D KT+LQE       V   Y+VT 
Sbjct: 125 FLGALLLDKGVEAVKNFLYQVMIPK-VEVGDFEQVIDYKTKLQELLQVNGDVEIVYQVTS 183

Query: 180 RSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKRE 223
            SGP H   F V V + G    QG   SK+ AEQ AA    ++E
Sbjct: 184 ESGPAHAKEFAVAVSVDGRTVGQGQGRSKKLAEQEAAKNAFEKE 227


>gi|40063418|gb|AAR38229.1| ribonuclease III [uncultured marine bacterium 580]
          Length = 231

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 78/223 (34%), Positives = 113/223 (50%), Gaps = 6/223 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M       LEK I Y F +  LL  A+TH S  HS   + ERLEFLGD IL  +++ LLF
Sbjct: 1   METKELKILEKSIKYKFKDDKLLALAMTHRS--HSGMNN-ERLEFLGDSILNFVVADLLF 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
             F+   EG+LS   + LV  E  S++  EL +  F+ +     K       SI AD  E
Sbjct: 58  KKFNDLDEGDLSRLRSQLVKEEPLSKLGNELKIGDFLNLGVGELKSSGWRRPSILADAFE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI A+++DGG++ A  F++  +      +   +  +D KT LQE+  A+    P Y+V 
Sbjct: 118 ALIGAIFIDGGMKSAYKFIEDSYADLIEKINPKEIYKDPKTILQEFLQAQKVPLPSYEVI 177

Query: 179 FRSGPDHDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVL 220
              G  H+  FTV   +S      +G   S++ AEQ AA E +
Sbjct: 178 NVEGEAHNQLFTVTCVVSKFDVKVEGGGRSRKIAEQEAAKEAM 220


>gi|325830746|ref|ZP_08164130.1| ribonuclease III [Eggerthella sp. HGA1]
 gi|325487153|gb|EGC89596.1| ribonuclease III [Eggerthella sp. HGA1]
          Length = 304

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 81/215 (37%), Positives = 109/215 (50%), Gaps = 4/215 (1%)

Query: 13  IGYAFANRSLLEKALTHSSISH--SYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGE 70
           +GY FA+  LL  A+TH S +   S + SYERLEFLGD ILG +++T+ F+ F    EG 
Sbjct: 41  LGYRFADEQLLLSAITHPSATEGKSVKYSYERLEFLGDSILGAIVATIAFDRFHDLDEGG 100

Query: 71  LSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDG 130
           L+    +LVS  + S VA  L  A  I   S         + S   +V E+++AAL+LDG
Sbjct: 101 LTRIKVALVSGASLSDVAERLGFADVIVFGSSETGTGRRGLHSALENVYEAVVAALFLDG 160

Query: 131 GIEVAGTFVDKYWKQR-ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189
           GIE A  FV      R +    +   + K+ LQE      G+TP YK+    GP HD  F
Sbjct: 161 GIEAAEGFVRATLIPRMSADMAREPENPKSALQEKLQED-GITPTYKLVETQGPPHDRTF 219

Query: 190 TVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREG 224
              V       A+G   +K+ AE  AA   L R G
Sbjct: 220 VAQVFAGSQGLARGTGRTKKEAESQAAKSTLARLG 254


>gi|269127639|ref|YP_003301009.1| ribonuclease III [Thermomonospora curvata DSM 43183]
 gi|268312597|gb|ACY98971.1| ribonuclease III [Thermomonospora curvata DSM 43183]
          Length = 268

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 114/213 (53%), Gaps = 8/213 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ--ESYERLEFLGDRILGLLISTLLFNHFDSA 66
           LE+ +G +  +R LLE+ALTH S ++      + ERLEFLGD +LGL+++  LF +    
Sbjct: 29  LERALGVSI-SRELLERALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTLFRNHPDL 87

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
            EG+L+    ++V+    + VAR L   ++IR+            TSI AD +E+LI A+
Sbjct: 88  PEGQLAKLRAAVVNMRALAGVARSLGAGAYIRLGRGEEGTGGRDKTSILADTLEALIGAV 147

Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRR--DAKTELQEW-AHAKFGVTPEYKVTFRSGP 183
           YL+ G++ A   V + +     KS       D KT LQE  A  + GV PEY V   SGP
Sbjct: 148 YLEHGLDEAAKLVHRLFDSLIDKSASLGAGLDWKTSLQELTAEEELGV-PEYHVA-ESGP 205

