RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780940|ref|YP_003065353.1| ribonuclease III [Candidatus Liberibacter asiaticus str. psy62] (227 letters) >gnl|CDD|30916 COG0571, Rnc, dsRNA-specific ribonuclease [Transcription]. Length = 235 Score = 221 bits (564), Expect = 1e-58 Identities = 93/224 (41%), Positives = 129/224 (57%), Gaps = 4/224 (1%) Query: 7 STLEKRIGYAFANRSLLEKALTHSSIS--HSYQESYERLEFLGDRILGLLISTLLFNHFD 64 LEK++GY F ++ LLE+ALTH S + H E+ ERLEFLGD +LGL+++ LF + Sbjct: 9 EALEKKLGYTFKDKELLEQALTHRSYANEHKAVENNERLEFLGDAVLGLVVAEYLFKKYP 68 Query: 65 SAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIA 124 + EGELS +LVS E+ +++AREL L ++R+ K SI AD E+LI Sbjct: 69 NLPEGELSKLRAALVSEESLAEIARELGLGDYLRLGKGEEKSGGRRRESILADAFEALIG 128 Query: 125 ALYLDGGIEVAGTFVDKYWKQRALKSGKFR--RDAKTELQEWAHAKFGVTPEYKVTFRSG 182 A+YLD G+E A F+ K + R + +D KT LQE A+ V PEY++ G Sbjct: 129 AIYLDSGLEAARKFILKLFLPRLEEIDAGDQFKDPKTRLQELLQAQGLVLPEYRLVKEEG 188 Query: 183 PDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKREGIW 226 P HD FTV V + G G SK+ AEQ AA + LK+ G+ Sbjct: 189 PAHDKEFTVEVAVGGKELGTGKGRSKKEAEQAAAEQALKKLGVK 232 >gnl|CDD|29697 cd00593, RIBOc, RIBOc. Ribonuclease III C terminal domain. This group consists of eukaryotic, bacterial and archeal ribonuclease III (RNAse III) proteins. RNAse III is a double stranded RNA-specific endonuclease. Prokaryotic RNAse III is important in post-transcriptional control of mRNA stability and translational efficiency. It is involved in the processing of ribosomal RNA precursors. Prokaryotic RNAse III also plays a role in the maturation of tRNA precursors and in the processing of phage and plasmid transcripts. Eukaryotic RNase III's participate (through direct cleavage) in rRNA processing, in processing of small nucleolar RNAs (snoRNAs) and snRNA's (components of the spliceosome). In eukaryotes RNase III or RNaseIII like enzymes such as Dicer are involved in RNAi (RNA interference) and miRNA (micro-RNA) gene silencing.. Length = 133 Score = 124 bits (313), Expect = 2e-29 Identities = 52/127 (40%), Positives = 74/127 (58%), Gaps = 1/127 (0%) Query: 21 SLLEKALTHSSIS-HSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELSVRFNSLV 79 SLL +ALTH S + + + ERLEFLGD +L L+++ LF F EG+L+ ++LV Sbjct: 1 SLLLEALTHPSYANEHGRFNNERLEFLGDAVLELVVTEYLFKKFPDLSEGDLTRLRSALV 60 Query: 80 SAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIEVAGTFV 139 S ET +++AREL L ++R+ K I ADV E+LI A+YLDGG E A F+ Sbjct: 61 SNETLARLARELGLGKYLRLGKGEEKSGGRLRPKILADVFEALIGAIYLDGGFEAARKFL 120 Query: 140 DKYWKQR 146 + Sbjct: 121 LRLLGPL 127 >gnl|CDD|37028 KOG1817, KOG1817, KOG1817, Ribonuclease [RNA processing and modification]. Length = 533 Score = 113 bits (285), Expect = 3e-26 Identities = 73/224 (32%), Positives = 111/224 (49%), Gaps = 13/224 (5%) Query: 9 LEKRIGYAFANRSLLEKALTHSSI--SHSYQESYERLEFLGDRILGLLISTLLFNHFDSA 66 E+ IG F + LL +A T SI +H +RLEFLGD IL L+++ +L+ F Sbjct: 278 FEEIIGIVFIHIRLLARAFTLRSIPFNHLTLGHNQRLEFLGDSILQLVMTEILYRKFPDH 337 Query: 67 KEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAAL 126 EG LS+ +SLVS ET ++VA +L ++ +++ KD + AD+ E+ I AL Sbjct: 338 HEGHLSLLRSSLVSNETQAKVADDLGFHEYL-ITNFDLKDFQNLKLKDYADLFEAFIGAL 396 Query: 127 YLDGGIEVAGTFVDKYWKQRALKSGKFRR---DAKTELQEWAHA------KFGVTPEYKV 177 Y+D G+E F+ + R LK + D K++LQ+ P YKV Sbjct: 397 YVDKGLEYCRQFLRVLFFPR-LKEFIRNQDWNDPKSKLQQCCLTLRYSLGGEPDIPLYKV 455 Query: 178 TFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLK 221 GP +D + V V G A G+ + + AE AA + L+ Sbjct: 456 LGAKGPANDRNYKVAVYFKGKRLATGVGSNIKQAEMRAAMQALE 499 Score = 48.1 bits (114), Expect = 2e-06 Identities = 48/182 (26%), Positives = 72/182 (39%), Gaps = 55/182 (30%) Query: 9 LEKRIGYAFANRSLLEKALTHSSISHSY-----------------QESY----------- 40 LE+ IGY F +R LL+ ALTH S +Y Q Y Sbjct: 46 LEELIGYTFQDRCLLQLALTHPSHKLNYGTNPDHAKNSLTNCGIRQPKYGDRKEHIMTKR 105 Query: 41 ---------------------------ERLEFLGDRILGLLISTLLFNHFDSAKEGELSV 73 ERLEFLGD ++ LL S L+ F +EG L+ Sbjct: 106 KLGINTLINIMKRLGVIQPTHSVIKHNERLEFLGDAVVELLSSNHLYFMFPRLEEGGLAT 165 Query: 74 RFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLDGGIE 133 ++V +++A++L F+ + + + A+ E++I A YLDGG+ Sbjct: 166 YRTAIVQNRHLAKLAKKLRKDEFLLYAHGYDLCFETELKHAMANCFEAVIGAKYLDGGLV 225 Query: 134 VA 135 VA Sbjct: 226 VA 227 >gnl|CDD|144289 pfam00636, Ribonuclease_3, RNase3 domain. Length = 96 Score = 97.0 bits (242), Expect = 4e-21 Identities = 40/96 (41%), Positives = 57/96 (59%), Gaps = 5/96 (5%) Query: 41 ERLEFLGDRILGLLISTLLFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVS 100 ERLEFLGD +L L++S L+ + EGEL+ ++LVS ET +++AR+L L +IR Sbjct: 1 ERLEFLGDAVLELIVSEYLYEKYPDLSEGELTRLRSALVSNETLAKLARKLGLDKYIRRG 60 Query: 101 SDLRKDV-----CSFMTSIQADVVESLIAALYLDGG 131 + S + ADV E+LI A+YLDGG Sbjct: 61 RNALSKGEKAKSASLSPKVLADVFEALIGAIYLDGG 96 >gnl|CDD|28930 cd00048, DSRM, Double-stranded RNA binding motif. Binding is not sequence specific but is highly specific for double stranded RNA. Found in a variety of proteins including dsRNA dependent protein kinase PKR, RNA helicases, Drosophila staufen protein, E. coli RNase III, RNases H1, and dsRNA dependent adenosine deaminases.. Length = 68 Score = 76.6 bits (188), Expect = 6e-15 Identities = 27/66 (40%), Positives = 37/66 (56%) Query: 156 DAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVA 215 + K+ LQE A + PEY++ GPDH PRFTV V + G +G SK+ A+Q A Sbjct: 1 