HHsearch alignment for GI: 254780942 and conserved domain: PRK00725

>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional.
Probab=100.00  E-value=0  Score=361.53  Aligned_cols=345  Identities=19%  Similarity=0.235  Sum_probs=232.5

Q ss_pred             CCCCCEEEEECCCCCCCCCCC---CCCCEEEECCE-EHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHCCCC-------
Q ss_conf             987408999458877232788---87441258848-5799999999977997799995798899999730269-------
Q gi|254780942|r    1 MKRKRLAIVLAAGRGHRMKSS---SSKVLQKIAGK-PMISHVMETIAAAGIENVALVLGYGAEEITRINFPPT-------   69 (442)
Q Consensus         1 m~~~~~AiILAaG~GtRl~p~---~pKpLlpi~gk-pli~~~i~~l~~~g~~~ivvv~~~~~e~i~~~~~~~~-------   69 (442)
T Consensus        16 ~~~~~~aviLAGG~GtRL~pLT~~RpkpavPfgGryRlIDF~LSn~vnsGI~~V~V~t~y~~~SL~dHlg~GW~~~~~~~   95 (431)
T PRK00725         16 LPRKSVALILAGGRGSRLKELTDKRAKPAVYFGGKFRIIDFALSNCLNSGIRRIGVITQYQAHSLVRHIQRGWSFFREER   95 (431)
T ss_pred             CCCCEEEEEECCCCCCCCHHHHCCCCCCCCEECCCCEEEHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHCCCCCCCCCC
T ss_conf             56767999963888775515542784003153782354023676688759998999927787999998753424444468


Q ss_pred             -CEEEEE-------ECCCCCCHHHHHHHCCCCCCC-CCCEEEEEECCCCCCCCCCCCCCCCCC-CCCCCCCCEEEEC--C
Q ss_conf             -728999-------859988614466410000123-446058985154111533220000001-3586100100101--2
Q gi|254780942|r   70 -LSVEYY-------IQDCQQGTAHAVLTAQDAIKP-GYDDVIIMYGDVPLVSSHTLKKAMDKI-AQGYSIAVVGFNA--D  137 (442)
Q Consensus        70 -~~i~~v-------~q~~~~GTa~Ai~~a~~~l~~-~~~~~lVl~GD~~li~~~~l~~l~~~~-~~~~~~~i~~~~~--~  137 (442)
T Consensus        96 g~~~~~lp~~~~~~~~~~~~Gtadav~~n~~~l~~~~~eyvvI~~gD~--I~~~D~~~~l~~H~~~gAdiTi~~~~v~~~  173 (431)
T PRK00725         96 NEFVDLLPAQQRVSEENWYRGTADAVYQNLDIIRRYKAEYVVILAGDH--IYKMDYSRMLIDHVEKGADCTVGCLEVPRE  173 (431)
T ss_pred             CCCEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCCE--EECCCHHHHHHHHHHCCCCEEEEEEECCHH
T ss_conf             960797776112588765468589999999999756998799945988--981799999999987799879999984878


Q ss_pred             CCCCCCEEEEC-CCCCEECCCCCCCC---CCCCCCCCCCCCHHEECCHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHC
Q ss_conf             21574404202-33310010014667---542100035560011125014677753288874001112114899997307
Q gi|254780942|r  138 NPKGYGRLLIK-NNEIIAIREENDAT---DEERKIHYCNSGLMAIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGK  213 (442)
Q Consensus       138 dp~~yGvV~~d-~~~v~~i~Ek~d~~---~~~~~~~lin~GiY~f~~~~L~~~l~~l~~~~~~gE~yltDii~~l~~~g~  213 (442)
T Consensus       174 ~~~~fGv~~~D~~grV~~f~EKP~~p~~~~g~~~~~l~smGiYvf~~~~L~~~L~~~~~~~~~~~Dfg~diip~ll~~~~  253 (431)
T PRK00725        174 EASAFGVMAVDENDKIIAFVEKPADPPAMPGDPDKSLASMGIYVFDADYLYELLERDAADPNSSHDFGKDIIPKIVEEGK  253 (431)
T ss_pred             HCCCCCEEEECCCCCEEEEEECCCCCCCCCCCCCCCEECCEEEEECHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCC
T ss_conf             85547749999999899999337884346897553300015899859999999986521776421026778999997498


Q ss_pred             CEEEEEEC----------HHHEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCEEEEEEEEECCCCCEECCCCCC
Q ss_conf             71799917----------21430111210000001222221122122233210211527994112331784100122322
Q gi|254780942|r  214 SIASIDVK----------EQEVCGCNNRYELSLIENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFG  283 (442)
Q Consensus       214 ~i~~~~~~----------~~~~~gv~~~~~L~~~~~~~~~~~~~~~l~~gv~~~~p~~~~i~~~~~I~~~~~I~~~~~Ig  283 (442)
T Consensus       254 -~~ay~f~~~~~~~~~~~~GYw~dIgt~~sY~~AnmdLL~~~-------------~~~~lf~~~~pI~Tk~~~~pP~k~~  319 (431)
T PRK00725        254 -AYAHPFPLSCVRSDPEAEPYWRDVGTLDAYWQANLDLASVV-------------PELDMYDRNWPIRTYMESLPPAKFV  319 (431)
T ss_pred             -EEEEECCCCCCCCCCCCCCEEEECCCHHHHHHHHHHHHCCC-------------CHHHCCCCCCCCCCCCCCCCCCEEE
T ss_conf             -78986253334566566641788799999999987774578-------------4543258999633667768982786


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCEECCCCEE
Q ss_conf             34420002111631343321211121002134432000002586443202310211247854487455566398899899
Q gi|254780942|r  284 CGVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNI  363 (442)
Q Consensus       284 ~~~~Ig~~~~I~~~~~i~~~~Ig~~~~Ig~~~~i~~~s~i~~~~~Ig~~~ei~~s~i~~g~~i~~~~~igd~~iG~~~~i  363 (442)
T Consensus       320 ~~~~g-~------~g~v~nSli~~GcvI~G-~~V-enSVI~r~v~Ig~gA~V~nSIIm~~~~IG~ga~l~naIiDk~v~I  390 (431)
T PRK00725        320 QDRSG-S------HGMTLNSLVSGGCIISG-SVV-VQSVLFTRVRVNSFSNIDSAVLLPEVWVGRSCRLRRCVIDRACVI  390 (431)
T ss_pred             CCCCC-C------CCCEECCEEECCEEEEC-CEE-EECCCCCCCEECCCCEEEEEEECCCCEECCCCEEEEEEECCCCEE
T ss_conf             35676-6------54143679839989969-999-829825998999998996139889898899999971398999898


Q ss_pred             CCCEEEC
Q ss_conf             7980883
Q gi|254780942|r  364 GAGTITC  370 (442)
Q Consensus       364 g~g~i~~  370 (442)
T Consensus       391 ~~G~~Ig  397 (431)
T PRK00725        391 PEGMVIG  397 (431)
T ss_pred             CCCCEEC
T ss_conf             9899989