Query: 184 DHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216
           DH   F   V + G+    G   SK+ AEQ AA
Sbjct: 206 DHQKTFRATVRVGGVTYGSGEGRSKKEAEQRAA 238


>gi|89075088|ref|ZP_01161529.1| ribonuclease III [Photobacterium sp. SKA34]
 gi|89049175|gb|EAR54740.1| ribonuclease III [Photobacterium sp. SKA34]
          Length = 239

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 110/204 (53%), Gaps = 6/204 (2%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKE 68
           L++++GY F N  L+  ALTH S + ++ E   RLEFLGD IL  +++  L++ F S  E
Sbjct: 23  LQRKLGYQFNNCELMTLALTHRSANGTHNE---RLEFLGDSILSFVVADDLYHRFPSVDE 79

Query: 69  GELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYL 128
           G++S    +LV  +T +++ RE +L   + +     K       SI AD VE++I A+YL
Sbjct: 80  GDMSRMRATLVRGKTLAELGREFELGDHLLLGPGELKSGGFRRDSILADCVEAIIGAIYL 139

Query: 129 DGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHD 186
           D  +E     V  ++K R   ++ G  ++D KT LQE    +    P Y VT   G  H+
Sbjct: 140 DSDVEQVRRIVLAWYKTRLDTIEPGINQKDPKTRLQECLQGRRLPLPAYTVTKVQGEAHN 199

Query: 187 PRFTVVVEISGL-APAQGMDCSKR 209
             FTV  +++GL  P  G   S+R
Sbjct: 200 QEFTVQCDVTGLDKPVIGKGGSRR 223


>gi|70728453|ref|YP_258202.1| ribonuclease III [Pseudomonas fluorescens Pf-5]
 gi|68342752|gb|AAY90358.1| ribonuclease III [Pseudomonas fluorescens Pf-5]
          Length = 225

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 84/222 (37%), Positives = 118/222 (53%), Gaps = 6/222 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           S LE+++GY+F ++ L+  ALTH S +     + ERLEFLGD IL  +    LF  F  A
Sbjct: 2   SRLERQLGYSFKDQELMLLALTHRSFAG---RNNERLEFLGDAILNFVAGEALFERFPQA 58

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           +EG+LS     LV  ET + +AR  DL  ++R+ S   K       SI AD +E+LI A+
Sbjct: 59  REGQLSRLRARLVKGETLAVLARGFDLGEYLRLGSGELKSGGFRRESILADALEALIGAI 118

Query: 127 YLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLD G+E A   V  +      +L      +D KT LQE+  ++    P Y+V    G  
Sbjct: 119 YLDAGMETARDRVLSWLASEFESLTLVDTNKDPKTRLQEFLQSRACELPRYEVVDIQGEP 178

Query: 185 HDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKREGI 225
           H   F V  E++ L   ++G   S+R AEQVAAA  L   G+
Sbjct: 179 HCRTFFVECEVTLLNEKSRGQGVSRRIAEQVAAAAALIALGV 220


>gi|66047178|ref|YP_237019.1| ribonuclease III [Pseudomonas syringae pv. syringae B728a]
 gi|257486563|ref|ZP_05640604.1| ribonuclease III [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|289628144|ref|ZP_06461098.1| ribonuclease III [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289649890|ref|ZP_06481233.1| ribonuclease III [Pseudomonas syringae pv. aesculi str. 2250]
 gi|289676656|ref|ZP_06497546.1| ribonuclease III [Pseudomonas syringae pv. syringae FF5]
 gi|298488677|ref|ZP_07006706.1| Ribonuclease III [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|302186917|ref|ZP_07263590.1| ribonuclease III [Pseudomonas syringae pv. syringae 642]
 gi|75500898|sp|Q4ZPE1|RNC_PSEU2 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|63257885|gb|AAY38981.1| Ribonuclease III [Pseudomonas syringae pv. syringae B728a]
 gi|298156750|gb|EFH97841.1| Ribonuclease III [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|330871241|gb|EGH05950.1| ribonuclease III [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330898515|gb|EGH29934.1| ribonuclease III [Pseudomonas syringae pv. japonica str. M301072PT]
 gi|330950056|gb|EGH50316.1| ribonuclease III [Pseudomonas syringae Cit 7]
 gi|330973032|gb|EGH73098.1| ribonuclease III [Pseudomonas syringae pv. aceris str. M302273PT]
 gi|330989032|gb|EGH87135.1| ribonuclease III [Pseudomonas syringae pv. lachrymans str. M301315]
 gi|331010046|gb|EGH90102.1| ribonuclease III [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 229

