BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780942|ref|YP_003065355.1| UDP-N-acetylglucosamine
pyrophosphorylase protein [Candidatus Liberibacter asiaticus str.
psy62]
         (442 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780942|ref|YP_003065355.1| UDP-N-acetylglucosamine pyrophosphorylase protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040619|gb|ACT57415.1| UDP-N-acetylglucosamine pyrophosphorylase protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 442

 Score =  912 bits (2356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/442 (100%), Positives = 442/442 (100%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE
Sbjct: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM
Sbjct: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
           DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG
Sbjct: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
           LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI
Sbjct: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL
Sbjct: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN
Sbjct: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
           VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS
Sbjct: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420

Query: 421 LVFARSRQIVKEDGALSMRKKK 442
           LVFARSRQIVKEDGALSMRKKK
Sbjct: 421 LVFARSRQIVKEDGALSMRKKK 442


>gi|315122355|ref|YP_004062844.1| UDP-N-acetylglucosamine pyrophosphorylase protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495757|gb|ADR52356.1| UDP-N-acetylglucosamine pyrophosphorylase protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 442

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/442 (75%), Positives = 385/442 (87%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           MKRK LAIVLAAG G RMKSS  KVLQKIAGKPMI HVMETI+AAGI +VALVLG+GAE 
Sbjct: 1   MKRKCLAIVLAAGSGQRMKSSFPKVLQKIAGKPMICHVMETISAAGIRDVALVLGHGAEA 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           +++I+FP  LSVEY+IQD QQGTAHAVL+AQDAIK GYDD+IIMYGDVPLV +HTLK+AM
Sbjct: 61  VSKIDFPAELSVEYFIQDSQQGTAHAVLSAQDAIKRGYDDIIIMYGDVPLVPAHTLKEAM 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
           DKI QGYSIAV+GFN DNP+GYGRLLI NNE++AIREE DA+D E+KI YCNSGLMAIDG
Sbjct: 121 DKIVQGYSIAVIGFNTDNPEGYGRLLINNNELVAIREEKDASDAEKKIKYCNSGLMAIDG 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
           ++I+DWLL+I K   SQEYYLTDI+  A+  GK+IAS+D  EQEV GCNNR+ELS++E+I
Sbjct: 181 VHILDWLLKINKENKSQEYYLTDIVAIAQFAGKTIASVDAMEQEVYGCNNRHELSIVESI 240

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           WQ   RR+MM+SGV MI+PETVFLSHDTII PDTVIEPHVFFG GV +E+   IRAFSYL
Sbjct: 241 WQVNRRRRMMMSGVAMISPETVFLSHDTIIDPDTVIEPHVFFGYGVVVESAAHIRAFSYL 300

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EGVH+GK  +IGPFAR+R  TTIE+NVRIGNFCE+K   I EGSKINHLSYVGDS VG++
Sbjct: 301 EGVHVGKNAVIGPFARLRPGTTIEQNVRIGNFCEIKNTVIGEGSKINHLSYVGDSFVGES 360

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
           VNIGAG +TCNYDG +K++THI +NAFIGSNSSLIAP+TIG G+YVASGS+ITQDTPENS
Sbjct: 361 VNIGAGVVTCNYDGINKHETHICDNAFIGSNSSLIAPVTIGSGSYVASGSVITQDTPENS 420

Query: 421 LVFARSRQIVKEDGALSMRKKK 442
           LV ARSRQIVKE  AL +RK+K
Sbjct: 421 LVLARSRQIVKEKKALLIRKRK 442


>gi|218516173|ref|ZP_03513013.1| UDP-N-acetylglucosamine pyrophosphorylase protein [Rhizobium etli
           8C-3]
          Length = 449

 Score =  510 bits (1314), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 238/441 (53%), Positives = 317/441 (71%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M+R  LA++LAAG   RMKSS SKVL  +AG+PMI+HV+E +A+AGI +VALV+G  AEE
Sbjct: 1   MERTCLAVILAAGDSTRMKSSKSKVLHPVAGRPMIAHVVEAVASAGISSVALVVGRDAEE 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           + +      + +E Y+Q  + GT HAVL A+DAI  GYDD+++ YGDVPL +   LK A 
Sbjct: 61  VAKAASIDGVGIESYLQKDRLGTGHAVLAARDAIAKGYDDILVTYGDVPLQTDAPLKAAR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
             +A G  I V+GF++D P GYGRLL+K+ E+IAIREE DATD ER + +CNSGLMAI+G
Sbjct: 121 QGLADGSDIVVIGFHSDRPTGYGRLLVKDGELIAIREEKDATDAERTVTWCNSGLMAING 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
              +D L +I  +    E+YLTD++E AR  G  + ++D  E E+ GCNNR EL++IE  
Sbjct: 181 RKALDLLSRIGNSNAKGEFYLTDLVEIARSLGGRVTAVDAPEIEMTGCNNRAELAVIERF 240

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           WQ R RR+MM++GVTMIAPETVFLS+DTII  D +IEP+V FG G  I++   I AFS++
Sbjct: 241 WQERRRREMMLAGVTMIAPETVFLSYDTIIGQDALIEPNVVFGPGAVIDSGAVIHAFSHI 300

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EG H+ +   +GPF R+R    +    ++GNFCEVK   I EG+K+NHL+Y+GD+VVG  
Sbjct: 301 EGAHVSEGATVGPFGRLRPGADLANGAKVGNFCEVKNGRIGEGAKVNHLTYIGDAVVGAG 360

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
            NIGAGTITCNYDG +K +T I ENAFIGSNSSL+AP+TIG G YV SGS+IT D P ++
Sbjct: 361 SNIGAGTITCNYDGVNKSETVIGENAFIGSNSSLVAPVTIGDGAYVGSGSVITADVPADA 420

Query: 421 LVFARSRQIVKEDGALSMRKK 441
           L   R+RQ +K + A  +R++
Sbjct: 421 LALGRARQEIKPERAKLLRER 441


>gi|190891734|ref|YP_001978276.1| UDP-N-acetylglucosamine pyrophosphorylase [Rhizobium etli CIAT 652]
 gi|254798786|sp|B3PZN3|GLMU_RHIE6 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|190697013|gb|ACE91098.1| UDP-N-acetylglucosamine pyrophosphorylase protein [Rhizobium etli
           CIAT 652]
          Length = 453

 Score =  510 bits (1314), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 238/441 (53%), Positives = 317/441 (71%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M+R  LA++LAAG   RMKSS SKVL  +AG+PMI+HV+E +A+AGI +VALV+G  AEE
Sbjct: 1   MERTCLAVILAAGDSTRMKSSKSKVLHPVAGRPMIAHVVEAVASAGISSVALVVGRDAEE 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           + +      + +E Y+Q  + GT HAVL A+DAI  GYDD+++ YGDVPL +   LK A 
Sbjct: 61  VAKAASIDGVGIESYLQKDRLGTGHAVLAARDAIAKGYDDILVTYGDVPLQTDAPLKAAR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
             +A G  I V+GF++D P GYGRLL+K+ E+IAIREE DATD ER + +CNSGLMAI+G
Sbjct: 121 QGLADGSDIVVIGFHSDRPTGYGRLLVKDGELIAIREEKDATDAERTVTWCNSGLMAING 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
              +D L +I  +    E+YLTD++E AR  G  + ++D  E E+ GCNNR EL++IE  
Sbjct: 181 RKALDLLSRIGNSNAKGEFYLTDLVEIARSLGGRVTAVDAPEIEMTGCNNRAELAVIERF 240

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           WQ R RR+MM++GVTMIAPETVFLS+DTII  D +IEP+V FG G  I++   I AFS++
Sbjct: 241 WQERRRREMMLAGVTMIAPETVFLSYDTIIGQDALIEPNVVFGPGAVIDSGAVIHAFSHI 300

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EG H+ +   +GPF R+R    +    ++GNFCEVK   I EG+K+NHL+Y+GD+VVG  
Sbjct: 301 EGAHVSEGATVGPFGRLRPGADLANGAKVGNFCEVKNGRIGEGAKVNHLTYIGDAVVGAG 360

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
            NIGAGTITCNYDG +K +T I ENAFIGSNSSL+AP+TIG G YV SGS+IT D P ++
Sbjct: 361 SNIGAGTITCNYDGVNKSETVIGENAFIGSNSSLVAPVTIGDGAYVGSGSVITADVPADA 420

Query: 421 LVFARSRQIVKEDGALSMRKK 441
           L   R+RQ +K + A  +R++
Sbjct: 421 LALGRARQEIKPERAKLLRER 441


>gi|327188307|gb|EGE55526.1| UDP-N-acetylglucosamine pyrophosphorylase protein [Rhizobium etli
           CNPAF512]
          Length = 453

 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 239/441 (54%), Positives = 316/441 (71%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M+R  LA++LAAG   RMKSS SKVL  +AG+PMI+HV+E +A+AGI +VALV+G  AEE
Sbjct: 1   MERTCLAVILAAGDSTRMKSSKSKVLHPVAGRPMIAHVVEAVASAGIASVALVVGRDAEE 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           + +      + VE Y+Q  + GT HAVL A++AI   YDD+++ YGDVPL +   LK A 
Sbjct: 61  VAKAASIDGVGVESYLQQQRLGTGHAVLAAREAIARNYDDILVTYGDVPLQTDGPLKAAR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
             +A G  I V+GF+ D P GYGRLL+K+ E+IAIREE DATD ER + +CNSGLMAI+G
Sbjct: 121 QGLADGSDIVVIGFHTDRPTGYGRLLVKDGELIAIREEKDATDAERTVTWCNSGLMAING 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
              +D L +I       E+YLTD++E AR  G  + ++D  E E+ GCNNR EL++IE  
Sbjct: 181 RKALDLLSRIGNANAKGEFYLTDLVEIARSLGGRVTAVDAPEIEMTGCNNRAELAVIERF 240

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           WQ R RR+MM++GVTMIAPETVFLS+DTII  D +IEP+V FG G  I++   I AFS++
Sbjct: 241 WQERRRREMMLAGVTMIAPETVFLSYDTIIGQDALIEPNVVFGPGAVIDSGAVIHAFSHI 300

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EG H+ +   +GPFAR+R    + K  ++GNFCEVK   I EG+K+NHL+Y+GD+VVG  
Sbjct: 301 EGAHVSEGATVGPFARLRPGADLAKGSKVGNFCEVKNGRIGEGAKVNHLTYIGDAVVGAG 360

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
            NIGAGTITCNYDG +K +T I ENAFIGSNSSL+AP+TIG G YV SGS+IT D P ++
Sbjct: 361 SNIGAGTITCNYDGVNKSETVIGENAFIGSNSSLVAPVTIGDGAYVGSGSVITADVPADA 420

