HHsearch alignment for GI: 254780942 and conserved domain: COG1212

>COG1212 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cell envelope biogenesis, outer membrane].
Probab=99.74  E-value=2.4e-17  Score=117.17  Aligned_cols=226  Identities=19%  Similarity=0.258  Sum_probs=151.3

Q ss_pred             CCEEEEECCCCCCCCCCCCCCCEEEECCEEHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHCCCCCEEEEEECCCCCCH
Q ss_conf             40899945887723278887441258848579999999997799779999579889999973026972899985998861
Q gi|254780942|r    4 KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFPPTLSVEYYIQDCQQGT   83 (442)
Q Consensus         4 ~~~AiILAaG~GtRl~p~~pKpLlpi~gkpli~~~i~~l~~~g~~~ivvv~~~~~e~i~~~~~~~~~~i~~v~q~~~~GT   83 (442)
T Consensus         3 ~~~viIPAR~~STRL-p--gKPLadI~GkpmI~rV~e~a~~s~~~rvvVAT--Dde~I~~av~~~G~~avmT~~~h~SGT   77 (247)
T COG1212           3 KFVVIIPARLASTRL-P--GKPLADIGGKPMIVRVAERALKSGADRVVVAT--DDERIAEAVQAFGGEAVMTSKDHQSGT   77 (247)
T ss_pred             CEEEEEECCHHCCCC-C--CCCHHHHCCCHHHHHHHHHHHHCCCCEEEEEC--CCHHHHHHHHHHCCEEEECCCCCCCCC
T ss_conf             559998542002668-9--97357737960789999999873787289974--988999999970978996178889800


Q ss_pred             HHHHHHCCCCCCCCCCEE-EEEECCCCCCCCCCCCCCCCCCCCC-CCCCCEEEECCC------CCCCCEEEEC-CCCCEE
Q ss_conf             446641000012344605-8985154111533220000001358-610010010122------1574404202-333100
Q gi|254780942|r   84 AHAVLTAQDAIKPGYDDV-IIMYGDVPLVSSHTLKKAMDKIAQG-YSIAVVGFNADN------PKGYGRLLIK-NNEIIA  154 (442)
Q Consensus        84 a~Ai~~a~~~l~~~~~~~-lVl~GD~~li~~~~l~~l~~~~~~~-~~~~i~~~~~~d------p~~yGvV~~d-~~~v~~  154 (442)
T Consensus        78 -dR~~Ev~~~l~~~~~~iIVNvQGDeP~i~p~~I~~~~~~L~~~~~~~aTl~~~i~~~ee~~nPN~VKvV-~d~~g~ALY  155 (247)
T COG1212          78 -DRLAEVVEKLGLPDDEIIVNVQGDEPFIEPEVIRAVAENLENSNADMATLAVKITDEEEAFNPNVVKVV-LDKEGYALY  155 (247)
T ss_pred             -HHHHHHHHHCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHCCCCCEEEE-ECCCCCEEE
T ss_conf             -899999996599964299986588777797999999999873776604553433788884599827999-759982899


Q ss_pred             CCCCCCCCCCCC-----CCCCCCCCHHEECCHHHHHHHHHCCCCCCCCHHHHHHHHHHH--HHHHCCEEEEEECHHHEEC
Q ss_conf             100146675421-----000355600111250146777532888740011121148999--9730771799917214301
Q gi|254780942|r  155 IREENDATDEER-----KIHYCNSGLMAIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKA--RLDGKSIASIDVKEQEVCG  227 (442)
Q Consensus       155 i~Ek~d~~~~~~-----~~~lin~GiY~f~~~~L~~~l~~l~~~~~~gE~yltDii~~l--~~~g~~i~~~~~~~~~~~g  227 (442)
T Consensus       156 FSRs~--iP~~rd~~~~~p~l~HIGIYayr~~~L~~f~~~-~ps~L--E--~~E~LEQLR~Le~G~kI~v~i~~~~p~~g  228 (247)
T COG1212         156 FSRAP--IPYGRDNFGGTPFLRHIGIYAYRAGFLERFVAL-KPSPL--E--KIESLEQLRVLENGEKIHVEIVKEVPSIG  228 (247)
T ss_pred             EECCC--CCCCCCCCCCCCHHHEEEHHHHHHHHHHHHHCC-CCCHH--H--HHHHHHHHHHHHCCCEEEEEEECCCCCCC
T ss_conf             87687--877543467764364220588679999999706-99605--6--78778999998769757899841688889


Q ss_pred             CCCCCCCCCCCCCCCC
Q ss_conf             1121000000122222
Q gi|254780942|r  228 CNNRYELSLIENIWQS  243 (442)
Q Consensus       228 v~~~~~L~~~~~~~~~  243 (442)
T Consensus       229 VDT~EDLe~v~~~~~~  244 (247)
T COG1212         229 VDTPEDLERVRKILSN  244 (247)
T ss_pred             CCCHHHHHHHHHHHHH
T ss_conf             8988999999999875