HHsearch alignment for GI: 254780941 and conserved domain: PRK12289

>PRK12289 ribosome-associated GTPase; Reviewed.
Probab=98.20  E-value=2e-06  Score=61.42  Aligned_cols=57  Identities=30%  Similarity=0.418  Sum_probs=41.6

Q ss_pred             EEEEEECCCCCCHHHHHHHHHCC---CEEEECCC----CCCEEEEEEEEEEECCEEEEEEECCCCHH
Q ss_conf             18998338998688999998689---20210588----88602127899973994899998798401
Q gi|254780941|r   23 GCVALVGATNAGKSTLVNRFVGA---KVSIVTHK----VQTTRSIVRGIVSEKESQIVFLDTPGIFN   82 (311)
Q Consensus        23 g~VaivG~pN~GKSTL~N~l~g~---~vsivS~k----~~TTr~~i~gi~~~~~~qiifvDTPG~~~   82 (311)
T Consensus       172 k~tv~~G~SGVGKSSLIN~L~p~~~l~TgeVS~k~~rGrHTTr~~eL~~L~~Gg~---iiDTPGf~~  235 (351)
T PRK12289        172 KITVVAGPSGVGKSSLINRLIPDVELRVGEVSGKLQRGRHTTRHVELFELPNGGL---LADTPGFNQ  235 (351)
T ss_pred             CEEEEECCCCCCHHHHHHHHCCCHHHHHHHHCCCCCCCCCCCCEEEEEECCCCCE---EEECCCCCC
T ss_conf             8699981798878898876374123456654064899878355168999489958---997979887