HHsearch alignment for GI: 254780941 and conserved domain: PRK12288

>PRK12288 ribosome-associated GTPase; Reviewed.
Probab=98.72  E-value=1.4e-08  Score=75.38  Aligned_cols=86  Identities=26%  Similarity=0.333  Sum_probs=57.3

Q ss_pred             HHHHHHHCCCCHHHHHHHCC-HHHHHHHHHHCCCCCEEEEEECCCHHHHHHH---HHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             55532100110000100000-0012234544287202578721101043457---8888641001233431100013874
Q gi|254780941|r   99 IKHADIVCLVVDSHRELKVN-IHDLLKEIAKRSSRLILILNKIDCVKPERLL---EQAEIANKLVFIEKTFMVSATKGHG  174 (311)
Q Consensus        99 l~~aDiil~VvDa~~~~~~~-~~~il~~l~~~~~p~IiVlNKiDlv~~~~l~---~~~~~~~~~~~~~~i~~ISAk~g~G  174 (311)
T Consensus       120 AANIDqvlIV~A~~P~~~~~liDRyLv~ae~~~I~pvIvlNK~DL~~~~~~~~~~~~l~~Y~~l-G-Y~v~~~Sa~~~~g  197 (344)
T PRK12288        120 AANIDQIVIVSAVLPELSLNIIDRYLVACETLGIEPLIVLNKIDLLDDEERPFVNEQLDIYRNI-G-YRVLMVSSHTGEG  197 (344)
T ss_pred             EEECCEEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEEECHHCCCHHHHHHHHHHHHHHHHC-C-CEEEEEECCCCCC
T ss_conf             9716889999968999897899999999998699779997314408977899999999999867-9-7399973688628


Q ss_pred             HHHHHHHHHHHC
Q ss_conf             267899999836
Q gi|254780941|r  175 CDDVLNYLCSTL  186 (311)
Q Consensus       175 id~L~~~L~~~l  186 (311)
T Consensus       198 l~~L~~~L~~kt  209 (344)
T PRK12288        198 LEPLEAALTGRI  209 (344)
T ss_pred             HHHHHHHHCCCE
T ss_conf             999999876785