HHsearch alignment for GI: 254780941 and conserved domain: cd04136

>cd04136 Rap_like Rap-like subfamily. The Rap subfamily consists of the Rap1, Rap2, and RSR1. Rap subfamily proteins perform different cellular functions, depending on the isoform and its subcellular localization. For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules. Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and microsomal membrane of the pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts. Rap1 localizes in the nucleus of human oropharyngeal squamous cell carcinomas (SCCs) and cell lines. Rap1 plays a role in phagocytosis by controlling the binding of adhesion receptors (typically integrins) to their ligands. In yeast, Rap1 has been implicated in multiple functions, including activation and silencing of transcription and maintenance of telomeres.
Probab=99.59  E-value=1.2e-14  Score=114.56  Aligned_cols=151  Identities=21%  Similarity=0.213  Sum_probs=98.0

Q ss_pred             EEEECCCCCCHHHHHHHHHCCCEEEECCCCCCEEEEEEEEEEECC--EEEEEEECCCCHHHCCCCCCCCCCHHHHHHHHH
Q ss_conf             998338998688999998689202105888860212789997399--489999879840101235753210023455553
Q gi|254780941|r   25 VALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSIVRGIVSEKE--SQIVFLDTPGIFNAKDSYHKLMIRLSWSTIKHA  102 (311)
Q Consensus        25 VaivG~pN~GKSTL~N~l~g~~vsivS~k~~TTr~~i~gi~~~~~--~qiifvDTPG~~~~~~~l~~~~~~~~~~~l~~a  102 (311)
T Consensus         4 ivllGd~~VGKTsli~r~~~~~f~-~~y~~-Ti~~~~~k~i~~~~~~~~l~iwDtaG~e~--------~~~~~~~y~~~a   73 (163)
T cd04136           4 VVVLGSGGVGKSALTVQFVQGIFV-EKYDP-TIEDSYRKQIEVDGQQCMLEILDTAGTEQ--------FTAMRDLYIKNG   73 (163)
T ss_pred             EEEECCCCCCHHHHHHHHHHCCCC-CCCCC-CCCCEEEEEEEECCEEEEEEECCCCCCHH--------HHHHHHHHHCCC
T ss_conf             999899998899999999719598-86699-54206999999999999998645765445--------556789883468


Q ss_pred             HHHCCCCHHHHHHHCCH-HHHHHHHH----HCCCCCEEEEEECCCHHHHHH-HHHHHHHHHCCCCCCCCCCCCCCCCCHH
Q ss_conf             21001100001000000-01223454----428720257872110104345-7888864100123343110001387426
Q gi|254780941|r  103 DIVCLVVDSHRELKVNI-HDLLKEIA----KRSSRLILILNKIDCVKPERL-LEQAEIANKLVFIEKTFMVSATKGHGCD  176 (311)
Q Consensus       103 Diil~VvDa~~~~~~~~-~~il~~l~----~~~~p~IiVlNKiDlv~~~~l-~~~~~~~~~~~~~~~i~~ISAk~g~Gid  176 (311)
T Consensus        74 ~~~ilvydvt~~~Sf~~l~~~~~~i~~~~~~~~~piilVGnK~Dl~~~r~v~~~~~~~~a~~~~~-~~~E~SAk~~~nV~  152 (163)
T cd04136          74 QGFVLVYSITSQSSFNDLQDLREQILRVKDTENVPMVLVGNKCDLEDERVVSREEGQALARQWGC-PFYETSAKSKINVD  152 (163)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHCCCCHHHHHHHHHHCCC-EEEEECCCCCCCHH
T ss_conf             76999704898899999999999999861888886787623547264078999999999998499-89997448780589


Q ss_pred             HHHHHHHHHC
Q ss_conf             7899999836
Q gi|254780941|r  177 DVLNYLCSTL  186 (311)
Q Consensus       177 ~L~~~L~~~l  186 (311)
T Consensus       153 e~F~~l~~~i  162 (163)
T cd04136         153 EVFADLVRQI  162 (163)
T ss_pred             HHHHHHHHHH
T ss_conf             9999999963