HHsearch alignment for GI: 254780941 and conserved domain: cd01885

>cd01885 EF2 EF2 (for archaea and eukarya). Translocation requires hydrolysis of a molecule of GTP and is mediated by EF-G in bacteria and by eEF2 in eukaryotes. The eukaryotic elongation factor eEF2 is a GTPase involved in the translocation of the peptidyl-tRNA from the A site to the P site on the ribosome. The 95-kDa protein is highly conserved, with 60% amino acid sequence identity between the human and yeast proteins. Two major mechanisms are known to regulate protein elongation and both involve eEF2. First, eEF2 can be modulated by reversible phosphorylation. Increased levels of phosphorylated eEF2 reduce elongation rates presumably because phosphorylated eEF2 fails to bind the ribosomes. Treatment of mammalian cells with agents that raise the cytoplasmic Ca2+ and cAMP levels reduce elongation rates by activating the kinase responsible for phosphorylating eEF2. In contrast, treatment of cells with insulin increases elongation rates by promoting eEF2 dephosphorylation. Seco
Probab=99.65  E-value=4.4e-16  Score=123.89  Aligned_cols=157  Identities=24%  Similarity=0.364  Sum_probs=105.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCEEEECCCCCCEEE-------EEEEE----------E--------EECCEEEEEEECC
Q ss_conf             899833899868899999868920210588886021-------27899----------9--------7399489999879
Q gi|254780941|r   24 CVALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRS-------IVRGI----------V--------SEKESQIVFLDTP   78 (311)
Q Consensus        24 ~VaivG~pN~GKSTL~N~l~g~~vsivS~k~~TTr~-------~i~gi----------~--------~~~~~qiifvDTP   78 (311)
T Consensus         2 Ni~iigHvdhGKTTL~D~Ll~~~g~i~~~~~g~~~~~D~~~~E~eRgiTIks~~isl~~~~~~~~~~~~~~~~inlIDTP   81 (222)
T cd01885           2 NICIIAHVDHGKTTLSDSLLASAGIISEKLAGKARYMDSREDEQERGITMKSSAISLYFEYEEEDKADGNEYLINLIDSP   81 (222)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCHHCCCCEEECCCHHHHHHCCCEEEEEEEEEEEEECCCCCCCCCCEEEEEEECC
T ss_conf             69998668877999999999985984121066346514243342054158622689998603443456886389997288


Q ss_pred             CCHHHCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHCCHHHHHHHHHHCCCCCEEEEEECCCH------HHHHH----
Q ss_conf             84010123575321002345555321001100001000000012234544287202578721101------04345----
Q gi|254780941|r   79 GIFNAKDSYHKLMIRLSWSTIKHADIVCLVVDSHRELKVNIHDLLKEIAKRSSRLILILNKIDCV------KPERL----  148 (311)
Q Consensus        79 G~~~~~~~l~~~~~~~~~~~l~~aDiil~VvDa~~~~~~~~~~il~~l~~~~~p~IiVlNKiDlv------~~~~l----  148 (311)
T Consensus        82 GH~d--------F~~ev~~al~~~DgailVVDa~eGv~~qT~~vl~~a~~~~l~~il~iNKiDRli~el~l~p~day~~l  153 (222)
T cd01885          82 GHVD--------FSSEVTAALRLCDGALVVVDAVEGVCVQTETVLRQALKERVKPVLVINKIDRLILELKLSPEEAYQRL  153 (222)
T ss_pred             CHHH--------HHHHHHHHHHHCCEEEEEECCCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCHHCCCCHHHHHHHH
T ss_conf             5698--------99999999985681799610457857789999999998599979999890365001179989999999


Q ss_pred             HHHHHHHHHC----------------CCC----CCCCCCCCCCCCCHH--------HHHHHHHHHCCC
Q ss_conf             7888864100----------------123----343110001387426--------789999983662
Q gi|254780941|r  149 LEQAEIANKL----------------VFI----EKTFMVSATKGHGCD--------DVLNYLCSTLPL  188 (311)
Q Consensus       149 ~~~~~~~~~~----------------~~~----~~i~~ISAk~g~Gid--------~L~~~L~~~lpe  188 (311)
T Consensus       154 ~~iie~vN~~i~~~~~~~~~~~~~~~~~~~p~~gnV~f~Sa~~Gw~f~l~~fa~ly~ll~~iv~~iP~  221 (222)
T cd01885         154 ARIIEQVNAIIGTYADEEFKEKDDEKWYFSPQKGNVAFGSALHGWGFTIIKFARIYAVLEMVVKHLPS  221 (222)
T ss_pred             HHHHHHHHHHHHHHCHHHHCCCCCCCEEECCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             99999999999872304330355321020777783899983237712675412189999999962899