HHsearch alignment for GI: 254780941 and conserved domain: PRK00007

>PRK00007 elongation factor G; Reviewed.
Probab=99.61  E-value=1.4e-14  Score=114.25  Aligned_cols=110  Identities=19%  Similarity=0.243  Sum_probs=83.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCEEEECCCCC------CEEE----------EEE--E-EEE-ECCEEEEEEECCCCHHH
Q ss_conf             89983389986889999986892021058888------6021----------278--9-997-39948999987984010
Q gi|254780941|r   24 CVALVGATNAGKSTLVNRFVGAKVSIVTHKVQ------TTRS----------IVR--G-IVS-EKESQIVFLDTPGIFNA   83 (311)
Q Consensus        24 ~VaivG~pN~GKSTL~N~l~g~~vsivS~k~~------TTr~----------~i~--g-i~~-~~~~qiifvDTPG~~~~   83 (311)
T Consensus        12 Ni~IiaHvd~GKTTL~e~lL~~s--g~i~~~G~v~~g~t~~D~~~~E~eRgITI~s~~~s~~~~~~~~iNlIDTPGHvD-   88 (693)
T PRK00007         12 NIGIMAHIDAGKTTTTERILFYT--GVSHKIGEVHDGAATMDWMEQEQERGITITSAATTCFWKDGHRINIIDTPGHVD-   88 (693)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHC--CCCCCCCEECCCCCCCCCCHHHHHCCCCEEECEEEEEECCCEEEEEEECCCCCC-
T ss_conf             99999169999899999999966--984658424389855678288997698873222548826973899991979752-


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHCCHHHHHHHHHHCCCCCEEEEEECCCH
Q ss_conf             123575321002345555321001100001000000012234544287202578721101
Q gi|254780941|r   84 KDSYHKLMIRLSWSTIKHADIVCLVVDSHRELKVNIHDLLKEIAKRSSRLILILNKIDCV  143 (311)
Q Consensus        84 ~~~l~~~~~~~~~~~l~~aDiil~VvDa~~~~~~~~~~il~~l~~~~~p~IiVlNKiDlv  143 (311)
T Consensus        89 -------F~~Ev~~aLrv~DgAvlVvDav~GV~~qT~~v~r~a~~~~lp~i~fINK~Dr~  141 (693)
T PRK00007         89 -------FTIEVERSLRVLDGAVAVFCAVGGVEPQSETVWRQADKYKVPRIVFVNKMDRT  141 (693)
T ss_pred             -------HHHHHHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             -------48999999998586899998898877779999999987598969999797789