BLAST/BLAST alignment of GI: 254780941 and GI: 255764471
>gi|255764471|ref|YP_003064835.2| GTP-binding protein EngA [Candidatus Liberibacter asiaticus str. psy62] Length = 470
 Score = 43.1 bits (100), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 78/177 (44%), Gaps = 8/177 (4%)

Query: 11  EHKDFVQDNSRSGCVALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSIVRGIVSEKES 70
           E K  V++ S+   +A+VG  N GKSTL+NR +G    +   +   TR  V    + K  
Sbjct: 192 EGKSSVKNISKPLRIAVVGRPNVGKSTLINRLLGYNRLLTGSQSGITRDSVSISWNWKNH 251

Query: 71  QIVFLDTPGIFNAK---DSYHKLMIRLSWSTIKHADIVCLVVDSHRELKVNIHDLLKEIA 127
            I   DT G+       +S  +  ++ S  +++  +   +++D+    +     ++  + 
Sbjct: 252 PIEIFDTAGMRKPSRITESLEQKTVKKSMQSVRTCETTIVLLDATIPFEKQDLRIVDSVF 311

Query: 128 KRSSRLILILNKIDCVKPERLLEQ---AEIANKLVFIEKTFM--VSATKGHGCDDVL 179
                ++L LNK D V  +  L Q    +    L  I   ++  +S   G G DD++
Sbjct: 312 NTGHAVVLALNKWDMVSDKLNLLQDLRTKAIKNLPQIGDIYINTISGRTGEGLDDLM 368