Query: 421 LVFARSRQIVKEDGALSMRKK 441
           L   R+RQ +K + A  +R++
Sbjct: 421 LALGRARQEIKPERAKLLRER 441


>gi|86357709|ref|YP_469601.1| UDP-N-acetylglucosamine pyrophosphorylase protein [Rhizobium etli
           CFN 42]
 gi|109892115|sp|Q2K8G2|GLMU_RHIEC RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|86281811|gb|ABC90874.1| UDP-N-acetylglucosamine pyrophosphorylase protein [Rhizobium etli
           CFN 42]
          Length = 453

 Score =  501 bits (1289), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 233/441 (52%), Positives = 316/441 (71%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M+R  LA++LAAG   RMKSS SKVL  +AG+PMI+HV+E +A+AGI +VALV+G  A E
Sbjct: 1   MERTCLAVILAAGDSTRMKSSKSKVLHPVAGRPMIAHVVEAVASAGISSVALVVGRDAGE 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           + +      + +E Y+Q  + GT HAVL A++AI  GYDD+++ YGDVPL ++  LK A 
Sbjct: 61  VAKAASIDGVGIEAYLQQQRLGTGHAVLAAREAIAKGYDDILVTYGDVPLQTNGPLKAAR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
             +A+G  + V+GF+ D P GYGRLL+K+ E+IAIREE DA+D ER + +CNSGLMAI+G
Sbjct: 121 QGLAEGSDVVVIGFHTDRPTGYGRLLVKDGELIAIREEKDASDAERAVTWCNSGLMAING 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
              +D L +I       E+YLTD++E AR  G  + ++D  E E+ GCNNR EL++IE  
Sbjct: 181 RKALDLLSRIGNANAKGEFYLTDLVEIARSLGGRVTAVDAPEIEMTGCNNRAELAVIERF 240

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           WQ R RR+MM++GVTMIAPETVFLS+DT+I  D +IEP+V FG G  I++   I AFS++
Sbjct: 241 WQERRRREMMLAGVTMIAPETVFLSYDTVIGQDALIEPNVVFGPGAVIDSGAVIHAFSHI 300

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EG H+ +   +GPFAR+R    +    ++GNFCEVK   I  G+K+NHL+Y+GD+VVG  
Sbjct: 301 EGAHVSEGATVGPFARLRPGADLAMGSKVGNFCEVKNGRIGVGAKVNHLTYIGDAVVGAG 360

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
            NIGAGTITCNYDG +K +T I ENAFIGSNSSL+AP+TIG G Y+ASGS+IT D P ++
Sbjct: 361 SNIGAGTITCNYDGVNKSETVIGENAFIGSNSSLVAPVTIGDGAYIASGSVITVDVPADA 420

Query: 421 LVFARSRQIVKEDGALSMRKK 441
           L   R+RQ +K   A  +R++
Sbjct: 421 LALGRARQEIKPGRATLLRQR 441


>gi|218681827|ref|ZP_03529564.1| putative bifunctional GlmU protein [Rhizobium etli CIAT 894]
          Length = 428

 Score =  500 bits (1288), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 230/428 (53%), Positives = 308/428 (71%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M+R  LA++LAAG   RMKSS SKVL  +AG+PMI+HV+E +A+AGI +VALV+G  AE+
Sbjct: 1   MERTCLAVILAAGDSTRMKSSKSKVLHPVAGRPMIAHVVEAVASAGIASVALVVGRDAED 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           + +      + +E Y+Q  + GT HAVL A++AI  GYDD+++ YGDVPL +   LK A 
Sbjct: 61  VAKAAAIDGVGIESYLQKERLGTGHAVLAAREAIAKGYDDILVTYGDVPLQTDAPLKAAR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
             +A G  + V+GF+ D P GYGR+L+K+ E+IAIREE DATD ER + +CNSGLMAI+G
Sbjct: 121 QGLADGSDVVVIGFHTDRPTGYGRVLVKDGELIAIREEKDATDAERTVTWCNSGLMAING 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
              +D L +I       E+YLTD++E AR  G  + ++D  E E+ GCNNR EL++IE  
Sbjct: 181 RKALDLLSRIGNANAKGEFYLTDLVEIARSLGGRVTAVDAPEIEMTGCNNRAELAVIERF 240

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           WQ R R QMM++GVTMIAPETVFLS+DT+I  D +IEP+V FG G  I++   I AFS++
Sbjct: 241 WQERRRHQMMLAGVTMIAPETVFLSYDTVIGQDALIEPNVVFGAGAVIDSGAVIHAFSHI 300

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EG H+ +   +GPFAR+R    +    ++GNFCEVK   I EG+K+NHL+Y+GD+V+G  
Sbjct: 301 EGAHVSQGATVGPFARLRPGADLADGSKVGNFCEVKNGRIGEGAKVNHLTYIGDAVIGAG 360

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
            NIGAGTITCNYDG +K +T I ENAFIGSNSSL+AP+TIG G Y+ASGS+IT D P ++
Sbjct: 361 SNIGAGTITCNYDGVNKSETVIGENAFIGSNSSLVAPVTIGDGAYIASGSVITADVPADA 420

Query: 421 LVFARSRQ 428
           L   R+RQ
Sbjct: 421 LALGRARQ 428


>gi|218673900|ref|ZP_03523569.1| UDP-N-acetylglucosamine pyrophosphorylase protein [Rhizobium etli
           GR56]
          Length = 453

 Score =  500 bits (1287), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 234/441 (53%), Positives = 313/441 (70%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M+R  LA++LAAG   RMKSS SKVL  +AG+PMI+HV+E +A+AGI  VALV+G  AEE
Sbjct: 1   MERTCLAVILAAGDSTRMKSSKSKVLHPVAGRPMIAHVVEAVASAGISAVALVVGRDAEE 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           + +      + VE Y+Q  + GT HAVL A++AI   Y+D+++ YGDVPL +   LK A 
Sbjct: 61  VAKAASIDGVGVESYLQQQRLGTGHAVLAAREAIAKEYEDILVTYGDVPLQTDGPLKAAR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
             +A G  I V+GF+ D P GYGRLL+K+ E+IAIREE DATD ER + +CNSGLMAI+G
Sbjct: 121 QGLADGSDIVVIGFHTDRPTGYGRLLVKDGELIAIREEKDATDAERAVTWCNSGLMAING 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
              +D L +I       E+YLTD++E AR  G  + +++  E E+ GCNNR EL++IE  
Sbjct: 181 RKALDLLSRIGNANAKGEFYLTDLVEIARSLGGRVTAVNAPEIEMTGCNNRAELAVIERF 240

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           WQ R RR+MM++GVTMIAPETVFLS+DT+I  D +IEP+V FG G  I++   I AFS++
Sbjct: 241 WQERRRREMMLAGVTMIAPETVFLSYDTVIGQDALIEPNVVFGPGAVIDSGAVIHAFSHI 300

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EG H+ +   +GPFAR+R    +    ++GNFCEVK   + EG+K+NHL+Y+GD+VVG  
Sbjct: 301 EGAHVSESATVGPFARLRPGADLASGAKVGNFCEVKNGRLGEGAKVNHLTYIGDAVVGAG 360

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
            NIGAGTITCNYDG +K +T I ENAFIGSNSSL+AP+TIG G YV SGS+IT D P ++
Sbjct: 361 SNIGAGTITCNYDGVNKSETVIGENAFIGSNSSLVAPVTIGDGAYVGSGSVITVDVPADA 420

Query: 421 LVFARSRQIVKEDGALSMRKK 441
           L   R+RQ +K   A  +R++
Sbjct: 421 LALGRARQEIKPGRASLLRER 441


>gi|209549321|ref|YP_002281238.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|254798787|sp|B5ZP51|GLMU_RHILW RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|209535077|gb|ACI55012.1| UDP-N-acetylglucosamine pyrophosphorylase [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 453

 Score =  499 bits (1284), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 234/441 (53%), Positives = 313/441 (70%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M+R  LA++LAAG   RMKSS SKVL  +AG+PMI+HV+E +A+AGI +VALV+G  AEE
Sbjct: 1   MERTCLAVILAAGDSTRMKSSKSKVLHPVAGRPMIAHVVEAVASAGISSVALVVGRDAEE 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           + +      + +E  +Q  + GT HAVL A++AI  GYDD+++ YGDVPL +   LK A 
Sbjct: 61  VAKAASIAGVGIEACLQKERLGTGHAVLAAREAIAKGYDDILVTYGDVPLQTDGPLKAAR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
             +A G  I V+GF+ D P GYGRLL+K+ E+IAIREE DATD ER + +CNSGLMAI+G
Sbjct: 121 QGLADGSDIVVIGFHTDRPTGYGRLLVKDGELIAIREEKDATDAERTVTWCNSGLMAING 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
              +D L +I       E+YLTD++E AR  G  + ++D  E E+ GCN R EL++IE  
Sbjct: 181 RKALDLLQRIGNANAKGEFYLTDLVEIARSLGGRVTAVDAPEIEMTGCNTRAELAVIERF 240

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           WQ R R Q+M+SGVTMIAPETVFLS+DT+I  D +IEP+V FG G  I++   I AFS++
Sbjct: 241 WQERRRHQLMLSGVTMIAPETVFLSYDTVIGQDALIEPNVVFGPGAVIDSGAVIHAFSHI 300

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EG H+ +   +GPFAR+R    +    ++GNFCEVK   I EG+K+NHL+Y+GD+V+G  
Sbjct: 301 EGAHVSQGATVGPFARLRPGADLGNGSKVGNFCEVKNGRIGEGAKVNHLTYIGDAVIGAG 360

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
            NIGAGTITCNYDG +K +T I ENAFIGSNSSL+AP+TIG G Y+ASGS+IT D P ++
Sbjct: 361 SNIGAGTITCNYDGVNKSETVIGENAFIGSNSSLVAPVTIGDGAYIASGSVITADVPADA 420

Query: 421 LVFARSRQIVKEDGALSMRKK 441
           L   R+RQ +K   A  +R++
Sbjct: 421 LALGRARQEIKPGRASLLRER 441


>gi|241204634|ref|YP_002975730.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240858524|gb|ACS56191.1| UDP-N-acetylglucosamine pyrophosphorylase [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 453

 Score =  498 bits (1282), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 231/441 (52%), Positives = 314/441 (71%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M+R  LA++LAAG   RMKSS SKVL  +AG+PMI+HV+E +A+AGI +VALV+G  AE+
Sbjct: 1   MERTCLAVILAAGDSTRMKSSKSKVLHPVAGRPMIAHVVEAVASAGISSVALVVGRDAED 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           + +      + +E Y+Q  + GT HAVL A++AI  GYDD+++ YGDVPL +   LK A 
Sbjct: 61  VAKAASIAGVDIESYLQKERLGTGHAVLAAREAIAKGYDDILVTYGDVPLQTEGPLKAAR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
             +A G  + V+GF+ D P GYGRLL+K+ E+IAIREE DATD ER + +CNSGLMAI+G
Sbjct: 121 QGLADGSDVVVIGFHTDRPTGYGRLLVKDGELIAIREEKDATDAERTVTWCNSGLMAING 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
              +D L +I       E+YLTD++E AR  G  + ++D  E E+ GCN R EL++IE  
Sbjct: 181 RKALDLLSRIGNANAKGEFYLTDLVEIARALGGRVTAVDAPEIEMTGCNTRAELAVIERF 240