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 117/222 (52%), Gaps = 6/222 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           S LE+++GY F ++ L+  ALTH S +     + ERLEFLGD IL  +    LF  F  A
Sbjct: 6   SRLERQLGYTFKDQELMVLALTHRSFAGR---NNERLEFLGDAILNFVAGEALFERFPQA 62

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           +EG+LS     LV  ET + +AR  DL  ++R+ S   K       SI AD +E+LI A+
Sbjct: 63  REGQLSRLRARLVKGETLALLARGFDLGEYLRLGSGELKSGGFRRESILADALEALIGAI 122

Query: 127 YLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLD G+E A   V  +      +L      +D KT LQE+  ++    P Y+V    G  
Sbjct: 123 YLDAGMEAARERVLAWLTTEFDSLTLVDTNKDPKTRLQEFLQSRACELPRYEVVDIQGEP 182

Query: 185 HDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKREGI 225
           H   F V  EI+ L   ++G   S+R AEQVAAA  L   G+
Sbjct: 183 HCRTFFVECEINLLNEKSRGQGVSRRIAEQVAAAAALIALGV 224


>gi|291539668|emb|CBL12779.1| RNAse III [Roseburia intestinalis XB6B4]
          Length = 228

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 111/213 (52%), Gaps = 7/213 (3%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSIS---HSYQES-YERLEFLGDRILGLLIS 56
           MS L+   L+ RIGY F    LL +ALTHSS +   H  + S  ERLEFLGD +L ++ S
Sbjct: 1   MSKLQ--ELQNRIGYTFEKEGLLRQALTHSSYANEKHMKKHSDNERLEFLGDAVLEIVSS 58

Query: 57  TLLFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQA 116
             L+ ++    EG+L+    S+V   T +   RE+DL  ++ +     +       SI +
Sbjct: 59  DFLYRNYPDLPEGDLTKLRASIVCEPTLALCTREMDLGDYLLLGKGENQTGGRKRKSILS 118

Query: 117 DVVESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYK 176
           D +ES+I A+YLDGG E A  F+ K+     ++  K   D+KT LQE     +  +  Y+
Sbjct: 119 DALESVIGAIYLDGGFEPAKKFIHKFI-LTDIEHKKLFYDSKTILQEVVQGNYKESLHYE 177

Query: 177 VTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKR 209
           +    GPDHD +F+V   I       G   +K+
Sbjct: 178 LISEEGPDHDKQFSVEARIGDKVIGSGTGHTKK 210


>gi|90101636|sp|Q4KHT1|RNC_PSEF5 RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
          Length = 229

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 84/222 (37%), Positives = 118/222 (53%), Gaps = 6/222 (2%)

Query: 7   STLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66
           S LE+++GY+F ++ L+  ALTH S +     + ERLEFLGD IL  +    LF  F  A
Sbjct: 6   SRLERQLGYSFKDQELMLLALTHRSFAG---RNNERLEFLGDAILNFVAGEALFERFPQA 62

Query: 67  KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126
           +EG+LS     LV  ET + +AR  DL  ++R+ S   K       SI AD +E+LI A+
Sbjct: 63  REGQLSRLRARLVKGETLAVLARGFDLGEYLRLGSGELKSGGFRRESILADALEALIGAI 122

Query: 127 YLDGGIEVAGTFVDKYWKQ--RALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPD 184
           YLD G+E A   V  +      +L      +D KT LQE+  ++    P Y+V    G  
Sbjct: 123 YLDAGMETARDRVLSWLASEFESLTLVDTNKDPKTRLQEFLQSRACELPRYEVVDIQGEP 182

Query: 185 HDPRFTVVVEISGL-APAQGMDCSKRAAEQVAAAEVLKREGI 225
           H   F V  E++ L   ++G   S+R AEQVAAA  L   G+
Sbjct: 183 HCRTFFVECEVTLLNEKSRGQGVSRRIAEQVAAAAALIALGV 224


>gi|295109853|emb|CBL23806.1| RNAse III [Ruminococcus obeum A2-162]
          Length = 223

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/187 (39%), Positives = 101/187 (54%), Gaps = 7/187 (3%)

Query: 9   LEKRIGYAFANRSLLEKALTHSSISHSYQ----ESYERLEFLGDRILGLLISTLLFNHFD 64
           LE+ IGY F N+ LL++ALTHSS ++  +       ERLEFLGD +L L+ S  L+  F 
Sbjct: 4   LEQIIGYTFQNKKLLKQALTHSSYANEKKLGKLGCNERLEFLGDAVLELISSDFLYRKFS 63