NPKSLLQELAQKRGKPLPEYELVEEEGPDHAPRFTVEVTVGGKITGEGEGSSKKEAKQNA 60 Query: 216 AAEVLK 221 A L+ Sbjct: 61 AEAALR 66 >gnl|CDD|143824 pfam00035, dsrm, Double-stranded RNA binding motif. Putative motif shared by proteins that bind to dsRNA. At least some DSRM proteins seem to bind to specific RNA targets. Exemplified by Staufen, which is involved in localisation of at least five different mRNAs in the early Drosophila embryo. Also by interferon-induced protein kinase in humans, which is part of the cellular response to dsRNA. Length = 66 Score = 68.5 bits (168), Expect = 2e-12 Identities = 25/65 (38%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Query: 157 AKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAA 216 K+ LQE K G P Y+ GP H P FTV V + G G SK+ A+Q+AA Sbjct: 1 PKSLLQELCQ-KKGKKPPYEYVEEEGPSHSPTFTVTVTVGGKKYGTGTGSSKKEAKQLAA 59 Query: 217 AEVLK 221 + L+ Sbjct: 60 EKALQ 64 >gnl|CDD|35920 KOG0701, KOG0701, KOG0701, dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification]. Length = 1606 Score = 52.3 bits (125), Expect = 1e-07 Identities = 37/109 (33%), Positives = 52/109 (47%), Gaps = 5/109 (4%) Query: 21 SLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHFDSAKEGELSVRFNSLVS 80 SLL +ALT SS S S ERLE LGD +L L +S LF + EG+LS + VS Sbjct: 1006 SLLLEALTTSSCQDS--FSLERLELLGDSLLKLAVSRHLFLTYPDLDEGQLSRLRDVNVS 1063 Query: 81 AETCSQVARELDLASFIRVSSDLRKDVCSFMTSIQADVVESLIAALYLD 129 + +++A + L S++R + + Q DV L D Sbjct: 1064 NDNLARLAVKKGLYSYLRHEGF---EPSRWWVPGQLDVNNVDCKDLSGD 1109 Score = 41.9 bits (98), Expect = 1e-04 Identities = 43/141 (30%), Positives = 59/141 (41%), Gaps = 13/141 (9%) Query: 6 YSTLEKRIGYA--FANRSLLEKALTHSSISHSYQESYERLEFLGDRILGLLISTLLFNHF 63 LE+ +G F +LL +A H S+ ++ ERLEFLGD +L L F F Sbjct: 1213 LDRLERELGLKFKFLEAALLVQAFIHCSLRAEGLDATERLEFLGDAVLDKLSDKHPFEVF 1272 Query: 64 DSAKEGELSVRFNSLVS--AETCSQVARELDLASFIRVSSD-LRKDVCSFMTSIQADVVE 120 GEL+ + V+ E V L + S L K + AD VE Sbjct: 1273 IRLDGGELTDLREAGVNTLNENDLNVKVPKSLPYNLLDQSSVLEKSI--------ADSVE 1324 Query: 121 SLIAALYLDGGIEVAGTFVDK 141 +LI A +GG A F+D Sbjct: 1325 ALIGASLSEGGPSSALLFMDW 1345 Score = 40.0 bits (93), Expect = 5e-04 Identities = 42/158 (26%), Positives = 71/158 (44%), Gaps = 23/158 (14%) Query: 9 LEKRIGYAFANRSLLEKALTHSSISHSYQES-YERLEFLGDRILGLLISTLLFNHFDSAK 67 E+++ Y F + L +A TH+S ++ Y+RLEFLGD +L LI+ L+ Sbjct: 1374 FEEKLNYRFKLKPYLTQATTHASYIYNRITDCYQRLEFLGDAVLDYLITKHLYEDPRQHS 1433 Query: 68 EGELSVRFNSLVSAETCSQVARELDLASFIR-------------VSSDLRKDVCSFM--- 111 G L+ ++LV+ + +A + DL FI VS L+ ++ S Sbjct: 1434 PGVLTDLRSALVNNTIFASLAVKADLHKFIIAASPGLIHNIDRFVSFQLQSNLDSLFGWE 1493 Query: 112 -----TSIQADVVESLIAALYLDGGIEVAGTFVDKYWK 144 D+ ES+ A+ LD G + ++K+W Sbjct: 1494 