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           WQ R R QMM+SGVTMIAPETVFL++DT+I  D +IEP+V FG G  I++   I AFS++
Sbjct: 241 WQERRRHQMMLSGVTMIAPETVFLAYDTVIGQDALIEPNVVFGPGAVIDSGAVIHAFSHI 300

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EG H+ +   +GPFAR+R    +    ++GNFCEVK   + EG+K+NHL+Y+GD+V+G  
Sbjct: 301 EGAHVSQGATVGPFARLRPGADLGTGSKVGNFCEVKNGRLGEGAKVNHLTYIGDAVIGAG 360

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
            NIGAGTITCNYDG +K +T I ENAFIGSNSSL+AP+TIG G Y+ASGS+IT + P ++
Sbjct: 361 SNIGAGTITCNYDGVNKSETVIGENAFIGSNSSLVAPVTIGDGAYIASGSVITVNVPADA 420

Query: 421 LVFARSRQIVKEDGALSMRKK 441
           L   R+RQ +K   A  +R++
Sbjct: 421 LALGRARQEIKPGRATLLRER 441


>gi|116252133|ref|YP_767971.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Rhizobium leguminosarum bv. viciae
           3841]
 gi|119370587|sp|Q1MGP8|GLMU_RHIL3 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|115256781|emb|CAK07871.1| putative bifunctional GlmU protein [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 453

 Score =  496 bits (1278), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 230/441 (52%), Positives = 314/441 (71%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M+R  LA++LAAG   RMKSS SKVL  +AG+PMI+HV+E +A+AGI +VALV+G  AE+
Sbjct: 1   MERTCLAVILAAGDSTRMKSSKSKVLHPVAGRPMIAHVVEAVASAGISSVALVVGRDAED 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           + +      + +E ++Q  + GT HAVL A++AI  GYDD+++ YGDVPL +   LK A 
Sbjct: 61  VAKAASIAGVDIESFLQKERLGTGHAVLAAREAIAKGYDDILVTYGDVPLQTDGPLKAAR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
             +A G  + V+GF+ D P GYGRLL+K+ E+IAIREE DATD ER + +CNSGLMAI+G
Sbjct: 121 QGLADGSDVVVIGFHTDRPTGYGRLLVKDGELIAIREEKDATDAERTVTWCNSGLMAING 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
              +D L +I       E+YLTD++E AR  G  + ++D  E E+ GCN R EL++IE  
Sbjct: 181 RKALDLLSRIGNANAKGEFYLTDLVEIARSLGGRVTAVDAPEIEMTGCNTRAELAVIERF 240

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           WQ R R QMM+SGVTMIAPETVFL++DT+I  D +IEP+V FG G  I++   I AFS++
Sbjct: 241 WQERRRHQMMLSGVTMIAPETVFLAYDTVIGQDALIEPNVVFGPGAVIDSGAVIHAFSHI 300

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EG H+ +   +GPFAR+R    +    ++GNFCEVK   + EG+K+NHL+Y+GD+V+G  
Sbjct: 301 EGAHVSQGATVGPFARLRPGADLGTGSKVGNFCEVKNGRLGEGAKVNHLTYIGDAVIGAG 360

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
            NIGAGTITCNYDG +K +T I ENAFIGSNSSL+AP+TIG G Y+ASGS+IT + P ++
Sbjct: 361 SNIGAGTITCNYDGVNKSETVIGENAFIGSNSSLVAPVTIGDGAYIASGSVITVNVPADA 420

Query: 421 LVFARSRQIVKEDGALSMRKK 441
           L   R+RQ +K   A  +R++
Sbjct: 421 LALGRARQEIKTGRATLLRER 441


>gi|15889091|ref|NP_354772.1| UDP-N-acetylglucosamine pyrophosphorylase [Agrobacterium
           tumefaciens str. C58]
 gi|81591412|sp|Q8UEH0|GLMU_AGRT5 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|15156895|gb|AAK87557.1| UDP-N-acetylglucosamine pyrophosphorylase [Agrobacterium
           tumefaciens str. C58]
          Length = 453

 Score =  495 bits (1275), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 242/441 (54%), Positives = 324/441 (73%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M+R  LA++LAAG   RMKSS SKVL  +AG+PMI HV+E +A AG+  VALV+G  A+ 
Sbjct: 1   MERSSLAVILAAGDSTRMKSSKSKVLHPVAGRPMIGHVVEAVAGAGVGAVALVVGRDADN 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           +        L VE ++Q  ++GT HAVL A++AIK G+DDVI+ YGDVPL++S TL +A 
Sbjct: 61  VAAAASLKGLQVEAFLQKERKGTGHAVLAAREAIKRGFDDVIVAYGDVPLITSATLDRAR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
           + IA G  +AV+GF+ D P GYGRLL++N E++AIREE DATDEERK+ +CNSGLMAI+G
Sbjct: 121 EAIAAGADVAVIGFHTDRPTGYGRLLVENGELVAIREEKDATDEERKVTWCNSGLMAING 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
              +D L +I  + V  EYYLTD++E AR  G+   +ID  E+E+ GCNNR EL+ IE +
Sbjct: 181 RNALDLLDRIGNSNVKGEYYLTDVVEIARSLGRRAIAIDAPEKELTGCNNRAELAFIERL 240

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           WQ R R ++M+ GV+MIAPETVFLS DT I  D +IEP+V FG GV+IE    + AFS+L
Sbjct: 241 WQERRRHELMVDGVSMIAPETVFLSFDTKIGQDVLIEPNVVFGPGVTIEPGAIVHAFSHL 300

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EG H+ +  ++GPFAR+R    +  N ++GNFCEVKKA I EG+K+NHL+Y+GD+ VG  
Sbjct: 301 EGAHLAEGAVVGPFARLRPGANLHANAKVGNFCEVKKAEIGEGAKVNHLTYIGDAFVGAG 360

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
            NIGAG ITCNYDG +K +T I  N+FIGSNSSL+AP+TIG+  Y+ASGS+IT D P ++
Sbjct: 361 SNIGAGAITCNYDGYNKSETRIGANSFIGSNSSLVAPVTIGERAYIASGSVITDDVPADA 420

Query: 421 LVFARSRQIVKEDGALSMRKK 441
           L F R+RQ VK   A+++R++
Sbjct: 421 LAFGRARQEVKPGRAVALRER 441


>gi|222148603|ref|YP_002549560.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Agrobacterium vitis S4]
 gi|254798700|sp|B9JWC4|GLMU_AGRVS RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|221735589|gb|ACM36552.1| UDP-N-acetylglucosamine pyrophosphorylase [Agrobacterium vitis S4]
          Length = 452

 Score =  490 bits (1261), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 231/442 (52%), Positives = 322/442 (72%), Gaps = 2/442 (0%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M R  LA++LAAG   RMKS+ SKVL  +AG PMI+HVM+ IAA+ I +VALV+G  A++
Sbjct: 1   MSRTCLAVILAAGDSTRMKSAMSKVLHPVAGLPMIAHVMQAIAASDIADVALVVGRDADK 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           +T+      LSV  ++Q  + GT HAVLTA++A+  GYDD+++ YGD PL++   L  A 
Sbjct: 61  VTKAASIKGLSVTPFVQTERLGTGHAVLTAREALARGYDDILVAYGDAPLITPGPLLAAR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
             +A G  IAV+GF+ + P GYGRLL+++ E++AIREE DA+DEERK+ +CNSGLMAI+G
Sbjct: 121 AALADGNDIAVIGFHTEKPTGYGRLLVEDGELVAIREEKDASDEERKVTWCNSGLMAING 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKAR-LDGKSIASIDVKEQEVCGCNNRYELSLIEN 239
              +D L +I       EYYLTD++E  R L GK++A +D  E E+ GCNNR EL++IE 
Sbjct: 181 AKALDLLGRIGNANAKGEYYLTDLVEIIRSLGGKAVA-VDAPEAELAGCNNRAELAVIEK 239

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSY 299
           +WQ R R ++M+SGV+MIAPETVFL++DT++  D +IEP+V FG GV++E+   I AFS+
Sbjct: 240 LWQERRRHELMLSGVSMIAPETVFLAYDTVLAQDVLIEPNVVFGPGVTVESGAVIHAFSH 299

Query: 300 LEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGK 359
           LEG H+     +GPFAR+R    + +  ++GNFCEVKKA I  G+KINHL+Y+GD+ +G 
Sbjct: 300 LEGAHVASGATVGPFARLRPGANLGEGSKVGNFCEVKKAEIGAGAKINHLTYIGDAFIGA 359

Query: 360 NVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPEN 419
             NIGAGTITCNYDG +K++T I  NAFIGSNS+L+AP+TIG G ++ASGS+IT D P +
Sbjct: 360 ETNIGAGTITCNYDGVNKHETRIGANAFIGSNSALVAPVTIGDGAFIASGSVITDDVPAD 419

Query: 420 SLVFARSRQIVKEDGALSMRKK 441
           +L   R+RQ +K + A  +R++
Sbjct: 420 ALALGRARQEIKPERAKIIRER 441


>gi|325293173|ref|YP_004279037.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase [Agrobacterium
           sp. H13-3]
 gi|325061026|gb|ADY64717.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase [Agrobacterium
           sp. H13-3]
          Length = 453

 Score =  488 bits (1255), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 240/441 (54%), Positives = 323/441 (73%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M+R  LA++LAAG   RMKSS SKVL  +AG+PMI HV+E +A AG+  VALV+G  A+ 
Sbjct: 1   MERSSLAVILAAGDSTRMKSSKSKVLHPVAGRPMIGHVVEAVAGAGVGAVALVVGRDADN 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           +        L VE ++Q  ++GT HAVL A++AI+  +DDVI+ YGDVPL++S TL +A 
Sbjct: 61  VAAAASLKGLQVEAFLQKERKGTGHAVLAAREAIERDFDDVIVAYGDVPLITSATLDRAR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
           + IA G  +AV+GF+ D P GYGRLL++N E++AIREE DATDEERK+ +CNSGLMAI+G
Sbjct: 121 EAIADGADVAVIGFHTDRPTGYGRLLVENGELVAIREEKDATDEERKVTWCNSGLMAING 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
              +D L +I  + V  EYYLTDI+E AR  G+   +ID  E+E+ GCNNR EL+ IE +
Sbjct: 181 RNALDLLDRIGNSNVKGEYYLTDIVEIARSLGRRAIAIDAPEKELTGCNNRAELAFIERL 240