Query: 65  SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124
              EGEL+ +  SLV   + +  ARE  L  F+ +             SI +D  E+L+ 
Sbjct: 64  QIPEGELTKKRASLVCEPSLAYCAREFGLPEFLLLGKGENMTGGRNRDSIVSDATEALLG 123

Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTP-EYKVTFRSGP 183
           A+YLDGG   A  FV  +     ++  +   D+KT LQE    K G+ P EY +T   GP
Sbjct: 124 AIYLDGGFSNAKKFVLNFI-LNDIEHKQLFYDSKTILQELVQEK-GLQPIEYVLTGEDGP 181

Query: 184 DHDPRFT 190
           DHD RFT
Sbjct: 182 DHDKRFT 188


>gi|270265300|ref|ZP_06193561.1| ribonuclease 3 [Serratia odorifera 4Rx13]
 gi|270040704|gb|EFA13807.1| ribonuclease 3 [Serratia odorifera 4Rx13]
          Length = 226

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 80/225 (35%), Positives = 122/225 (54%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F  + LL +ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPIVINRLQRKLGYTFQQQELLLQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE DL   +R+     K       SI AD VE
Sbjct: 58  HRFPRVDEGDMSRMRATLVRGNTLAEMAREFDLGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I+     +  +++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGVFLDSDIQNVERLILDWYRSRLDEISPGDKQKDPKTRLQEFLQGRHLPLPSYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLA-PAQGMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SGL+ P  G   S+R AEQ AA + LK+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAAAEQALKK 222


>gi|50122200|ref|YP_051367.1| ribonuclease III [Pectobacterium atrosepticum SCRI1043]
 gi|81644286|sp|Q6D219|RNC_ERWCT RecName: Full=Ribonuclease 3; AltName: Full=Ribonuclease III;
           Short=RNase III
 gi|49612726|emb|CAG76176.1| ribonuclease III [Pectobacterium atrosepticum SCRI1043]
          Length = 226

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 119/225 (52%), Gaps = 6/225 (2%)

Query: 1   MSALRYSTLEKRIGYAFANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLF 60
           M+ +  + L++++GY F    LL +ALTH S S  + E   RLEFLGD IL  +I+  L+
Sbjct: 1   MNPILINRLQRKLGYTFQQYELLLQALTHRSASSKHNE---RLEFLGDSILSFVIANALY 57

Query: 61  NHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVE 120
           + F    EG++S    +LV   T +++ARE +L   +R+     K       SI AD VE
Sbjct: 58  DRFPKVDEGDMSRMRATLVRGNTLAEIAREFELGECLRLGPGELKSGGFRRESILADTVE 117

Query: 121 SLIAALYLDGGIEVAGTFVDKYWKQR--ALKSGKFRRDAKTELQEWAHAKFGVTPEYKVT 178
           +LI  ++LD  I      +  +++ R   +  G  ++D KT LQE+   +    P Y V 
Sbjct: 118 ALIGGIFLDSDILNIERLILNWYQTRLDEISPGDKQKDPKTRLQEFLQGRHLPLPTYLVV 177

Query: 179 FRSGPDHDPRFTVVVEISGLAPAQ-GMDCSKRAAEQVAAAEVLKR 222
              G  HD  FT+  ++SG + +  G   S+R AEQ AA + LK+
Sbjct: 178 QVRGEAHDQEFTIHCQVSGFSESVIGTGSSRRKAEQAAAEQALKK 222


>gi|15595967|ref|NP_249461.1| ribonuclease III [Pseudomonas aeruginosa PAO1]
 gi|107100231|ref|ZP_01364149.1| hypothetical protein PaerPA_01001254 [Pseudomonas aeruginosa PACS2]
 gi|116048686|ref|YP_792514.1| ribonuclease III [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218893287|ref|YP_002442156.1| ribonuclease III [Pseudomonas aeruginosa LESB58]
 gi|254239132|ref|ZP_04932455.1| ribonuclease III [Pseudomonas aeruginosa C3719]
 gi|254245025|ref|ZP_04938347.1| ribonuclease III [Pseudomonas aeruginosa 2192]
 gi|296390880|ref|ZP_06880355.1| ribonuclease III [Pseudomonas aeruginosa PAb1]
 gi|313105592|ref|ZP_07791858.1| ribonuclease III [Pseudomonas aeruginosa 39016]
 gi|7531195|sp|Q9XCX9|RNC_PSEAE RecName: Full=Ribonuclease 3; Al