EDIEVPKALGDIFESIAGAIKLDSGN-MMEPCIEKFWA 1530 >gnl|CDD|38936 KOG3732, KOG3732, KOG3732, Staufen and related double-stranded-RNA-binding proteins [Intracellular trafficking, secretion, and vesicular transport, Transcription]. Length = 339 Score = 40.4 bits (94), Expect = 4e-04 Identities = 24/61 (39%), Positives = 32/61 (52%), Gaps = 2/61 (3%) Query: 161 LQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVL 220 LQE+ + G+TP Y+V GP H P F V + G A G SK+ A+ AA +L Sbjct: 44 LQEYG-LRRGLTPVYEVLREEGPPHMPNFVFRVTV-GEITATGEGKSKKLAKHRAAEALL 101 Query: 221 K 221 K Sbjct: 102 K 102 Score = 36.2 bits (83), Expect = 0.008 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Query: 159 TELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAE 218 LQE A AK PEY++ SG H F + + +G SK+ A++ AA Sbjct: 146 GRLQELAQAKKWKLPEYELVQESGVPHRREFVIQCSVENFT-EEGKGPSKKIAKRNAAEA 204 Query: 219 VLKREG 224 +L+ G Sbjct: 205 MLESLG 210 >gnl|CDD|144925 pfam01510, Amidase_2, N-acetylmuramoyl-L-alanine amidase. This family includes zinc amidases that have N-acetylmuramoyl-L-alanine amidase activity EC:3.5.1.28. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls (preferentially: D-lactyl-L-Ala). The structure is known for the bacteriophage T7 structure and shows that two of the conserved histidines are zinc binding. Length = 126 Score = 28.5 bits (64), Expect = 1.7 Identities = 15/61 (24%), Positives = 23/61 (37%), Gaps = 10/61 (16%) Query: 131 GIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTF---RSGPDHDP 187 GIE+ G D L++ L W ++G+ P+Y + SG DP Sbjct: 71 GIELCGDGGDVTPTDAQLEALA-------ALLAWLCRRYGIPPDYTIVGHREVSGTHCDP 123 Query: 188 R 188 Sbjct: 124 G 124 >gnl|CDD|37988 KOG2777, KOG2777, KOG2777, tRNA-specific adenosine deaminase 1 [RNA processing and modification]. Length = 542 Score = 28.4 bits (63), Expect = 1.9 Identities = 9/25 (36%), Positives = 15/25 (60%) Query: 173 PEYKVTFRSGPDHDPRFTVVVEISG 197 +Y + ++GP H P F VE++G Sbjct: 10 LQYNLVSQTGPVHAPLFPFSVEVNG 34 Score = 28.0 bits (62), Expect = 2.3 Identities = 12/56 (21%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Query: 169 FGVTPEYKVTFRSGPDHDPRFTVVVEISGL---APAQGMDCSKRAAEQVAAAEVLK 221 + SGP H P+F + V + G + +K+ A A + K Sbjct: 99 LANGLFFDFVNESGPQHAPKFVMSVVVDGRWFEGGGRSKKEAKQEAAMAALQVLFK 154 >gnl|CDD|88571 cd05131, RasGAP_IQGAP2, IQGAP2 is a member of the IQGAP family that contains a calponin-homology (CH) domain which binds F-actin, IQGAP-specific repeat, a single WW domain, four IQ motifs which mediate interactions with calmodulin, and a Ras-GTPase-activating protein (GAP)-related domain that binds Rho family GTPases. IQGAP2 and IQGAP3 play important roles in the regulation of the cytoskeleton for