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           WQ R R ++M+ GV+MIAPETVFLS DT I  D +IEP+V FG GV+IE    I AFS+L
Sbjct: 241 WQERRRHELMVDGVSMIAPETVFLSFDTKIGQDVLIEPNVVFGPGVTIEPGAIIHAFSHL 300

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EG ++ +  ++GPFAR+R    +  N ++GNFCEVKKA I EG+K+NHL+Y+GD+ VG  
Sbjct: 301 EGAYLAEGAVVGPFARLRPGANLHANAKVGNFCEVKKAEIGEGAKVNHLTYIGDAFVGAG 360

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
            NIGAG ITCNYDG +K +T I  N+FIGSNSSL+AP++IG+  Y+ASGS+IT D P ++
Sbjct: 361 SNIGAGAITCNYDGYNKSETRIGANSFIGSNSSLVAPVSIGERAYIASGSVITDDVPADA 420

Query: 421 LVFARSRQIVKEDGALSMRKK 441
           L F R+RQ VK   A+++R++
Sbjct: 421 LAFGRARQEVKPGRAVALRER 441


>gi|222085966|ref|YP_002544498.1| UDP-N-acetylglucosamine pyrophosphorylase [Agrobacterium
           radiobacter K84]
 gi|254798614|sp|B9JF80|GLMU_AGRRK RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|221723414|gb|ACM26570.1| UDP-N-acetylglucosamine pyrophosphorylase [Agrobacterium
           radiobacter K84]
          Length = 453

 Score =  485 bits (1248), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 236/442 (53%), Positives = 311/442 (70%), Gaps = 2/442 (0%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M+R  LAI+LAAG   RMKSS SKVL  IAG+PMI+HVME IA   I   ALV+G  AEE
Sbjct: 1   MERTCLAIILAAGDSTRMKSSISKVLHPIAGRPMIAHVMEAIARTDISAAALVVGRNAEE 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           +        + VE Y+Q  + GT HAVL A++AI  GYDD+I+ YGDVPL++   L+ A 
Sbjct: 61  VAAAADIGGIEVEAYLQKERLGTGHAVLAAREAIARGYDDIIVAYGDVPLLTDVPLRAAR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
             +A G  I V+GF+ +NP  YGRLL+K+ E+IAIRE  DATD E  + +CNSGLMAI+G
Sbjct: 121 KGLADGNDIVVIGFHTENPNAYGRLLVKDGELIAIREAKDATDAELAVTWCNSGLMAING 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKAR-LDGKSIASIDVKEQEVCGCNNRYELSLIEN 239
              +D L +I  +    EYYLTD++E AR L G++IA +D  E E+ GCNNR EL+ IE 
Sbjct: 181 RKALDLLDRIGNSNAKGEYYLTDLVEIARSLGGRAIA-VDAPEVEMTGCNNRAELAFIER 239

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSY 299
           +WQ R R ++M+SGVTMIAPETVFL++DT+I  D +IEP+V FG  V I++   I AFS+
Sbjct: 240 LWQERRRHELMLSGVTMIAPETVFLAYDTVIGQDALIEPNVVFGPRVVIDSGAVIHAFSH 299

Query: 300 LEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGK 359
           +EG H+     +GPFAR+R    +    ++GNFCEVK   I +G+K+NHLSY+GD+ +G 
Sbjct: 300 IEGAHVSGTATVGPFARLRPGADLADGSKVGNFCEVKNGKIGKGAKVNHLSYIGDATIGA 359

Query: 360 NVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPEN 419
             NIGAGTITCNYDG +K++THI  N+FIGSNSSL+AP+ IG   YVASGS+IT+D P +
Sbjct: 360 GSNIGAGTITCNYDGVNKHETHIGANSFIGSNSSLVAPVRIGDNAYVASGSVITEDVPAD 419

Query: 420 SLVFARSRQIVKEDGALSMRKK 441
           +L F R+RQ VK   A  +R++
Sbjct: 420 ALAFGRARQEVKLGRAKVIRER 441


>gi|15965410|ref|NP_385763.1| UDP-N-acetylglucosamine pyrophosphorylase protein [Sinorhizobium
           meliloti 1021]
 gi|307310584|ref|ZP_07590231.1| UDP-N-acetylglucosamine pyrophosphorylase [Sinorhizobium meliloti
           BL225C]
 gi|307320966|ref|ZP_07600373.1| UDP-N-acetylglucosamine pyrophosphorylase [Sinorhizobium meliloti
           AK83]
 gi|81634573|sp|Q92PS3|GLMU_RHIME RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|15074591|emb|CAC46236.1| Probable Bifunctional protein GlmU: UDP-N-acetylglucosamine
           pyrophosphorylase and Glucosamine-1-phosphate
           N-acetyltransferase [Sinorhizobium meliloti 1021]
 gi|306893340|gb|EFN24119.1| UDP-N-acetylglucosamine pyrophosphorylase [Sinorhizobium meliloti
           AK83]
 gi|306899694|gb|EFN30320.1| UDP-N-acetylglucosamine pyrophosphorylase [Sinorhizobium meliloti
           BL225C]
          Length = 456

 Score =  481 bits (1238), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 227/442 (51%), Positives = 317/442 (71%), Gaps = 2/442 (0%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M+R  LAI+LAAG   RMKS+ SKVL  +AG+PMI+HV++ +A+A I +VALV+G  A+ 
Sbjct: 1   MERTCLAIILAAGESTRMKSAMSKVLHPVAGRPMIAHVVDALASASISDVALVVGRDADA 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           ++       ++V  ++Q  + GTAHAVL A++AI  GYDDV++++GD PL+++  LK A 
Sbjct: 61  VSAAAATDEVAVTSFLQKERLGTAHAVLAAREAIAKGYDDVLVVFGDTPLITAAPLKAAR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
           D +A G  + V+GF A +P GYGRL++K+  ++AIRE  DA+DEER+I YCN GLMAIDG
Sbjct: 121 DGLAAGNDVVVIGFQATDPTGYGRLIVKDGALVAIREHRDASDEERRITYCNGGLMAIDG 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKAR-LDGKSIASIDVKEQEVCGCNNRYELSLIEN 239
              +D L +I       EYYLTD++E AR LDG++IA ++  E+E+ GCN R EL+ IE 
Sbjct: 181 RKALDLLNRIGNANAKGEYYLTDLVEIARSLDGRAIA-VEAPEEELTGCNTRAELAYIER 239

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSY 299
           +WQ R R ++M++GV+MIAPETVFLS DT +  D ++EP+V FG GV +E+   I AFS+
Sbjct: 240 LWQQRRRHELMLAGVSMIAPETVFLSWDTALAQDVLLEPNVVFGPGVRVESGAVIHAFSH 299

Query: 300 LEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGK 359
           LEG H+     +GPFAR+R    +    ++GNFCEVK A I  G+K+NHL+Y+GD+ VG 
Sbjct: 300 LEGAHVRAGATVGPFARLRPGADLGAKSKVGNFCEVKNAEIGAGAKVNHLTYIGDAFVGA 359

Query: 360 NVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPEN 419
             NIGAGTITCNYDG +K+ T I  NAF+GSNSSL+AP++IG G  VASGS+IT+D P +
Sbjct: 360 GSNIGAGTITCNYDGVNKHVTRIGANAFVGSNSSLVAPVSIGDGALVASGSVITEDVPAD 419

Query: 420 SLVFARSRQIVKEDGALSMRKK 441
           ++ F R+RQ VK   A  +R++
Sbjct: 420 AVAFGRARQDVKPGRAPILRER 441


>gi|150396619|ref|YP_001327086.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Sinorhizobium medicae WSM419]
 gi|166226129|sp|A6U9C1|GLMU_SINMW RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|150028134|gb|ABR60251.1| Nucleotidyl transferase [Sinorhizobium medicae WSM419]
          Length = 456

 Score =  468 bits (1203), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 220/442 (49%), Positives = 314/442 (71%), Gaps = 2/442 (0%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M+R  LAI+LAAG   RMKS+ SKVL  +AG+ MISHV++ +A+A I +VALV+G  AE 
Sbjct: 1   MERTCLAIILAAGESTRMKSAMSKVLHPVAGRAMISHVVDALASASISDVALVVGRDAEA 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           +        ++V   +Q  + GTAHAVL A++AI  GYDD+++++GD PL+++  L+ A 
Sbjct: 61  VAAAANTGDVAVTALLQKERLGTAHAVLAAREAIAKGYDDILVVFGDTPLITAAPLEAAR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
           D +A G  + V+GF A +P GYGRL+++ + ++AIRE  DA++EER+I YCN GLMAIDG
Sbjct: 121 DGLAAGNDVVVIGFQAADPTGYGRLIVEGDALVAIREHRDASEEERRITYCNGGLMAIDG 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKAR-LDGKSIASIDVKEQEVCGCNNRYELSLIEN 239
              +D L ++       EYYLTD++E  R L G++IA ++  E+E+ GCN R EL+ IE 
Sbjct: 181 RKALDLLDRVGNTNAKGEYYLTDLVEIVRSLGGRAIA-VEAPEEELTGCNTRAELAYIER 239

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSY 299
           +WQ R R ++M++GV+M+APETVFLS DT +  D ++EP+V FG GV +E+   I AFS+
Sbjct: 240 LWQQRRRHELMLAGVSMVAPETVFLSWDTALAQDVLVEPNVVFGPGVRVESGAIIHAFSH 299

Query: 300 LEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGK 359
           LEG H+     +GPFAR+R    +  N ++GNFCEVKKA I  G+K++HL+Y+GD+ VG 
Sbjct: 300 LEGAHVRAGAAVGPFARLRTGADLGANSKVGNFCEVKKAEIGAGAKVSHLTYIGDAFVGA 359

Query: 360 NVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPEN 419
             NIGAGTITCNYDG +K+ T I  NAFIGSNS+L+AP++IG G  +ASGS+IT+D P +
Sbjct: 360 GTNIGAGTITCNYDGVNKHVTRIGANAFIGSNSALVAPVSIGDGALIASGSVITEDVPAD 419

Query: 420 SLVFARSRQIVKEDGALSMRKK 441
           ++ F R+RQ VK   A  +R++
Sbjct: 420 AVAFGRARQEVKPGRAPILRER 441


>gi|153010965|ref|YP_001372179.1| nucleotidyl transferase [Ochrobactrum anthropi ATCC 49188]
 gi|166226111|sp|A6X546|GLMU_OCHA4 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|151562853|gb|ABS16350.1| Nucleotidyl transferase [Ochrobactrum anthropi ATCC 49188]
          Length = 454

