HHsearch alignment for GI: 254780941 and conserved domain: PRK12317

>PRK12317 elongation factor 1-alpha; Reviewed.
Probab=99.70  E-value=1.4e-16  Score=127.21  Aligned_cols=152  Identities=24%  Similarity=0.291  Sum_probs=103.5

Q ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHH---CC------------------C---EEEECC------CCCCEEEEEEEEEEE
Q ss_conf             68512189983389986889999986---89------------------2---021058------888602127899973
Q gi|254780941|r   18 DNSRSGCVALVGATNAGKSTLVNRFV---GA------------------K---VSIVTH------KVQTTRSIVRGIVSE   67 (311)
Q Consensus        18 ~~~ksg~VaivG~pN~GKSTL~N~l~---g~------------------~---vsivS~------k~~TTr~~i~gi~~~   67 (311)
T Consensus         3 ~~K~~l~i~~~GhVD~GKSTL~G~Ll~~~g~~~~~~~~~~~~~~~~~g~~s~~~a~~~D~~~eEr~rGiTid~~~~~f~~   82 (426)
T PRK12317          3 KEKPHLNLAVIGHVDHGKSTLVGRLLYETGAVDEHIIEEYEEEAKKKGKESFKFAWVMDRLKEERERGVTIDLAHKKFET   82 (426)
T ss_pred             CCCCEEEEEEEEECCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCEEEEECCCCHHHHHCCCEEEEEEEEEEC
T ss_conf             98978499999522876888876898772994489999999899864877521432125786687558278831699954


Q ss_pred             CCEEEEEEECCCCHHHCCCCCCCCCCHHHHHHHHHHHHCCCCHHHH--HHHCCHHHHHHHHHHCCCC-CEEEEEECCCHH
Q ss_conf             9948999987984010123575321002345555321001100001--0000000122345442872-025787211010
Q gi|254780941|r   68 KESQIVFLDTPGIFNAKDSYHKLMIRLSWSTIKHADIVCLVVDSHR--ELKVNIHDLLKEIAKRSSR-LILILNKIDCVK  144 (311)
Q Consensus        68 ~~~qiifvDTPG~~~~~~~l~~~~~~~~~~~l~~aDiil~VvDa~~--~~~~~~~~il~~l~~~~~p-~IiVlNKiDlv~  144 (311)
T Consensus        83 ~~~~~~iiD~PG--------H~~fi~nmi~Gas~~D~ailvV~A~~~~G~~~QT~eHl~l~~~lgi~~iiV~vnKmD~v~  154 (426)
T PRK12317         83 DKYYFTIIDCPG--------HRDFVKNMITGASQADAAVLVVSARDAGGVMPQTREHVFLARTLGINQLIVAINKMDAVN  154 (426)
T ss_pred             CCCEEEEEECCC--------CHHHHHHHHHHHCCCCEEEEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCCC
T ss_conf             981699987896--------366787787453467727999963656676477899999999809983999995333567


Q ss_pred             --HHHHHH---HHHHHHHCCCC----CCCCCCCCCCCCCHHH
Q ss_conf             --434578---88864100123----3431100013874267
Q gi|254780941|r  145 --PERLLE---QAEIANKLVFI----EKTFMVSATKGHGCDD  177 (311)
Q Consensus       145 --~~~l~~---~~~~~~~~~~~----~~i~~ISAk~g~Gid~  177 (311)
T Consensus       155 ~~~~~~~~i~~~~~~~l~~~g~~~~~i~~iPiSa~~Gdni~~  196 (426)
T PRK12317        155 YDEKRYNEVKEEVSKLLKMVGYKPDDIPFIPVSAFEGDNVVK  196 (426)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCC
T ss_conf             788999999999999999709880347088753234656411