axon outgrowth in hippocampal neurons and are thought to stay in a common regulatory pathway. The results of RNA interference studies indicated that IQGAP3 partially compensates functions of IQGAP2, but has lesser ability than IQGAP2 to promote axon outgrowth in hippocampal neuron. Morevover, IQGAP2 is required for the cadherin-mediated cell-to-cell adhesion in Xenopus laevis embryos.. Length = 339 Score = 27.7 bits (61), Expect = 2.5 Identities = 11/35 (31%), Positives = 21/35 (60%) Query: 24 EKALTHSSISHSYQESYERLEFLGDRILGLLISTL 58 E+AL H + + S + L + D++LG ++S+L Sbjct: 107 EQALLHPEVRAKLESSIQVLRSVTDKVLGSIMSSL 141 >gnl|CDD|37906 KOG2695, KOG2695, KOG2695, WD40 repeat protein [General function prediction only]. Length = 425 Score = 27.3 bits (60), Expect = 3.2 Identities = 12/49 (24%), Positives = 16/49 (32%) Query: 141 KYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRF 189 K + RA K K + + A+ V E F G D R Sbjct: 324 KLYDLRATKCKKSVMQYEGHVNLSAYLPAHVKEEEGSIFSVGDDCYTRI 372 >gnl|CDD|37118 KOG1907, KOG1907, KOG1907, Phosphoribosylformylglycinamidine synthase [Nucleotide transport and metabolism]. Length = 1320 Score = 26.9 bits (59), Expect = 4.7 Identities = 10/64 (15%), Positives = 24/64 (37%), Gaps = 4/64 (6%) Query: 137 TFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSGPDHDPRFTVVVEIS 196 + + + W+ + + K + + + E K P+Y + + H + +S Sbjct: 1000 SDLREEWELTSYELQKLQDNPECAEVERECIKDNYDPQYDLYYNPAFIH----NEQLFLS 1055 Query: 197 GLAP 200 AP Sbjct: 1056 STAP 1059 >gnl|CDD|146630 pfam04097, Nic96, Nup93/Nic96. Nup93/Nic96 is a component of the nuclear pore complex. It is required for the correct assembly of the nuclear pore complex. In Saccharomyces cerevisiae, Nic96 has been shown to be involved in the distribution and cellular concentration of the GTPase Gsp1. The structure of Nic96 has revealed a mostly alpha helical structure. Length = 602 Score = 26.5 bits (59), Expect = 6.0 Identities = 12/48 (25%), Positives = 17/48 (35%), Gaps = 9/48 (18%) Query: 149 KSGKFRRDAKTELQEWAHAKFGVTP---------EYKVTFRSGPDHDP 187 RD T L+ +A + P EY R+ P+ DP Sbjct: 129 GFKSVDRDFPTYLKAYATSPDRRLPPELEDKLHLEYNQRLRNSPEGDP 176 >gnl|CDD|36416 KOG1202, KOG1202, KOG1202, Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism]. Length = 2376 Score = 26.5 bits (58), Expect = 6.2 Identities = 27/104 (25%), Positives = 42/104 (40%), Gaps = 20/104 (19%) Query: 123 IAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQEWAHAKFGVTPEYKVTFRSG 182 + Y DG + T + YW+ +++ T L + A A G++ E + R Sbjct: 594 LGCGYADGCLTQEQTVLAAYWRGQSIL--------DTHLPKGAMAAVGLSWE-QCKSRCP 644 Query: 183 PD-----HDPRFTVVVEISGLAPAQGMD--CSKRAAEQVAAAEV 219 PD H+ + V ISG P + + AE V A EV Sbjct: 645 