HHsearch alignment for GI: 254780941 and conserved domain: PRK00454

>PRK00454 engB GTPase EngB; Reviewed.
Probab=100.00  E-value=1.5e-36  Score=256.36  Aligned_cols=161  Identities=20%  Similarity=0.281  Sum_probs=126.6

Q ss_pred             EEEEEECCCCCCHHHHHHHHHCCC-EEEECCCCCCEEEEEEEEEEECCEEEEEEECCCCH------HHCCCCCCCCCCHH
Q ss_conf             189983389986889999986892-02105888860212789997399489999879840------10123575321002
Q gi|254780941|r   23 GCVALVGATNAGKSTLVNRFVGAK-VSIVTHKVQTTRSIVRGIVSEKESQIVFLDTPGIF------NAKDSYHKLMIRLS   95 (311)
Q Consensus        23 g~VaivG~pN~GKSTL~N~l~g~~-vsivS~k~~TTr~~i~gi~~~~~~qiifvDTPG~~------~~~~~l~~~~~~~~   95 (311)
T Consensus        25 p~VaivGrpNvGKSTL~N~L~g~k~~a~vs~~pgtTr~i~---~~~~~~~~~lvDtpGyG~a~~~~~~~~~~~~-~i~~y  100 (196)
T PRK00454         25 PEIAFAGRSNVGKSSLINALTNRKNLARTSKTPGRTQLIN---FFEVNDGLRLVDLPGYGYAKVSKEEKEKWQK-LIEEY  100 (196)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEEECCCCCEEEEE---EEECCCCEEEEECCCCCCCCCCHHHHHHHHH-HHHHH
T ss_conf             6899984898889999999868973699747888607988---8761883389937997413277878889999-99999


Q ss_pred             HHHHHHHHHHCCCCHHHHHHHCCHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHH----HHHHHCCCCCCCCCCCCCC
Q ss_conf             345555321001100001000000012234544287202578721101043457888----8641001233431100013
Q gi|254780941|r   96 WSTIKHADIVCLVVDSHRELKVNIHDLLKEIAKRSSRLILILNKIDCVKPERLLEQA----EIANKLVFIEKTFMVSATK  171 (311)
Q Consensus        96 ~~~l~~aDiil~VvDa~~~~~~~~~~il~~l~~~~~p~IiVlNKiDlv~~~~l~~~~----~~~~~~~~~~~i~~ISAk~  171 (311)
T Consensus       101 l~~~~~l~~villIDa~~g~~~~D~~i~~~l~~~~~p~iivlNKiD~l~~~~~~~~~~~i~~~l~~~~~~~~ii~ISA~~  180 (196)
T PRK00454        101 LQKRENLKGVVLLIDSRHPLKELDLEMIEWLKEAGIPVLIVLTKADKLKKGERKKLLKKVKKALARFAADPEVLLFSSLK  180 (196)
T ss_pred             HHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEECCHHCCHHHHHHHHHHHHHHHHHCCCCCCEEEEECCC
T ss_conf             99623336389999716589888999999998627785999987251697899999999999976125898289996999


Q ss_pred             CCCHHHHHHHHHHHCC
Q ss_conf             8742678999998366
Q gi|254780941|r  172 GHGCDDVLNYLCSTLP  187 (311)
Q Consensus       172 g~Gid~L~~~L~~~lp  187 (311)
T Consensus       181 g~GI~eL~~~I~k~Lk  196 (196)
T PRK00454        181 KTGIDELRAAIAKWLK  196 (196)
T ss_pred             CCCHHHHHHHHHHHHC
T ss_conf             9798999999999859