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 217/438 (49%), Positives = 309/438 (70%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L+IVLAAG G RMKS+  KVL ++AG P++SHV+  +   G  ++ALV+G GA+++ 
Sbjct: 4   RTCLSIVLAAGEGTRMKSNLPKVLHQVAGLPLVSHVVTAVQGTGKSDIALVVGRGADDVR 63

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                    V  + Q  + GTAHAVL A++AI+ GYDD++I++GD PL+ + +L+KA ++
Sbjct: 64  AAVEKNAGPVSAFEQKERLGTAHAVLAAREAIERGYDDLLIVFGDTPLIEAQSLQKARER 123

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +A+G  + V+GF  DNP GYGRL+ K ++++AI EE +AT+E+++I +CN GLMA+ G +
Sbjct: 124 LAEGADVVVIGFRPDNPHGYGRLIEKGDKLVAIIEEKEATEEQKQIGFCNGGLMAVRGQH 183

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +  L  +  +    EYYLTDI+  A   G ++ +I+V    V G NNR EL+  E IWQ
Sbjct: 184 ALALLDAVGNDNAKGEYYLTDIVAIAHSKGMNVTAIEVPVDNVIGINNRVELAEAEAIWQ 243

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
            R RR+MM++GVT+IAPETVF SHDT+I+ D ++EP+VFFG  V +     I +FS++EG
Sbjct: 244 QRKRREMMLAGVTLIAPETVFFSHDTLIEADVIVEPNVFFGPRVHVATGALIHSFSHMEG 303

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
            ++G K  IGPFAR+R    + +  ++GNFCEVK AT+ +G+KINHL+Y+GD+ VG + N
Sbjct: 304 AYVGPKAEIGPFARLRPGANLGEKTKVGNFCEVKNATVHKGAKINHLTYIGDATVGASSN 363

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG +KYKT I ENAFIGSNSSL+AP+ IG   Y+ASGS IT + P ++L 
Sbjct: 364 IGAGTITCNYDGYNKYKTVIGENAFIGSNSSLVAPVEIGDNAYIASGSTITDNVPADALA 423

Query: 423 FARSRQIVKEDGALSMRK 440
           F R+RQ  KE  A  +R+
Sbjct: 424 FGRARQETKEGRAKILRE 441


>gi|227822018|ref|YP_002825989.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Sinorhizobium fredii NGR234]
 gi|254798788|sp|C3MCF7|GLMU_RHISN RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|227341018|gb|ACP25236.1| UDP-N-acetylglucosamine pyrophosphorylase [Sinorhizobium fredii
           NGR234]
          Length = 456

 Score =  461 bits (1185), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 220/442 (49%), Positives = 319/442 (72%), Gaps = 2/442 (0%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M+R  LAI+LAAG   RMKS+ SKVL  +AG+PMI+HV++ +A+A I +VALV+G  AE 
Sbjct: 1   MERTCLAIILAAGESTRMKSAMSKVLHPVAGRPMIAHVVDALASASITDVALVVGRDAEA 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           ++      +++V  ++Q  + GTAHAVL A+ AI+ GYDDV++++GD PL+++  L  A 
Sbjct: 61  VSTAASTGSVTVSSFLQKERLGTAHAVLAARAAIEKGYDDVLVVFGDTPLITAAPLTAAR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
           +++A+G  + V+GF   +P GYGRL++K+ E++AIRE  DA++EER+I YCN GLMAI G
Sbjct: 121 ERLAEGNDVVVIGFETADPTGYGRLIVKDGELLAIREHKDASEEERRITYCNGGLMAISG 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKAR-LDGKSIASIDVKEQEVCGCNNRYELSLIEN 239
              +D L +I    V  EYYLTD++E  R L G++IA ++  E+E+ GCN R EL+ IE 
Sbjct: 181 SKALDLLGRIGNANVKGEYYLTDLVEIVRSLGGRAIA-VEAPEEELTGCNTRAELAYIER 239

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSY 299
           +WQ R R+++M++GV+M+APETVFL+ DT +  D ++EP+V FG GV +E+   I AFS+
Sbjct: 240 LWQQRRRQELMLAGVSMVAPETVFLAWDTELAEDVLVEPNVVFGPGVRVESGAVIHAFSH 299

Query: 300 LEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGK 359
           +EG H+     +GPFAR+R    +    ++GNFCEVKKA I  G+K+NHL+Y+GD+ VG 
Sbjct: 300 VEGAHVRAGATVGPFARLRPGADLGPKSKVGNFCEVKKAEIGAGAKVNHLTYIGDAFVGA 359

Query: 360 NVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPEN 419
             NIGAGTITCNYDG +K+ T I EN FIGSN+SL+AP++IG G  VASGS+IT+D P +
Sbjct: 360 GSNIGAGTITCNYDGVNKHVTRIGENTFIGSNASLVAPVSIGSGALVASGSVITEDVPAD 419

Query: 420 SLVFARSRQIVKEDGALSMRKK 441
           ++ F R+RQ +K   A  +R++
Sbjct: 420 AVAFGRARQEIKPGRAPILRQR 441


>gi|306845914|ref|ZP_07478482.1| UDP-N-acetylglucosamine pyrophosphorylase [Brucella sp. BO1]
 gi|306273806|gb|EFM55644.1| UDP-N-acetylglucosamine pyrophosphorylase [Brucella sp. BO1]
          Length = 454

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 219/439 (49%), Positives = 307/439 (69%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L+IVLAAG G RMKS+  KVL ++AG P++ HV+  +   G  +VALV+G GAEE+ 
Sbjct: 4   RTCLSIVLAAGEGTRMKSNLPKVLHRVAGLPLVCHVVNAVRGTGKSDVALVVGRGAEEVR 63

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                    V  + Q  + GTAHAVL A++AI  GYDD++I++GD PL+ + +L  A ++
Sbjct: 64  GAVEKIAGPVSAFEQKERLGTAHAVLAAREAIARGYDDLLIVFGDTPLIEAQSLLAARER 123

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +AQG  + V+GF   +P GYGRL+ +  +++AI EE +ATDE++KI +CN GLMA+ G +
Sbjct: 124 LAQGADLVVIGFRPASPHGYGRLIEEGGQLVAIIEEKEATDEQKKIGFCNGGLMAVRGQH 183

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +  L  +  +    EYYLTDI+  A   G ++ +I+V    V G NNR EL+  E IWQ
Sbjct: 184 ALALLDAVGNDNAKGEYYLTDIVAIAHGKGLNVTAIEVSVDNVIGINNRAELAEAETIWQ 243

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
           +R RR++M+SGVT+IAPETVF S+DT+I+PD VIEP+VFFG  V + +   I +FS+LEG
Sbjct: 244 NRKRRELMLSGVTLIAPETVFFSYDTVIEPDVVIEPNVFFGPSVHVASGALIHSFSHLEG 303

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             +G+K  IGPFAR+R    + +  ++GNFCEVK A + +G+KINHL+Y+GD+V+G + N
Sbjct: 304 AQVGEKAEIGPFARLRPGADLAEKSKVGNFCEVKNAKVGKGAKINHLTYIGDAVIGASSN 363

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG +K+KT I +NAFIGSNSSL+AP+ IG   Y+ASGS+IT D P ++L 
Sbjct: 364 IGAGTITCNYDGYNKFKTIIGDNAFIGSNSSLVAPVEIGDNAYIASGSVITADVPADALA 423

Query: 423 FARSRQIVKEDGALSMRKK 441
             R+RQ  KE  A  +R+K
Sbjct: 424 LGRARQDTKEGRAKILREK 442


>gi|294853620|ref|ZP_06794292.1| UDP-N-acetylglucosamine diphosphorylase [Brucella sp. NVSL 07-0026]
 gi|294819275|gb|EFG36275.1| UDP-N-acetylglucosamine diphosphorylase [Brucella sp. NVSL 07-0026]
          Length = 454

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 219/439 (49%), Positives = 308/439 (70%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L+IVLAAG G RMKS+  KVL ++AG P++ HV+  +   G  +VALV+G GAE++ 
Sbjct: 4   RTCLSIVLAAGEGTRMKSNLPKVLHRVAGLPLVCHVVNAVRGTGKSDVALVVGRGAEDVR 63

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                    V  + Q  + GTAHAVL A++AI  GYDD++I++GD PL+ + +L  A ++
Sbjct: 64  SAVEKIAGPVSAFEQKERLGTAHAVLAAREAIARGYDDLLIVFGDTPLIEAQSLLAARER 123

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +AQG  + V+GF   +P GYGRL+ +  +++AI EE +ATDE++KI +CN GLMA+ G +
Sbjct: 124 LAQGADLVVIGFRPASPHGYGRLIEEGGQLVAIIEEKEATDEQKKIGFCNGGLMALRGQH 183

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +  L  +  +    EYYLTDI+  A   G ++ +I+V    V G NNR EL+  E IWQ
Sbjct: 184 ALALLDAVGNDNAKGEYYLTDIVAIAHGKGLNVTAIEVPVDNVIGINNRAELAEAETIWQ 243

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
           +R RR++M+SGVT+IAPETVF S+DT+I+PD VIEP+VFFG  V + +   I +FS+LEG
Sbjct: 244 NRKRRELMLSGVTLIAPETVFFSYDTVIEPDVVIEPNVFFGPSVHVASGALIHSFSHLEG 303

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
           V +G+K  IGPFAR+R    + +  ++GNFCEVK A + +G+KINHL+Y+GD+V+G + N
Sbjct: 304 VQVGEKAEIGPFARLRPGADLAEKSKVGNFCEVKNAKVGKGAKINHLTYIGDAVIGASSN 363

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG +K+KT I +NAFIGSNSSL+AP+ IG   Y+ASGS+IT D P ++L 
Sbjct: 364 IGAGTITCNYDGYNKFKTIIGDNAFIGSNSSLVAPVEIGDNAYIASGSVITADVPADALA 423

Query: 423 FARSRQIVKEDGALSMRKK 441
             R+RQ  KE  A  +R+K
Sbjct: 424 LGRARQETKEGRAKILREK 442


>gi|225686369|ref|YP_002734341.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Brucella melitensis ATCC 23457]
 gi|254705923|ref|ZP_05167751.1| glucosamine-1-phosphate acetyltransferase / UDP-N-acetylglucosamine
           pyrophosphorylase [Brucella pinnipedialis M163/99/10]
 gi|256043481|ref|ZP_05446408.1| glucosamine-1-phosphate acetyltransferase / UDP-N-acetylglucosamine
           pyrophosphorylase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256262490|ref|ZP_05465022.1| glmU [Brucella melitensis bv. 2 str. 63/9]
 gi|260564674|ref|ZP_05835159.1| glmU protein [Brucella melitensis bv. 1 str. 16M]
 gi|261313351|ref|ZP_05952548.1| glmU [Brucella pinnipedialis M163/99/10]
 gi|265989897|ref|ZP_06102454.1| glmU [Brucella melitensis bv. 1 str. Rev.1]
 gi|94714269|sp|Q8YC48|GLMU_BRUME RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|254798722|sp|C0RLA4|GLMU_BRUMB RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|225642474|gb|ACO02387.1| Nucleotidyl transferase [Brucella melitensis ATCC 23457]
 gi|260152317|gb|EEW87410.1| glmU protein [Brucella melitensis bv. 1 str. 16M]
 gi|261302377|gb|EEY05874.1| glmU [Brucella pinnipedialis M163/99/10]
 gi|263000566|gb|EEZ13256.1| glmU [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092227|gb|EEZ16524.1| glmU [Brucella melitensis bv. 2 str. 63/9]
 gi|326410740|gb|ADZ67804.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Brucella melitensis M28]
 gi|326554033|gb|ADZ88672.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Brucella melitensis M5-90]
          Length = 454

