HHsearch alignment for GI: 254780941 and conserved domain: cd04141

>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like protein in all tissues), Rin (Ras-like protein in neurons) and Ric (Ras-related protein which interacts with calmodulin) form a subfamily with several unique structural and functional characteristics. These proteins all lack a the C-terminal CaaX lipid-binding motif typical of Ras family proteins, and Rin and Ric contain calmodulin-binding domains. Rin, which is expressed only in neurons, induces neurite outgrowth in rat pheochromocytoma cells through its association with calmodulin and its activation of endogenous Rac/cdc42. Rit, which is ubiquitously expressed in mammals, inhibits growth-factor withdrawl-mediated apoptosis and induces neurite extension in pheochromocytoma cells. Rit and Rin are both able to form a ternary complex with PAR6, a cell polarity-regulating protein, and Rac/cdc42. This ternary complex is proposed to have physiological function in processes such as tumorigenesis. Activated Ric is likely to sign
Probab=99.59  E-value=2.5e-14  Score=112.60  Aligned_cols=154  Identities=18%  Similarity=0.192  Sum_probs=99.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCEEEECCCCCCEEEEEEEEEEEC--CEEEEEEECCCCHHHCCCCCCCCCCHHHHHHHH
Q ss_conf             899833899868899999868920210588886021278999739--948999987984010123575321002345555
Q gi|254780941|r   24 CVALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSIVRGIVSEK--ESQIVFLDTPGIFNAKDSYHKLMIRLSWSTIKH  101 (311)
Q Consensus        24 ~VaivG~pN~GKSTL~N~l~g~~vsivS~k~~TTr~~i~gi~~~~--~~qiifvDTPG~~~~~~~l~~~~~~~~~~~l~~  101 (311)
T Consensus         4 Kiv~lGd~~VGKTsli~r~~~~~f~-~~~~p-Ti~~~~~~~i~i~~~~~~l~iwDtaGqe--------~~~~l~~~~~r~   73 (172)
T cd04141           4 KIVMLGAGGVGKSAVTMQFISHSFP-DYHDP-TIEDAYKQQARIDNEPALLDILDTAGQA--------EFTAMRDQYMRC   73 (172)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCC-CCCCC-CCCCCEEEEEEECCEEEEEEEEECCCCC--------CCCCCHHHHHCC
T ss_conf             9999999997799999999709899-87588-4222036999999999999999788851--------357451556427


Q ss_pred             HHHHCCCCHHHHHHHCC-HHHHHHHHH----HCCCCCEEEEEECCCHHHHHH-HHHHHHHHHCCCCCCCCCCCCCCCCCH
Q ss_conf             32100110000100000-001223454----428720257872110104345-788886410012334311000138742
Q gi|254780941|r  102 ADIVCLVVDSHRELKVN-IHDLLKEIA----KRSSRLILILNKIDCVKPERL-LEQAEIANKLVFIEKTFMVSATKGHGC  175 (311)
Q Consensus       102 aDiil~VvDa~~~~~~~-~~~il~~l~----~~~~p~IiVlNKiDlv~~~~l-~~~~~~~~~~~~~~~i~~ISAk~g~Gi  175 (311)
T Consensus        74 a~~~ilvydvt~~~Sf~~~~~w~~~i~~~~~~~~~piilvGNK~DL~~~r~Vs~~e~~~~a~~~~~-~f~EtSAk~~~nV  152 (172)
T cd04141          74 GEGFIICYSVTDRHSFQEASEFKKLITRVRLTEDIPLVLVGNKVDLESQRQVTTEEGRNLAREFNC-PFFETSAALRHYI  152 (172)
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHCCCCHHHHHHHHHHCCC-EEEEECCCCCCCH
T ss_conf             865688731688889999999999999972889986899850456676188899999999998599-7999747888288


Q ss_pred             HHHHHHHHHHCCC
Q ss_conf             6789999983662
Q gi|254780941|r  176 DDVLNYLCSTLPL  188 (311)
Q Consensus       176 d~L~~~L~~~lpe  188 (311)
T Consensus       153 ~e~F~~l~~~i~~  165 (172)
T cd04141         153 DDAFHGLVREIRR  165 (172)
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999999999986