HHsearch alignment for GI: 254780941 and conserved domain: cd04107

>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 are members of the Rab family of small GTPases. Human Rab32 was first identified in platelets but it is expressed in a variety of cell types, where it functions as an A-kinase anchoring protein (AKAP). Rab38 has been shown to be melanocyte-specific. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=99.65  E-value=3.9e-15  Score=117.78  Aligned_cols=157  Identities=17%  Similarity=0.157  Sum_probs=99.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCEEEECCCCCCEE--EEEEEEEEEC-C--EEEEEEECCCCHHHCCCCCCCCCCHHHHH
Q ss_conf             89983389986889999986892021058888602--1278999739-9--48999987984010123575321002345
Q gi|254780941|r   24 CVALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTR--SIVRGIVSEK-E--SQIVFLDTPGIFNAKDSYHKLMIRLSWST   98 (311)
Q Consensus        24 ~VaivG~pN~GKSTL~N~l~g~~vsivS~k~~TTr--~~i~gi~~~~-~--~qiifvDTPG~~~~~~~l~~~~~~~~~~~   98 (311)
T Consensus         2 KvvllGd~gVGKTsLi~rf~~~~F~~---~y~~Tig~df~~k~i~~~~~~~v~l~iwDtaGqe--------~~~~l~~~y   70 (201)
T cd04107           2 KVLVIGDLGVGKTSIIKRYVHGIFSQ---HYKATIGVDFALKVIEWDPNTVVRLQLWDIAGQE--------RFGGMTRVY   70 (201)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCCC---CCCCCCCEEEEEEEEEECCCEEEEEEEEECCCCC--------CCCCCHHHH
T ss_conf             79999999978999999998299999---8888756778998999679819999998689983--------222003755


Q ss_pred             HHHHHHHCCCCHHHHHHHCCH-HHHHHHH-------HHCCCCCEEEEEECCCHHHHHH-HHHHHHHHHCCCCCCCCCCCC
Q ss_conf             555321001100001000000-0122345-------4428720257872110104345-788886410012334311000
Q gi|254780941|r   99 IKHADIVCLVVDSHRELKVNI-HDLLKEI-------AKRSSRLILILNKIDCVKPERL-LEQAEIANKLVFIEKTFMVSA  169 (311)
Q Consensus        99 l~~aDiil~VvDa~~~~~~~~-~~il~~l-------~~~~~p~IiVlNKiDlv~~~~l-~~~~~~~~~~~~~~~i~~ISA  169 (311)
T Consensus        71 ~~~a~~~ilvydvt~~~Sf~~l~~w~~~i~~~~~~~~~~~ipiilVgNK~DL~~~~~v~~ee~~~~a~~~~~~~~~EtSA  150 (201)
T cd04107          71 YRGAVGAIIVFDVTRPSTFEAVLKWKADLDSKVTLPNGEPIPCLLLANKCDLKKRLAKDGEQMDQFCKENGFIGWFETSA  150 (201)
T ss_pred             CCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHCCCCEEEEECC
T ss_conf             55776479998279889999899999999998621378987189986655641125689999999999779980999779


Q ss_pred             CCCCCHHHHHHHHHHHCCCCCC
Q ss_conf             1387426789999983662235
Q gi|254780941|r  170 TKGHGCDDVLNYLCSTLPLAPW  191 (311)
Q Consensus       170 k~g~Gid~L~~~L~~~lpe~~~  191 (311)
T Consensus       151 ktg~nV~e~F~~l~~~i~~~~~  172 (201)
T cd04107         151 KEGINIEEAMRFLVKNILANDK  172 (201)
T ss_pred             CCCCCHHHHHHHHHHHHHHCCC
T ss_conf             9994989999999999986653