 Score =  458 bits (1179), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 218/439 (49%), Positives = 307/439 (69%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L+IVLAAG G RMKS+  KVL ++AG P++ HV+  +   G  +VALV+G GAE++ 
Sbjct: 4   RTCLSIVLAAGEGTRMKSNLPKVLHRVAGLPLVCHVVNAVRGTGKSDVALVVGRGAEDVR 63

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                    V  + Q  + GTAHAVL A++AI  GYDD++I++GD PL+ + +L  A ++
Sbjct: 64  SAVEKIAGPVSAFEQKERLGTAHAVLAAREAIARGYDDLLIVFGDTPLIEAQSLLAARER 123

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +AQG  + V+GF   +P GYGRL+ +  +++AI EE +ATDE++KI +CN GLMA+ G +
Sbjct: 124 LAQGADLVVIGFRPASPHGYGRLIEEGGQLVAIIEEKEATDEQKKIGFCNGGLMALRGQH 183

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +  L  +  +    EYYLTDI+  A   G ++ +I+V    V G NNR EL+  E IWQ
Sbjct: 184 ALALLDAVGNDNAKGEYYLTDIVAIAHGKGLNVTAIEVPVDNVIGINNRAELAEAETIWQ 243

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
           +R RR++M+SGVT+IAPETVF S+DT+I+PD VIEP+VFFG  V + +   I +FS+LEG
Sbjct: 244 NRKRRELMLSGVTLIAPETVFFSYDTVIEPDVVIEPNVFFGPSVHVASGALIHSFSHLEG 303

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             +G+K  IGPFAR+R    + +  ++GNFCEVK A + +G+KINHL+Y+GD+V+G + N
Sbjct: 304 AQVGEKAEIGPFARLRPGADLAEKSKVGNFCEVKNAKVGKGAKINHLAYIGDAVIGASSN 363

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG +K+KT I +NAFIGSNSSL+AP+ IG   Y+ASGS+IT D P ++L 
Sbjct: 364 IGAGTITCNYDGYNKFKTIIGDNAFIGSNSSLVAPVEIGDNAYIASGSVITADVPADALA 423

Query: 423 FARSRQIVKEDGALSMRKK 441
             R+RQ  KE  A  +R+K
Sbjct: 424 LGRARQETKEGRAKILREK 442


>gi|260167381|ref|ZP_05754192.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Brucella sp. F5/99]
 gi|261756789|ref|ZP_06000498.1| N-acetylglucosamine-1-phosphate uridyltransferase [Brucella sp.
           F5/99]
 gi|261736773|gb|EEY24769.1| N-acetylglucosamine-1-phosphate uridyltransferase [Brucella sp.
           F5/99]
          Length = 454

 Score =  458 bits (1178), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 218/439 (49%), Positives = 307/439 (69%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L+IVLAAG G RMKS+  KVL ++AG P++ HV+  +   G  +VALV+G GAE++ 
Sbjct: 4   RTCLSIVLAAGEGTRMKSNLPKVLHRVAGLPLVCHVVNAVRGTGKSDVALVVGRGAEDVR 63

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                    V  + Q  + GTAHAVL A++AI  GYDD++I++GD PL+ + +L  A ++
Sbjct: 64  SAVEKIAGPVSAFEQKERLGTAHAVLAAREAIARGYDDLLIVFGDTPLIEAQSLLAARER 123

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +AQG  + V+GF   +P GYGRL+ +  +++AI EE +ATDE++KI +CN GLMA+ G +
Sbjct: 124 LAQGVDLVVIGFRPASPHGYGRLIEEGGQLVAIIEEKEATDEQKKIGFCNGGLMALRGQH 183

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +  L  +  +    EYYLTDI+  A   G ++ +I+V    V G NNR EL+  E IWQ
Sbjct: 184 ALALLDAVGNDNAKGEYYLTDIVAIAHGKGLNVTAIEVPVDNVIGINNRAELAEAETIWQ 243

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
           +R RR++M+SGVT+IAPETVF S+DT+I+PD VIEP+VFFG  V + +   I +FS+LEG
Sbjct: 244 NRKRRELMLSGVTLIAPETVFFSYDTVIEPDVVIEPNVFFGPSVHVASGALIHSFSHLEG 303

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             +G+K  IGPFAR+R    + +  ++GNFCEVK A + +G+KINHL+Y+GD+V+G + N
Sbjct: 304 AQVGEKAEIGPFARLRPGADLAEKSKVGNFCEVKNAKVGKGAKINHLTYIGDAVIGASSN 363

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG +K+KT I +NAFIGSNSSL+AP+ IG   Y+ASGS+IT D P ++L 
Sbjct: 364 IGAGTITCNYDGYNKFKTIIGDNAFIGSNSSLVAPVEIGDNAYIASGSVITADVPADALA 423

Query: 423 FARSRQIVKEDGALSMRKK 441
             R+RQ  KE  A  +R+K
Sbjct: 424 LGRARQETKEGRAKILREK 442


>gi|17989029|ref|NP_541662.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Brucella melitensis bv. 1 str. 16M]
 gi|17984869|gb|AAL53926.1| glucosamine-1-phosphate acetyltransferase / udp-n-acetylglucosamine
           pyrophosphorylase [Brucella melitensis bv. 1 str. 16M]
          Length = 468

 Score =  458 bits (1178), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 218/439 (49%), Positives = 307/439 (69%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L+IVLAAG G RMKS+  KVL ++AG P++ HV+  +   G  +VALV+G GAE++ 
Sbjct: 18  RTCLSIVLAAGEGTRMKSNLPKVLHRVAGLPLVCHVVNAVRGTGKSDVALVVGRGAEDVR 77

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                    V  + Q  + GTAHAVL A++AI  GYDD++I++GD PL+ + +L  A ++
Sbjct: 78  SAVEKIAGPVSAFEQKERLGTAHAVLAAREAIARGYDDLLIVFGDTPLIEAQSLLAARER 137

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +AQG  + V+GF   +P GYGRL+ +  +++AI EE +ATDE++KI +CN GLMA+ G +
Sbjct: 138 LAQGADLVVIGFRPASPHGYGRLIEEGGQLVAIIEEKEATDEQKKIGFCNGGLMALRGQH 197

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +  L  +  +    EYYLTDI+  A   G ++ +I+V    V G NNR EL+  E IWQ
Sbjct: 198 ALALLDAVGNDNAKGEYYLTDIVAIAHGKGLNVTAIEVPVDNVIGINNRAELAEAETIWQ 257

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
           +R RR++M+SGVT+IAPETVF S+DT+I+PD VIEP+VFFG  V + +   I +FS+LEG
Sbjct: 258 NRKRRELMLSGVTLIAPETVFFSYDTVIEPDVVIEPNVFFGPSVHVASGALIHSFSHLEG 317

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             +G+K  IGPFAR+R    + +  ++GNFCEVK A + +G+KINHL+Y+GD+V+G + N
Sbjct: 318 AQVGEKAEIGPFARLRPGADLAEKSKVGNFCEVKNAKVGKGAKINHLAYIGDAVIGASSN 377

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG +K+KT I +NAFIGSNSSL+AP+ IG   Y+ASGS+IT D P ++L 
Sbjct: 378 IGAGTITCNYDGYNKFKTIIGDNAFIGSNSSLVAPVEIGDNAYIASGSVITADVPADALA 437

Query: 423 FARSRQIVKEDGALSMRKK 441
             R+RQ  KE  A  +R+K
Sbjct: 438 LGRARQETKEGRAKILREK 456


>gi|225629079|ref|ZP_03787112.1| Nucleotidyl transferase [Brucella ceti str. Cudo]
 gi|225615575|gb|EEH12624.1| Nucleotidyl transferase [Brucella ceti str. Cudo]
          Length = 469

 Score =  458 bits (1178), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 218/439 (49%), Positives = 307/439 (69%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L+IVLAAG G RMKS+  KVL ++AG P++ HV+  +   G  +VALV+G GAE++ 
Sbjct: 19  RTCLSIVLAAGEGTRMKSNLPKVLHRVAGLPLVCHVVNAVRGTGKSDVALVVGRGAEDVR 78

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                    V  + Q  + GTAHAVL A++AI  GYDD++I++GD PL+ + +L  A ++
Sbjct: 79  SAVEKIAGPVSAFEQKERLGTAHAVLAAREAIARGYDDLLIVFGDTPLIEAQSLLAARER 138

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +AQG  + V+GF   +P GYGRL+ +  +++AI EE +ATDE++KI +CN GLMA+ G +
Sbjct: 139 LAQGVDLVVIGFRPASPHGYGRLIEEGGQLVAIIEEKEATDEQKKIGFCNGGLMALRGQH 198

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +  L  +  +    EYYLTDI+  A   G ++ +I+V    V G NNR EL+  E IWQ
Sbjct: 199 ALALLDAVGNDNAKGEYYLTDIVAIAHGKGLNVTAIEVPVDNVIGINNRAELAEAETIWQ 258

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
           +R RR++M+SGVT+IAPETVF S+DT+I+PD VIEP+VFFG  V + +   I +FS+LEG
Sbjct: 259 NRKRRELMLSGVTLIAPETVFFSYDTVIEPDVVIEPNVFFGPSVHVASGALIHSFSHLEG 318

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             +G+K  IGPFAR+R    + +  ++GNFCEVK A + +G+KINHL+Y+GD+V+G + N
Sbjct: 319 AQVGEKAEIGPFARLRPGADLAEKSKVGNFCEVKNAKVGKGAKINHLTYIGDAVIGASSN 378

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG +K+KT I +NAFIGSNSSL+AP+ IG   Y+ASGS+IT D P ++L 
Sbjct: 379 IGAGTITCNYDGYNKFKTIIGDNAFIGSNSSLVAPVEIGDNAYIASGSVITADVPADALA 438

