>cd01886 EF-G Elongation factor G (EF-G) subfamily. Translocation is mediated by EF-G (also called translocase). The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA. This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule. EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit. The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit. To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it. The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well. The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site. This group conta

Probab=99.70 E-value=3.1e-16 Score=124.91 Aligned_cols=152 Identities=15% Similarity=0.169 Sum_probs=99.5 Q ss_pred EEEEECCCCCCHHHHHHHHHCC-----CEEEECCC------------CCCEEEEEEEEEEECCEEEEEEECCCCHHHCCC Q ss_conf 8998338998688999998689-----20210588------------886021278999739948999987984010123 Q gi|254780941|r 24 CVALVGATNAGKSTLVNRFVGA-----KVSIVTHK------------VQTTRSIVRGIVSEKESQIVFLDTPGIFNAKDS 86 (311) Q Consensus 24 ~VaivG~pN~GKSTL~N~l~g~-----~vsivS~k------------~~TTr~~i~gi~~~~~~qiifvDTPG~~~~~~~ 86 (311) T Consensus 1 Niai~gH~gaGKTtL~EalL~~ag~i~r~G~v~~g~tv~D~~~eE~~R~isi~~~~~~~~w~~~~inliDTPG~~D---- 76 (270) T cd01886 1 NIGIIAHIDAGKTTTTERILYYTGRIHKIGEVHGGGATMDFMEQERERGITIQSAATTCFWKDHRINIIDTPGHVD---- 76 (270) T ss_pred CEEEEECCCCCHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCHHHHHCCCEEECCEEEEEECCEEEEEEECCCCHH---- T ss_conf 9899968999988999999986687355815538975566848898768707336689998998999986969678---- Q ss_pred CCCCCCCHHHHHHHHHHHHCCCCHHHHHHHCCHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHCCCCCCCCC Q ss_conf 57532100234555532100110000100000001223454428720257872110104345788886410012334311 Q gi|254780941|r 87 YHKLMIRLSWSTIKHADIVCLVVDSHRELKVNIHDLLKEIAKRSSRLILILNKIDCVKPERLLEQAEIANKLVFIEKTFM 166 (311) Q Consensus 87 l~~~~~~~~~~~l~~aDiil~VvDa~~~~~~~~~~il~~l~~~~~p~IiVlNKiDlv~~~~l~~~~~~~~~~~~~~~i~~ 166 (311) T Consensus 77 ----F~~e~~~aL~~~D~AviVv~a~~GVe~~T~~~w~~~~~~~lP~i~fINKmDre~ad-~~~~l~~i~~~lg~-~~vp 150 (270) T cd01886 77 ----FTIEVERSLRVLDGAVAVFDAVAGVEPQTETVWRQADRYNVPRIAFVNKMDRTGAD-FFRVVEQIREKLGA-NPVP 150 (270) T ss_pred ----HHHHHHHHHHHHCEEEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCC-CHHHHHHHHHHHCC-CEEE T ss_conf ----89999999877555999984676442636999988998499989999887877887-16689999998589-7388 Q ss_pred CCC--CCCCCHHHHHHHHHHH Q ss_conf 000--1387426789999983 Q gi|254780941|r 167 VSA--TKGHGCDDVLNYLCST 185 (311) Q Consensus 167 ISA--k~g~Gid~L~~~L~~~ 185 (311) T Consensus 151 ~~~Pig~g~~f~GvvDll~~k 171 (270) T cd01886 151 LQLPIGEEDDFRGVVDLIEMK 171 (270) T ss_pred EEEEECCCCCEEEEEECCCCE T ss_conf 985632789747999778787

HHsearch alignment for GI: 254780941 and conserved domain: cd01886