RPSBLAST alignment for GI: 254780941 and conserved domain: PRK05291

>gnl|CDD|179996 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed. Length = 449
 Score = 96.7 bits (242), Expect = 6e-21
 Identities = 45/158 (28%), Positives = 76/158 (48%), Gaps = 10/158 (6%)

Query: 25  VALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSIVRGIVSEKESQIVFLDTPGIFNAK 84
           V + G  N GKS+L+N  +G + +IVT    TTR ++   ++     +  +DT GI    
Sbjct: 218 VVIAGRPNVGKSSLLNALLGEERAIVTDIAGTTRDVIEEHINLDGIPLRLIDTAGIRETD 277

Query: 85  DSYHKLMIRLSWSTIKHADIVCLVVDSHRELKVNIHDLLKEIAKRSSRLILILNKIDCVK 144
           D   K+ I  S   I+ AD+V LV+D+   L     ++L+E+  +   +I++LNK D   
Sbjct: 278 DEVEKIGIERSREAIEEADLVLLVLDASEPLTEEDDEILEELKDK--PVIVVLNKADLTG 335

Query: 145 PERLLEQAEIANKLVFIEKTFMVSATKGHGCDDVLNYL 182
              L E+          +    +SA  G G D++   +
Sbjct: 336 EIDLEEEN--------GKPVIRISAKTGEGIDELREAI 365