Query: 423 FARSRQIVKEDGALSMRKK 441
             R+RQ  KE  A  +R+K
Sbjct: 439 LGRARQETKEGRAKILREK 457


>gi|23500327|ref|NP_699767.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Brucella suis 1330]
 gi|161620645|ref|YP_001594531.1| bifunctional N-acetylglucosamine-1-phosphate uridyltransferase /
           glucosamine-1-phosphate N-acetyltransferase [Brucella
           canis ATCC 23365]
 gi|163844735|ref|YP_001622390.1| hypothetical protein BSUIS_B0579 [Brucella suis ATCC 23445]
 gi|254699820|ref|ZP_05161648.1| hypothetical protein Bsuib55_03016 [Brucella suis bv. 5 str. 513]
 gi|254702958|ref|ZP_05164786.1| hypothetical protein Bsuib36_03274 [Brucella suis bv. 3 str. 686]
 gi|254711148|ref|ZP_05172959.1| hypothetical protein BpinB_12977 [Brucella pinnipedialis B2/94]
 gi|254712394|ref|ZP_05174205.1| hypothetical protein BcetM6_03246 [Brucella ceti M644/93/1]
 gi|254715466|ref|ZP_05177277.1| hypothetical protein BcetM_03266 [Brucella ceti M13/05/1]
 gi|256029529|ref|ZP_05443143.1| hypothetical protein BpinM2_02540 [Brucella pinnipedialis
           M292/94/1]
 gi|256157724|ref|ZP_05455642.1| hypothetical protein BcetM4_02565 [Brucella ceti M490/95/1]
 gi|256253305|ref|ZP_05458841.1| hypothetical protein BcetB_03196 [Brucella ceti B1/94]
 gi|260568130|ref|ZP_05838599.1| glmU protein [Brucella suis bv. 4 str. 40]
 gi|261217199|ref|ZP_05931480.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261220419|ref|ZP_05934700.1| glmU [Brucella ceti B1/94]
 gi|261318740|ref|ZP_05957937.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261320070|ref|ZP_05959267.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261750292|ref|ZP_05994001.1| N-acetylglucosamine-1-phosphate uridyltransferase [Brucella suis
           bv. 5 str. 513]
 gi|261753565|ref|ZP_05997274.1| N-acetylglucosamine-1-phosphate uridyltransferase [Brucella suis
           bv. 3 str. 686]
 gi|265986538|ref|ZP_06099095.1| glmU [Brucella pinnipedialis M292/94/1]
 gi|265996230|ref|ZP_06108787.1| glmU [Brucella ceti M490/95/1]
 gi|81751319|sp|Q8FW78|GLMU_BRUSU RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|189040832|sp|A9MBM3|GLMU_BRUC2 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|189040833|sp|A9WYQ2|GLMU_BRUSI RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|23463941|gb|AAN33772.1| UDP-N-acetylglucosamine pyrophosphorylase [Brucella suis 1330]
 gi|161337456|gb|ABX63760.1| Bifunctional protein glmU [Brucella canis ATCC 23365]
 gi|163675458|gb|ABY39568.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|260154795|gb|EEW89876.1| glmU protein [Brucella suis bv. 4 str. 40]
 gi|260919003|gb|EEX85656.1| glmU [Brucella ceti B1/94]
 gi|260922288|gb|EEX88856.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261292760|gb|EEX96256.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261297963|gb|EEY01460.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261740045|gb|EEY27971.1| N-acetylglucosamine-1-phosphate uridyltransferase [Brucella suis
           bv. 5 str. 513]
 gi|261743318|gb|EEY31244.1| N-acetylglucosamine-1-phosphate uridyltransferase [Brucella suis
           bv. 3 str. 686]
 gi|262550527|gb|EEZ06688.1| glmU [Brucella ceti M490/95/1]
 gi|264658735|gb|EEZ28996.1| glmU [Brucella pinnipedialis M292/94/1]
          Length = 454

 Score =  458 bits (1178), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 218/439 (49%), Positives = 307/439 (69%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L+IVLAAG G RMKS+  KVL ++AG P++ HV+  +   G  +VALV+G GAE++ 
Sbjct: 4   RTCLSIVLAAGEGTRMKSNLPKVLHRVAGLPLVCHVVNAVRGTGKSDVALVVGRGAEDVR 63

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                    V  + Q  + GTAHAVL A++AI  GYDD++I++GD PL+ + +L  A ++
Sbjct: 64  SAVEKIAGPVSAFEQKERLGTAHAVLAAREAIARGYDDLLIVFGDTPLIEAQSLLAARER 123

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +AQG  + V+GF   +P GYGRL+ +  +++AI EE +ATDE++KI +CN GLMA+ G +
Sbjct: 124 LAQGADLVVIGFRPASPHGYGRLIEEGGQLVAIIEEKEATDEQKKIGFCNGGLMALRGQH 183

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +  L  +  +    EYYLTDI+  A   G ++ +I+V    V G NNR EL+  E IWQ
Sbjct: 184 ALALLDAVGNDNAKGEYYLTDIVAIAHGKGLNVTAIEVPVDNVIGINNRAELAEAETIWQ 243

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
           +R RR++M+SGVT+IAPETVF S+DT+I+PD VIEP+VFFG  V + +   I +FS+LEG
Sbjct: 244 NRKRRELMLSGVTLIAPETVFFSYDTVIEPDVVIEPNVFFGPSVHVASGALIHSFSHLEG 303

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             +G+K  IGPFAR+R    + +  ++GNFCEVK A + +G+KINHL+Y+GD+V+G + N
Sbjct: 304 AQVGEKAEIGPFARLRPGADLAEKSKVGNFCEVKNAKVGKGAKINHLTYIGDAVIGASSN 363

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG +K+KT I +NAFIGSNSSL+AP+ IG   Y+ASGS+IT D P ++L 
Sbjct: 364 IGAGTITCNYDGYNKFKTIIGDNAFIGSNSSLVAPVEIGDNAYIASGSVITADVPADALA 423

Query: 423 FARSRQIVKEDGALSMRKK 441
             R+RQ  KE  A  +R+K
Sbjct: 424 LGRARQETKEGRAKILREK 442


>gi|62317560|ref|YP_223413.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Brucella abortus bv. 1 str. 9-941]
 gi|83269541|ref|YP_418832.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Brucella melitensis biovar Abortus
           2308]
 gi|189022814|ref|YP_001932555.1| GlmU, UDP-N-acetylglucosamine pyrophosphorylase [Brucella abortus
           S19]
 gi|254691057|ref|ZP_05154311.1| glucosamine-1-phosphate acetyltransferase / UDP-N-acetylglucosamine
           pyrophosphorylase [Brucella abortus bv. 6 str. 870]
 gi|254695637|ref|ZP_05157465.1| glucosamine-1-phosphate acetyltransferase / UDP-N-acetylglucosamine
           pyrophosphorylase [Brucella abortus bv. 3 str. Tulya]
 gi|254698841|ref|ZP_05160669.1| glucosamine-1-phosphate acetyltransferase / UDP-N-acetylglucosamine
           pyrophosphorylase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254732289|ref|ZP_05190867.1| glucosamine-1-phosphate acetyltransferase / UDP-N-acetylglucosamine
           pyrophosphorylase [Brucella abortus bv. 4 str. 292]
 gi|256256242|ref|ZP_05461778.1| glucosamine-1-phosphate acetyltransferase / UDP-N-acetylglucosamine
           pyrophosphorylase [Brucella abortus bv. 9 str. C68]
 gi|260544797|ref|ZP_05820618.1| glmU protein [Brucella abortus NCTC 8038]
 gi|260756654|ref|ZP_05869002.1| glucosamine-1-phosphate N-acetyltransferase [Brucella abortus bv. 6
           str. 870]
 gi|260760085|ref|ZP_05872433.1| glucosamine-1-phosphate N-acetyltransferase [Brucella abortus bv. 4
           str. 292]
 gi|260763323|ref|ZP_05875655.1| glucosamine-1-phosphate N-acetyltransferase [Brucella abortus bv. 2
           str. 86/8/59]
 gi|260882471|ref|ZP_05894085.1| glmU [Brucella abortus bv. 9 str. C68]
 gi|261216035|ref|ZP_05930316.1| glucosamine-1-phosphate N-acetyltransferase [Brucella abortus bv. 3
           str. Tulya]
 gi|75495571|sp|Q577Y2|GLMU_BRUAB RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|109892102|sp|Q2YKK2|GLMU_BRUA2 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|254798721|sp|B2SB72|GLMU_BRUA1 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|62197753|gb|AAX76052.1| GlmU, UDP-N-acetylglucosamine pyrophosphorylase [Brucella abortus
           bv. 1 str. 9-941]
 gi|82939815|emb|CAJ12823.1| Bacterial transferase hexapeptide repeat:ATP/GTP-binding site motif
           A (P-loop):Nucleotidyl transferase [Brucella melitensis
           biovar Abortus 2308]
 gi|189021388|gb|ACD74109.1| GlmU, UDP-N-acetylglucosamine pyrophosphorylase [Brucella abortus
           S19]
 gi|260098068|gb|EEW81942.1| glmU protein [Brucella abortus NCTC 8038]
 gi|260670403|gb|EEX57343.1| glucosamine-1-phosphate N-acetyltransferase [Brucella abortus bv. 4
           str. 292]
 gi|260673744|gb|EEX60565.1| glucosamine-1-phosphate N-acetyltransferase [Brucella abortus bv. 2
           str. 86/8/59]
 gi|260676762|gb|EEX63583.1| glucosamine-1-phosphate N-acetyltransferase [Brucella abortus bv. 6
           str. 870]
 gi|260871999|gb|EEX79068.1| glmU [Brucella abortus bv. 9 str. C68]
 gi|260917642|gb|EEX84503.1| glucosamine-1-phosphate N-acetyltransferase [Brucella abortus bv. 3
           str. Tulya]
          Length = 454

 Score =  457 bits (1177), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 218/439 (49%), Positives = 306/439 (69%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L+IVLAAG G RMKS+  KVL ++AG P++ HV+  +   G  +VALV+G GAE++ 
Sbjct: 4   RTCLSIVLAAGEGTRMKSNLPKVLHRVAGLPLVCHVVNAVRGTGKSDVALVVGRGAEDVR 63

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                    V  + Q  + GTAHAVL A +AI  GYDD++I++GD PL+ + +L  A ++
Sbjct: 64  SAVEKIAGPVSAFEQKERLGTAHAVLAAHEAIARGYDDLLIVFGDTPLIEAQSLLAARER 123

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +AQG  + V+GF   +P GYGRL+ +  +++AI EE +ATDE++KI +CN GLMA+ G +
Sbjct: 124 LAQGADLVVIGFRPASPHGYGRLIEEGGQLVAIIEEKEATDEQKKIGFCNGGLMALRGQH 183

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +  L  +  +    EYYLTDI+  A   G ++ +I+V    V G NNR EL+  E IWQ
Sbjct: 184 ALALLDAVGNDNAKGEYYLTDIVAIAHGKGLNVTAIEVPVDNVIGINNRAELAEAETIWQ 243