PDVVPACHNSKDNVT--ISG--PQASVFAFVEQLRAEGVFAKEV 684 >gnl|CDD|38973 KOG3769, KOG3769, KOG3769, Ribonuclease III domain proteins [Translation, ribosomal structure and biogenesis]. Length = 333 Score = 26.1 bits (57), Expect = 7.3 Identities = 48/236 (20%), Positives = 86/236 (36%), Gaps = 21/236 (8%) Query: 7 STLEKRIGYAFANRSLLEKALTHSSISHSY-----------------QESYERLEFLGDR 49 S KR+ + S L KALT+ S S+ Q S E L +G + Sbjct: 66 SAFGKRLQSEEISLSYLLKALTNLSFSYPEKVLRQQLGAETVAQVNPQYSNEELVEIGKQ 125 Query: 50 ILGLLISTLLFNHFDSAKEGELSVRFNSLVSAETCSQVARELDLASFIRVSSDLRKDVCS 109 L ++ L + E L N L+ E + +A L + S + K Sbjct: 126 FLSFYVTEYLKCKYPRLPEEGLHAIVNGLLGEEVLAHIATHLGIEELGL-SEEFPKVGEI 184 Query: 110 FMTSIQADVVESLIAALYLDGGIEVAGTFVDKYWKQRALKSGK-FRRDAKTELQEWAHAK 168 + +L+ ++ L+ G F++ + L + ++ L + Sbjct: 185 SQDESSRRAIGALLGSVGLEKGFNFVRDFINDQILSKDLDPREMWQLQWPRRLLSRLCKR 244 Query: 169 FGVT-PEYKVTFRSGPDH-DPRFTVVVEISGLAPAQGMDCSKRAAEQVAAAEVLKR 222 G+ PE ++ SG + +P + V + QG S + AE+ AA + L + Sbjct: 245 RGLKEPESRLLAESGRNSAEPVYVVGIYSGKKLLGQGQGESLKLAEEQAARDALIK 300 >gnl|CDD|143908 pfam00136, DNA_pol_B, DNA polymerase family B. This region of DNA polymerase B appears to consist of more than one structural domain, possibly including elongation, DNA-binding and dNTP binding activities. Length = 458 Score = 26.1 bits (58), Expect = 7.3 Identities = 14/78 (17%), Positives = 26/78 (33%), Gaps = 6/78 (7%) Query: 104 RKDVCSFMTSIQADVVESLIAALYLDGGIEVAGTFVDKYWKQRALKSGKFRRDAKTELQE 163 R+D C F+ + V++ L+ ++ + + K K L++ Sbjct: 288 RRDWCEFVKEVIRKVLDLLLKDKDVEDAAPSLKIVIIEILK----SLTDKLVQNKVPLED 343 Query: 164 WAHAKFGVTP--EYKVTF 179 K P EYK Sbjct: 344 LVITKELSKPPSEYKKKN 361 >gnl|CDD|32398 COG2216, KdpB, High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism]. Length = 681 Score = 25.9 bits (57), Expect = 9.8 Identities = 16/59 (27%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Query: 50 ILGLLISTLLFNHFDSA-KEGELSVRFNSLVSAETCSQVARELDLASFIRV-SSDLRKD 106 I +L T+LF +F A EG + +SL +T + S V +++L+K Sbjct: 68 ITIILWFTVLFANFAEAVAEGRGKAQADSLRKTKTETIARLLRADGSIEMVPATELKKG 126 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.132 0.377 Gapped Lambda K H 0.267 0.0737 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,582,372 Number of extensions: 128410 Number of successful extensions: 323 Number of sequences better than 10.0: 1 Number of HSP's gapped: 315 Number of HSP's successfully gapped: 28 Length of query: 227 Length of database: 6,263,737 Length adjustment: 90 Effective length of query: 137 Effective length of database: 4,318,927 Effective search space: 591692999 Effective search space used: 591692999 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 56 (25.3 bits)