HHsearch alignment for GI: 254780942 and conserved domain: cd06421

>cd06421 CESA_CelA_like CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
Probab=94.96  E-value=0.19  Score=26.70  Aligned_cols=103  Identities=13%  Similarity=0.146  Sum_probs=63.2

Q ss_pred             EEEECCEE--HHHHHHHHHHHCCC--C--EEEEEECCCHHHHHHHHCCC--CCEEEEEECCCCCC-HHHHHHHCCCCCCC
Q ss_conf             12588485--79999999997799--7--79999579889999973026--97289998599886-14466410000123
Q gi|254780942|r   26 LQKIAGKP--MISHVMETIAAAGI--E--NVALVLGYGAEEITRINFPP--TLSVEYYIQDCQQG-TAHAVLTAQDAIKP   96 (442)
Q Consensus        26 Llpi~gkp--li~~~i~~l~~~g~--~--~ivvv~~~~~e~i~~~~~~~--~~~i~~v~q~~~~G-Ta~Ai~~a~~~l~~   96 (442)
T Consensus         6 iIPayNE~~~~i~~~l~sl~~q~YP~~~~eIiVvdD~std~t~~~~~~~~~~~~~~~~~~~~~~g~Ka~alN~g~~~a~g   85 (234)
T cd06421           6 FIPTYNEPLEIVRKTLRAALAIDYPHDKLRVYVLDDGRRPELRALAAELGVEYGYRYLTRPDNRHAKAGNLNNALAHTTG   85 (234)
T ss_pred             EEECCCCCHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHHCCC
T ss_conf             99838997899999999999679999828999998989878898888845664368887488999769999999997789


Q ss_pred             CCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             44605898515411153322000000135861001
Q gi|254780942|r   97 GYDDVIIMYGDVPLVSSHTLKKAMDKIAQGYSIAV  131 (442)
Q Consensus        97 ~~~~~lVl~GD~~li~~~~l~~l~~~~~~~~~~~i  131 (442)
T Consensus        86 --d~v~~~DaD~-~~~~~~L~~~~~~~~~~~~v~~  117 (234)
T cd06421          86 --DFVAILDADH-VPTPDFLRRTLGYFLDDPKVAL  117 (234)
T ss_pred             --CEEEEECCCC-CCCHHHHHHHHHHHHHCCCEEE
T ss_conf             --9999988987-7087699999999986997589