HHsearch alignment for GI: 254780941 and conserved domain: cd04118

>cd04118 Rab24 Rab24 subfamily. Rab24 is distinct from other Rabs in several ways. It exists primarily in the GTP-bound state, having a low intrinsic GTPase activity; it is not efficiently geranyl-geranylated at the C-terminus; it does not form a detectable complex with Rab GDP-dissociation inhibitors (GDIs); and it has recently been shown to undergo tyrosine phosphorylation when overexpressed in vitro. The specific function of Rab24 still remains unknown. It is found in a transport route between ER-cis-Golgi and late endocytic compartments. It is putatively involved in an autophagic pathway, possibly directing misfolded proteins in the ER to degradative pathways. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilita
Probab=99.64  E-value=5e-15  Score=117.11  Aligned_cols=155  Identities=17%  Similarity=0.204  Sum_probs=99.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCEEEECCCCCCEEEE-EEEEEEECC--EEEEEEECCCCHHHCCCCCCCCCCHHHHHHH
Q ss_conf             8998338998688999998689202105888860212-789997399--4899998798401012357532100234555
Q gi|254780941|r   24 CVALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSI-VRGIVSEKE--SQIVFLDTPGIFNAKDSYHKLMIRLSWSTIK  100 (311)
Q Consensus        24 ~VaivG~pN~GKSTL~N~l~g~~vsivS~k~~TTr~~-i~gi~~~~~--~qiifvDTPG~~~~~~~l~~~~~~~~~~~l~  100 (311)
T Consensus         2 KivlvGd~~VGKTsLi~r~~~~~f~-~~~y~~tig~~~~~k~i~v~~~~v~l~iwDtaG~e--------~~~~l~~~y~~   72 (193)
T cd04118           2 KVVMLGKESVGKTSLVERYVHHRFL-VGPYQNTIGAAFVAKRMVVGERVVTLGIWDTAGSE--------RYEAMSRIYYR   72 (193)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCC-CCCCCCCCEEEEEEEEEEECCEEEEEEEEECCCCH--------HHHHHHHHHHC
T ss_conf             8999996998799999999859799-89978763058899999999999999999199973--------12355798834


Q ss_pred             HHHHHCCCCHHHHHHHC-CHHHHHHHHH--HCCCCCEEEEEECCCHHHH----H-HHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             53210011000010000-0001223454--4287202578721101043----4-5788886410012334311000138
Q gi|254780941|r  101 HADIVCLVVDSHRELKV-NIHDLLKEIA--KRSSRLILILNKIDCVKPE----R-LLEQAEIANKLVFIEKTFMVSATKG  172 (311)
Q Consensus       101 ~aDiil~VvDa~~~~~~-~~~~il~~l~--~~~~p~IiVlNKiDlv~~~----~-l~~~~~~~~~~~~~~~i~~ISAk~g  172 (311)
T Consensus        73 ~a~~~ilvydit~~~Sf~~i~~W~~~i~~~~~~~~iilVGnK~DL~~~~~~~r~V~~~e~~~~a~~~~-~~~~E~SAktg  151 (193)
T cd04118          73 GAKAAIVCYDLTDSSSFERAKFWVKELQNLEEHCKIYLCGTKSDLIEQDRSLRQVDFHDVQDFADEIK-AQHFETSSKTG  151 (193)
T ss_pred             CCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHHHCCCCCCCCCHHHHHHHHHHCC-CEEEEECCCCC
T ss_conf             77445788306987999989999999997489999799977466322016664468999999999809-96999838989


Q ss_pred             CCHHHHHHHHHHHCCC
Q ss_conf             7426789999983662
Q gi|254780941|r  173 HGCDDVLNYLCSTLPL  188 (311)
Q Consensus       173 ~Gid~L~~~L~~~lpe  188 (311)
T Consensus       152 ~nV~e~F~~la~~i~~  167 (193)
T cd04118         152 QNVDELFQKVAEDFVS  167 (193)
T ss_pred             CCHHHHHHHHHHHHHH
T ss_conf             3989999999999997