>cd04155 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension. In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form. The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector. Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2). It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery. In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.

Probab=99.85 E-value=9.6e-21 Score=154.08 Aligned_cols=152 Identities=19% Similarity=0.274 Sum_probs=104.9 Q ss_pred CEEEEEECCCCCCHHHHHHHHHCCCEEEECCCCCCEEEEEEEEEEECCEEEEEEECCCCHHHCCCCCCCCCCHHHHHHHH Q ss_conf 21899833899868899999868920210588886021278999739948999987984010123575321002345555 Q gi|254780941|r 22 SGCVALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSIVRGIVSEKESQIVFLDTPGIFNAKDSYHKLMIRLSWSTIKH 101 (311) Q Consensus 22 sg~VaivG~pN~GKSTL~N~l~g~~vsivS~k~~TTr~~i~gi~~~~~~qiifvDTPG~~~~~~~l~~~~~~~~~~~l~~ 101 (311) T Consensus 14 ~~Ki~ilG~~~sGKTsll~~l~~~~~~~~~pT~g~----~~~~v~~~~~~~~lwD~~G~--------~~~~~~~~~y~~~ 81 (173) T cd04155 14 EPRILILGLDNAGKTTILKQLASEDISHITPTQGF----NIKTVQSDGFKLNVWDIGGQ--------RAIRPYWRNYFEN 81 (173) T ss_pred CCEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCE----EEEEEEECCEEEEEEECCCC--------HHHHHHHHHHCCC T ss_conf 75899997999988999999856998660681132----37999989999999855875--------1012689976555 Q ss_pred HHHHCCCCHHHHHHHC-C----HHHHHHHHHHCCCCCEEEEEECCCHH---HHHHHHHHHHHHHCCCCCCCCCCCCCCCC Q ss_conf 3210011000010000-0----00122345442872025787211010---43457888864100123343110001387 Q gi|254780941|r 102 ADIVCLVVDSHRELKV-N----IHDLLKEIAKRSSRLILILNKIDCVK---PERLLEQAEIANKLVFIEKTFMVSATKGH 173 (311) Q Consensus 102 aDiil~VvDa~~~~~~-~----~~~il~~l~~~~~p~IiVlNKiDlv~---~~~l~~~~~~~~~~~~~~~i~~ISAk~g~ 173 (311) T Consensus 82 a~~iI~VvD~td~~~~~~~~~~l~~~l~~~~~~~~PiLiv~NK~Dl~~a~~~~eI~~~l~l~~~~~~~~~i~~~SA~tG~ 161 (173) T cd04155 82 TDCLIYVIDSADKKRLEEAGAELVELLEEEKLAGVPVLVFANKQDLATAAPAEEIAEALNLHDLRDRTWHIQACSAKTGE 161 (173) T ss_pred CCEEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCHHHHHHHHCHHHCCCCCCEEEEEECCCCC T ss_conf 63799999667568899999999999741300698389999766677789999999985876434887589995785793 Q ss_pred CHHHHHHHHHHH Q ss_conf 426789999983 Q gi|254780941|r 174 GCDDVLNYLCST 185 (311) Q Consensus 174 Gid~L~~~L~~~ 185 (311) T Consensus 162 Gi~E~f~WL~~n 173 (173) T cd04155 162 GLQEGMNWVCKN 173 (173) T ss_pred CHHHHHHHHHCC T ss_conf 989999998549

HHsearch alignment for GI: 254780941 and conserved domain: cd04155