>TIGR00092 TIGR00092 GTP-binding protein YchF; InterPro: IPR004396 This is a family of conserved hypothetical proteins found in both prokaryotes and eukaryotes. While the function of these proteins is not known, the crystal structure of P44681 from SWISSPROT from Haemophilus influenzae has been determined . This protein consists of three domains: an N-terminal domain which has a mononucleotide binding fold typical for the P-loop NTPases, a central domain which forms an alpha-helical coiled coil, and a C-terminal domain composed of a six-stranded half-barrel curved around an alpha helix. The central and C-terminal domains are topologically similar to RNA-binding proteins, while the N-terminal region contains the features typical of GTP-dependent molecular switches. The purified protein was capable of binding both double-stranded nucleic acid and GTP. It was suggested, therefore, that this protein might be part of a nucleoprotein complex and could function as a GTP-dependent translation factor.; GO: 0005525 GTP binding.

Probab=99.40 E-value=3.2e-13 Score=105.43 Aligned_cols=88 Identities=24% Similarity=0.366 Sum_probs=70.1 Q ss_pred CCCCEEEEEECCCCCCHHHHHHHHHCCCEEEECCCCCCEEEEEEEEEEECCE------------------EEEEEECCCC Q ss_conf 8512189983389986889999986892021058888602127899973994------------------8999987984 Q gi|254780941|r 19 NSRSGCVALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSIVRGIVSEKES------------------QIVFLDTPGI 80 (311) Q Consensus 19 ~~ksg~VaivG~pN~GKSTL~N~l~g~~vsivS~k~~TTr~~i~gi~~~~~~------------------qiifvDTPG~ 80 (311) T Consensus 2 nl~a---GIVGLpNVGKSTlF~AiT~~~~ge~ANYPFaTIePn~g~V~vpd~RLd~La~i~k~~k~evptt~~fvDIAGL 78 (390) T TIGR00092 2 NLKA---GIVGLPNVGKSTLFNAITNLQLGEAANYPFATIEPNTGVVNVPDPRLDKLAEIYKPEKVEVPTTLEFVDIAGL 78 (390) T ss_pred CCCC---CCEECCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCEEECCCCCHHHHHHHHCCCEEECCEEEEEEEECCC T ss_conf 8876---5300687605579999982667776688876516764446258853334776406420411404899862234 Q ss_pred HHHCCCCCCCCCCHHHHHHHHHHHHCCCCH Q ss_conf 010123575321002345555321001100 Q gi|254780941|r 81 FNAKDSYHKLMIRLSWSTIKHADIVCLVVD 110 (311) Q Consensus 81 ~~~~~~l~~~~~~~~~~~l~~aDiil~VvD 110 (311) T Consensus 79 vkGAS~-GeGLGN~FLanIReVd~I~hVVR 107 (390) T TIGR00092 79 VKGASK-GEGLGNQFLANIREVDAICHVVR 107 (390) T ss_pred CCCCCC-CCCCHHHHHHCCCCCCCCEEEEE T ss_conf 100015-78723344310320331047886

HHsearch alignment for GI: 254780941 and conserved domain: TIGR00092