>TIGR00485 EF-Tu translation elongation factor Tu; InterPro: IPR004541 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome , , . EF1A (or EF-Tu) is responsible for the selection and binding of the cognate aminoacyl-tRNA to the A-site (acceptor site) of the ribosome. EF2 (or EF-G) is responsible for the translocation of the peptidyl-tRNA from the A-site to the P-site (peptidyl-tRNA site) of the ribosome, thereby freeing the A-site for the next aminoacyl-tRNA to bind. Elongation factors are responsible for achieving accuracy of translation and both EF1A and EF2 are remarkably conserved throughout evolution. EF1A (also known as EF-1alpha or EF-Tu) is a G-protein. It forms a ternary complex of EF1A-GTP-aminoacyltRNA. The binding of aminoacyl-tRNA stimulates GTP hydrolysis by EF1A, causing a conformational change in EF1A that causes EF1A-GDP to detach from the ribosome, leaving the aminoacyl-tRNA attached at the A-site. Only the cognate aminoacyl-tRNA can induce the required conformational change in EF1A through its tight anticodon-codon binding , . EF1A-GDP is returned to its active state, EF1A-GTP, through the action of another elongation factor, EF1B (also known as EF-Ts or EF-1beta/gamma/delta). This entry represents EF1A (or EF-Tu) proteins found primarily in bacteria, mitochondria and chloroplasts. Eukaryotic and archaeal EF1A (IPR004539 from INTERPRO) are excluded from this entry. When bound to GTP, EF-Tu can form a complex with any (correctly) aminoacylated tRNA except those for initiation and for selenocysteine, in which case EF-Tu is replaced by other factors . More information about these proteins can be found at Protein of the Month: Elongation Factors .; GO: 0003746 translation elongation factor activity, 0005525 GTP binding, 0006414 translational elongation, 0005622 intracellular.

Probab=97.85 E-value=4.5e-05 Score=52.70 Aligned_cols=156 Identities=18% Similarity=0.150 Sum_probs=95.2 Q ss_pred EEEEEECCCCCCHHHHHHHHHCC----CEEE------ECCCC-----CCEEEEEEEEEEECCEEEEEEECCCCHHHCCCC Q ss_conf 18998338998688999998689----2021------05888-----860212789997399489999879840101235 Q gi|254780941|r 23 GCVALVGATNAGKSTLVNRFVGA----KVSI------VTHKV-----QTTRSIVRGIVSEKESQIVFLDTPGIFNAKDSY 87 (311) Q Consensus 23 g~VaivG~pN~GKSTL~N~l~g~----~vsi------vS~k~-----~TTr~~i~gi~~~~~~qiifvDTPG~~~~~~~l 87 (311) T Consensus 13 ~n~GtiGhvdhGkttl~aa~~~~l~~~~~~~~~~y~~id~aPee~~rGiti~~~~vey~~~~rhyahvdCPGha------ 86 (394) T TIGR00485 13 VNIGTIGHVDHGKTTLTAAITTVLAKEGKAAAKKYDEIDKAPEEKARGITINTAHVEYETEKRHYAHVDCPGHA------ 86 (394) T ss_pred EEEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHCCEEEEEEEEEECCCCCCEEEECCCCHH------ T ss_conf 33301210015505789999999875100356767765237211334515653355421467515763188626------ Q ss_pred CCCCCCHHHHHHHHHHHHCCCCHHHHHHHCCHHHHHHHHHHCCCCCEEE-EEECCCHHHHHHHHHHHH-----HHHCC-- Q ss_conf 7532100234555532100110000100000001223454428720257-872110104345788886-----41001-- Q gi|254780941|r 88 HKLMIRLSWSTIKHADIVCLVVDSHRELKVNIHDLLKEIAKRSSRLILI-LNKIDCVKPERLLEQAEI-----ANKLV-- 159 (311) Q Consensus 88 ~~~~~~~~~~~l~~aDiil~VvDa~~~~~~~~~~il~~l~~~~~p~IiV-lNKiDlv~~~~l~~~~~~-----~~~~~-- 159 (311) T Consensus 87 --dyvknmitGaaqmdGailvv~~~d~~mPqt~ehill~~~vGvP~~vvflnk~d~~~~~el~~lv~~e~~~ll~~~~f~ 164 (394) T TIGR00485 87 --DYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPKIVVFLNKVDMVDDEELLELVELEVRELLSEYDFP 164 (394) T ss_pred --HHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHEEEECCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCC T ss_conf --788876410111176079995278888741121001002687657876402332242789999999999998740789 Q ss_pred -CCCCCCCCCCCCC-CCHHHHHHHHHHHC Q ss_conf -2334311000138-74267899999836 Q gi|254780941|r 160 -FIEKTFMVSATKG-HGCDDVLNYLCSTL 186 (311) Q Consensus 160 -~~~~i~~ISAk~g-~Gid~L~~~L~~~l 186 (311) T Consensus 165 G~~~Pi~~Gsal~al~~~~~~~~~~~~l~ 193 (394) T TIGR00485 165 GDDVPIVRGSALKALEGDAEWEEKILELM 193 (394) T ss_pred CCCCCEEECHHHHHHHHHHHHHHHHHHHH T ss_conf 86522561145654200367999999999

HHsearch alignment for GI: 254780941 and conserved domain: TIGR00485