>TIGR02475 CobW cobalamin biosynthesis protein CobW; InterPro: IPR012824 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt. Cobalamin is usually found in one of two biologically active forms: methylcobalamin and adocobalamin. Most prokaryotes, as well as animals, have cobalamin-dependent enzymes, whereas plants and fungi do not appear to use it. In bacteria and archaea, these include methionine synthase, ribonucleotide reductase, glutamate and methylmalonyl-CoA mutases, ethanolamine ammonia lyase, and diol dehydratase . In mammals, cobalamin is obtained through the diet, and is required for methionine synthase and methylmalonyl-CoA mutase . There are at least two distinct cobalamin biosynthetic pathways in bacteria : Aerobic pathway that requires oxygen and in which cobalt is inserted late in the pathway ; found in Pseudomonas denitrificans and Rhodobacter capsulatus. Anaerobic pathway in which cobalt insertion is the first committed step towards cobalamin synthesis ; found in Salmonella typhimurium, Bacillus megaterium, and Propionibacterium freudenreichii shermanii. Either pathway can be divided into two parts: (1) corrin ring synthesis (differs in aerobic and anaerobic pathways) and (2) adenosylation of corrin ring, attachment of aminopropanol arm, and assembly of the nucleotide loop (common to both pathways) . There are about 30 enzymes involved in either pathway, where those involved in the aerobic pathway are prefixed Cob and those of the anaerobic pathway Cbi. Several of these enzymes are pathway-specific: CbiD, CbiG, and CbiK are specific to the anaerobic route of S. typhimurium, whereas CobE, CobF, CobG, CobN, CobS, CobT, and CobW are unique to the aerobic pathway of P. denitrificans. This entry represents CobW proteins, which are generally found proximal to the trimeric cobaltochelatase subunit CobN, an essential protein for vitamin B12 (cobalamin) biosynthesis . They contain a P-loop nucleotide-binding loop in the N-terminal domain and a histidine-rich region in the C-terminal portion suggesting a role in metal binding, possibly as an intermediary between the cobalt transport and chelation systems. CobW might be involved in cobalt reduction leading to cobalt(I) corrinoids.; GO: 0009236 cobalamin biosynthetic process.

Probab=97.25 E-value=0.00056 Score=45.61 Aligned_cols=145 Identities=20% Similarity=0.265 Sum_probs=84.4 Q ss_pred EEECCCCCCHHHHHHHHH----CCCEEEECCCC----------------CCEEE-EEEEEEEECCE-------------- Q ss_conf 983389986889999986----89202105888----------------86021-27899973994-------------- Q gi|254780941|r 26 ALVGATNAGKSTLVNRFV----GAKVSIVTHKV----------------QTTRS-IVRGIVSEKES-------------- 70 (311) Q Consensus 26 aivG~pN~GKSTL~N~l~----g~~vsivS~k~----------------~TTr~-~i~gi~~~~~~-------------- 70 (311) T Consensus 8 vvTGFLGaGKTTLiRhlL~NA~GkRiAvIVNEFGd~GiDG~iLk~Cgi~~C~Eeeaq~~i~ELaNGCiCCTVaDdF~Ptm 87 (349) T TIGR02475 8 VVTGFLGAGKTTLIRHLLENAEGKRIAVIVNEFGDLGIDGEILKACGIEACSEEEAQVNIVELANGCICCTVADDFIPTM 87 (349) T ss_pred EEECCCCCCHHHHHHHHHHCCCCCEEEEEEECCCCCCCCHHHHHHCCCCCCCCHHHCCCEEECCCCCEECCCHHHHHHHH T ss_conf 87375676158999999717478769999852556063679996435678880120001488088973103201256799 Q ss_pred ----------EEEEEECCCCHHHCCCCCCCCCCHH-HHHHHHHHHHCCCCHHH---HHHHCCHHHHHHHHH------HCC Q ss_conf ----------8999987984010123575321002-34555532100110000---100000001223454------428 Q gi|254780941|r 71 ----------QIVFLDTPGIFNAKDSYHKLMIRLS-WSTIKHADIVCLVVDSH---RELKVNIHDLLKEIA------KRS 130 (311) Q Consensus 71 ----------qiifvDTPG~~~~~~~l~~~~~~~~-~~~l~~aDiil~VvDa~---~~~~~~~~~il~~l~------~~~ 130 (311) T Consensus 88 ~~LL~R~~~~DHIlIETSGLALPKPLV~AF--~WP~iRs~vTVDGVvtVVDg~AvAAG~fA~D~dav~aQR~aD~nLDHe 165 (349) T TIGR02475 88 TKLLARRERPDHILIETSGLALPKPLVQAF--QWPEIRSRVTVDGVVTVVDGPAVAAGRFAADPDAVDAQRAADDNLDHE 165 (349) T ss_pred HHHHHCCCCCCEEEEECCHHHCCHHHHHHC--CCCCCCCCEEECEEEEEECHHHHCCCCCCCCHHHHHHHHHHCCCCCCC T ss_conf 999703889866887442100221588646--882122712754178854446503588854378999998608777888 Q ss_pred -CCC------------EEEEEECCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC Q ss_conf -720------------2578721101043457888864100123343110001387 Q gi|254780941|r 131 -SRL------------ILILNKIDCVKPERLLEQAEIANKLVFIEKTFMVSATKGH 173 (311) Q Consensus 131 -~p~------------IiVlNKiDlv~~~~l~~~~~~~~~~~~~~~i~~ISAk~g~ 173 (311) T Consensus 166 d~PLeElFEDQlacADLviLnKaDlldaag~~~v~a~i~~~lp-r~v~iv~a~~G~ 220 (349) T TIGR02475 166 DSPLEELFEDQLACADLVILNKADLLDAAGLARVRAEIAAELP-RAVKIVEASHGE 220 (349) T ss_pred CCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCC-CCCEEEECCCCC T ss_conf 8851233668999889998534300488899999999997358-875177514785

HHsearch alignment for GI: 254780941 and conserved domain: TIGR02475