RPSBLAST alignment for GI: 254780941 and conserved domain: TIGR03598

>gnl|CDD|163346 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-binding protein YsxC/EngB. Members of this protein family are a GTPase associated with ribosome biogenesis, typified by YsxC from Bacillus subutilis. The family is widely but not universally distributed among bacteria. Members commonly are called EngB based on homology to EngA, one of several other GTPases of ribosome biogenesis. Cutoffs as set find essentially all bacterial members, but also identify large numbers of eukaryotic (probably organellar) sequences. This protein is found in about 80 percent of bacterial genomes. Length = 179
 Score = 47.9 bits (115), Expect = 4e-06
 Identities = 40/174 (22%), Positives = 69/174 (39%), Gaps = 37/174 (21%)

Query: 25  VALVGATNAGKSTLVNRFVG----AKVSIVTHKVQT---TRSIVRGIVSEKESQIVFLDT 77
           +A  G +N GKS+L+N        A+ S      +T   T+ I    V++       +D 
Sbjct: 21  IAFAGRSNVGKSSLINALTNRKKLARTS------KTPGRTQLINFFEVND---GFRLVDL 71

Query: 78  PGIFNAK------DSYHKLMIR--LSWSTIKHADIVCLVVDSHRELK---VNIHDLLKEI 126
           PG   AK      + + KL+         +K    V L++D    LK   + + + L+E 
Sbjct: 72  PGYGYAKVSKEEKEKWQKLIEEYLEKRENLKG---VVLLMDIRHPLKELDLEMLEWLRE- 127

Query: 127 AKRSSRLILILNKIDCVKP-ERLLEQAEIANKLVFIE---KTFMVSATKGHGCD 176
                 ++++L K D +K  E   +  +I   L          + S+ K  G D
Sbjct: 128 RGIP--VLIVLTKADKLKKSELNKQLKKIKKALKKDADDPSVQLFSSLKKTGID 179