HHsearch alignment for GI: 254780941 and conserved domain: cd04147

>cd04147 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-ventral anterior localization) subfamily consists of a set of proteins characterized only in Xenopus leavis, to date. In Xenopus Ras-dva expression is activated by the transcription factor Otx2 and begins during gastrulation throughout the anterior ectoderm. Ras-dva expression is inhibited in the anterior neural plate by factor Xanf1. Downregulation of Ras-dva results in head development abnormalities through the inhibition of several regulators of the anterior neural plate and folds patterning, including Otx2, BF-1, Xag2, Pax6, Slug, and Sox9. Downregulation of Ras-dva also interferes with the FGF-8a signaling within the anterior ectoderm. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.
Probab=99.63  E-value=4.9e-15  Score=117.17  Aligned_cols=152  Identities=20%  Similarity=0.213  Sum_probs=96.0

Q ss_pred             EEEECCCCCCHHHHHHHHHCCCEEEECCCCCCEEEEEEEEEEECC--EEEEEEECCCCHHHCCCCCCCCCCHHHHHHHHH
Q ss_conf             998338998688999998689202105888860212789997399--489999879840101235753210023455553
Q gi|254780941|r   25 VALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSIVRGIVSEKE--SQIVFLDTPGIFNAKDSYHKLMIRLSWSTIKHA  102 (311)
Q Consensus        25 VaivG~pN~GKSTL~N~l~g~~vsivS~k~~TTr~~i~gi~~~~~--~qiifvDTPG~~~~~~~l~~~~~~~~~~~l~~a  102 (311)
T Consensus         2 IvvlGd~~VGKTSLi~rf~~~~F~--~~y~~Ti~~~~~k~~~v~~~~v~l~i~DtaG~--------e~~~~l~~~~~r~a   71 (198)
T cd04147           2 LVFMGAAGVGKTALIQRFLYDTFE--PKYRRTVEEMHRKEYEVGGVSLTLDILDTSGS--------YSFPAMRKLSIQNS   71 (198)
T ss_pred             EEEECCCCCCHHHHHHHHHHCCCC--CCCCCCHHHEEEEEEEECCEEEEEEEEECCCC--------CCCHHHHHHHCCCC
T ss_conf             899998997799999999859899--88888725418899998997999999978775--------13014555541588


Q ss_pred             HHHCCCCHHHHHHHCC-HHHHHHHHH----HCCCCCEEEEEECCCHHHHH-H-HHHHHHHHH-CCCCCCCCCCCCCCCCC
Q ss_conf             2100110000100000-001223454----42872025787211010434-5-788886410-01233431100013874
Q gi|254780941|r  103 DIVCLVVDSHRELKVN-IHDLLKEIA----KRSSRLILILNKIDCVKPER-L-LEQAEIANK-LVFIEKTFMVSATKGHG  174 (311)
Q Consensus       103 Diil~VvDa~~~~~~~-~~~il~~l~----~~~~p~IiVlNKiDlv~~~~-l-~~~~~~~~~-~~~~~~i~~ISAk~g~G  174 (311)
T Consensus        72 ~~~ilVyDit~~~Sf~~l~~w~~~i~~~~~~~~ipiilVGNK~Dll~~~R~V~~~e~~~~a~~~~~-~~f~EtSAktg~n  150 (198)
T cd04147          72 DAFALVYAVDDPESFEEVERLREEILEVKEDKFVPIVVVGNKADSLEEERQVPAKDALSTVELDWN-CGFVETSAKDNEN  150 (198)
T ss_pred             CEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHCCC-CEEEECCCCCCCC
T ss_conf             668999616977999999999999999628889828999878765010478489999999985599-7899877999949


Q ss_pred             HHHHHHHHHHHCC
Q ss_conf             2678999998366
Q gi|254780941|r  175 CDDVLNYLCSTLP  187 (311)
Q Consensus       175 id~L~~~L~~~lp  187 (311)
T Consensus       151 V~e~F~~l~r~i~  163 (198)
T cd04147         151 VLEVFKELLRQAN  163 (198)
T ss_pred             HHHHHHHHHHHHC
T ss_conf             8999999999977