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
           +R RR++M+SGVT+IAPETVF S+DT+I+PD VIEP+VFFG  V + +   I +FS+LEG
Sbjct: 244 NRKRRELMLSGVTLIAPETVFFSYDTVIEPDVVIEPNVFFGPSVHVASGALIHSFSHLEG 303

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             +G+K  IGPFAR+R    + +  ++GNFCEVK A + +G+KINHL+Y+GD+V+G + N
Sbjct: 304 AQVGEKAEIGPFARLRPGADLAEKSKVGNFCEVKNAKVGKGAKINHLAYIGDAVIGASSN 363

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG +K+KT I +NAFIGSNSSL+AP+ IG   Y+ASGS+IT D P ++L 
Sbjct: 364 IGAGTITCNYDGYNKFKTIIGDNAFIGSNSSLVAPVEIGDNAYIASGSVITADVPADALA 423

Query: 423 FARSRQIVKEDGALSMRKK 441
             R+RQ  KE  A  +R+K
Sbjct: 424 LGRARQETKEGRAKILREK 442


>gi|297249600|ref|ZP_06933301.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Brucella abortus bv. 5 str. B3196]
 gi|297173469|gb|EFH32833.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Brucella abortus bv. 5 str. B3196]
          Length = 468

 Score =  457 bits (1177), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 218/439 (49%), Positives = 306/439 (69%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L+IVLAAG G RMKS+  KVL ++AG P++ HV+  +   G  +VALV+G GAE++ 
Sbjct: 18  RTCLSIVLAAGEGTRMKSNLPKVLHRVAGLPLVCHVVNAVRGTGKSDVALVVGRGAEDVR 77

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                    V  + Q  + GTAHAVL A +AI  GYDD++I++GD PL+ + +L  A ++
Sbjct: 78  SAVEKIAGPVSAFEQKERLGTAHAVLAAHEAIARGYDDLLIVFGDTPLIEAQSLLAARER 137

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +AQG  + V+GF   +P GYGRL+ +  +++AI EE +ATDE++KI +CN GLMA+ G +
Sbjct: 138 LAQGADLVVIGFRPASPHGYGRLIEEGGQLVAIIEEKEATDEQKKIGFCNGGLMALRGQH 197

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +  L  +  +    EYYLTDI+  A   G ++ +I+V    V G NNR EL+  E IWQ
Sbjct: 198 ALALLDAVGNDNAKGEYYLTDIVAIAHGKGLNVTAIEVPVDNVIGINNRAELAEAETIWQ 257

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
           +R RR++M+SGVT+IAPETVF S+DT+I+PD VIEP+VFFG  V + +   I +FS+LEG
Sbjct: 258 NRKRRELMLSGVTLIAPETVFFSYDTVIEPDVVIEPNVFFGPSVHVASGALIHSFSHLEG 317

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             +G+K  IGPFAR+R    + +  ++GNFCEVK A + +G+KINHL+Y+GD+V+G + N
Sbjct: 318 AQVGEKAEIGPFARLRPGADLAEKSKVGNFCEVKNAKVGKGAKINHLAYIGDAVIGASSN 377

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG +K+KT I +NAFIGSNSSL+AP+ IG   Y+ASGS+IT D P ++L 
Sbjct: 378 IGAGTITCNYDGYNKFKTIIGDNAFIGSNSSLVAPVEIGDNAYIASGSVITADVPADALA 437

Query: 423 FARSRQIVKEDGALSMRKK 441
             R+RQ  KE  A  +R+K
Sbjct: 438 LGRARQETKEGRAKILREK 456


>gi|306841769|ref|ZP_07474455.1| UDP-N-acetylglucosamine pyrophosphorylase [Brucella sp. BO2]
 gi|306288174|gb|EFM59561.1| UDP-N-acetylglucosamine pyrophosphorylase [Brucella sp. BO2]
          Length = 454

 Score =  457 bits (1177), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 218/439 (49%), Positives = 307/439 (69%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L+IVLAAG G RMKS+  KVL ++AG P++ HV+  +   G  +VALV+G GAEE+ 
Sbjct: 4   RTCLSIVLAAGEGTRMKSNLPKVLHRVAGLPLVCHVVNAVRGTGKSDVALVVGRGAEEVR 63

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                    V  + Q  + GTAHAVL A++AI  GYDD++I++GD PL+ + +L  A ++
Sbjct: 64  GAVEKIAGPVSAFEQKERLGTAHAVLAAREAIARGYDDLLIVFGDTPLIEAQSLLAARER 123

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +AQG  + V+GF   +P GYGRL+ +  +++AI EE +ATD+++KI +CN GLMA+ G +
Sbjct: 124 LAQGADLVVIGFRPASPHGYGRLIEEGGQLVAIIEEKEATDKQKKIGFCNGGLMAVRGQH 183

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +  L  +  +    EYYLTDI+  A   G ++ +I+V    V G NNR EL+  E IWQ
Sbjct: 184 ALALLDAVGNDNAKGEYYLTDIVAIAHGKGLNVTAIEVPVDNVIGINNRAELAEAETIWQ 243

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
           +R RR++M+SGVT+IAPETVF S+DT+I+PD VIEP+VFFG  V + +   I +FS+LEG
Sbjct: 244 NRKRRELMLSGVTLIAPETVFFSYDTVIEPDVVIEPNVFFGPSVHVASGALIHSFSHLEG 303

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             +G+K  IGPFAR+R    + +  ++GNFCEVK A + +G+KINHL+Y+GD+V+G + N
Sbjct: 304 AQVGEKAEIGPFARLRPGADLAEKSKVGNFCEVKNAKVGKGAKINHLTYIGDAVIGASSN 363

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG +K+KT I +NAFIGSNSSL+AP+ IG   Y+ASGS+IT D P ++L 
Sbjct: 364 IGAGTITCNYDGYNKFKTIIGDNAFIGSNSSLVAPVEIGDNAYIASGSVITADVPADALA 423

Query: 423 FARSRQIVKEDGALSMRKK 441
             R+RQ  KE  A  +R+K
Sbjct: 424 LGRARQDTKEGRAKILREK 442


>gi|237817107|ref|ZP_04596099.1| UDP-N-acetylglucosamine pyrophosphorylase [Brucella abortus str.
           2308 A]
 gi|237787920|gb|EEP62136.1| UDP-N-acetylglucosamine pyrophosphorylase [Brucella abortus str.
           2308 A]
          Length = 469

 Score =  457 bits (1177), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 218/439 (49%), Positives = 306/439 (69%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L+IVLAAG G RMKS+  KVL ++AG P++ HV+  +   G  +VALV+G GAE++ 
Sbjct: 19  RTCLSIVLAAGEGTRMKSNLPKVLHRVAGLPLVCHVVNAVRGTGKSDVALVVGRGAEDVR 78

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                    V  + Q  + GTAHAVL A +AI  GYDD++I++GD PL+ + +L  A ++
Sbjct: 79  SAVEKIAGPVSAFEQKERLGTAHAVLAAHEAIARGYDDLLIVFGDTPLIEAQSLLAARER 138

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +AQG  + V+GF   +P GYGRL+ +  +++AI EE +ATDE++KI +CN GLMA+ G +
Sbjct: 139 LAQGADLVVIGFRPASPHGYGRLIEEGGQLVAIIEEKEATDEQKKIGFCNGGLMALRGQH 198

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +  L  +  +    EYYLTDI+  A   G ++ +I+V    V G NNR EL+  E IWQ
Sbjct: 199 ALALLDAVGNDNAKGEYYLTDIVAIAHGKGLNVTAIEVPVDNVIGINNRAELAEAETIWQ 258

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
           +R RR++M+SGVT+IAPETVF S+DT+I+PD VIEP+VFFG  V + +   I +FS+LEG
Sbjct: 259 NRKRRELMLSGVTLIAPETVFFSYDTVIEPDVVIEPNVFFGPSVHVASGALIHSFSHLEG 318

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             +G+K  IGPFAR+R    + +  ++GNFCEVK A + +G+KINHL+Y+GD+V+G + N
Sbjct: 319 AQVGEKAEIGPFARLRPGADLAEKSKVGNFCEVKNAKVGKGAKINHLAYIGDAVIGASSN 378

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG +K+KT I +NAFIGSNSSL+AP+ IG   Y+ASGS+IT D P ++L 
Sbjct: 379 IGAGTITCNYDGYNKFKTIIGDNAFIGSNSSLVAPVEIGDNAYIASGSVITADVPADALA 438

Query: 423 FARSRQIVKEDGALSMRKK 441
             R+RQ  KE  A  +R+K
Sbjct: 439 LGRARQETKEGRAKILREK 457


>gi|319408654|emb|CBI82309.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase [Bartonella
           schoenbuchensis R1]
          Length = 449

 Score =  457 bits (1177), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 217/441 (49%), Positives = 309/441 (70%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M R  L+IVLAAG G RMKS   KVL K+AG P+I HV++ +  AG   +A+V+G G ++
Sbjct: 1   MVRSCLSIVLAAGEGTRMKSFLPKVLHKVAGLPLICHVVKQVELAGFSQLAVVVGAGGKD 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           +T++       V  + Q  + GTAHAVL+A+ A++ G DDV+I++GD PL+   +L +  
Sbjct: 61  VTKVVQSCVKDVMIFEQKERLGTAHAVLSARLALQKGIDDVLIIFGDTPLIEHTSLTRIR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
             +A G  + V GF A +P GYGRL+ KN + IAI EE DA+DEE+K  +CN G+MAI+G
Sbjct: 121 APLAMGADVVVAGFYAPDPTGYGRLIEKNGKFIAIVEEKDASDEEKKNSFCNGGIMAING 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
            + +  L +I  N   QEYYLTDI+  A  +G  +  I+V    V G NN +ELS ++ +
Sbjct: 181 KHALSLLDKINNNNAQQEYYLTDIVSIASCEGLDVRVIEVPFNNVIGVNNCFELSEVDTL 240

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           WQ R     M+SGVT++ PE+V+ S+DT I+P  +IEP+V+FG GV +++   IRAFSYL
Sbjct: 241 WQKRKACDFMLSGVTILKPESVYFSYDTEIEPGVLIEPNVYFGPGVKVQSGAVIRAFSYL 300

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EG  +G  T IGP+AR+R  T + ++V++GNFCE+K+A + E +KINHLSY+GD+ +G +
Sbjct: 301 EGAFVGADTQIGPYARLRPGTELARSVKVGNFCEIKQAKVGEAAKINHLSYIGDAEIGSH 360

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
            NIGAGTITCNYDG HKYKT I++N FIGSNS+L+AP+ IG+ +Y+ASGS+IT+D P NS
Sbjct: 361 TNIGAGTITCNYDGFHKYKTMIDDNVFIGSNSALVAPLIIGKDSYIASGSVITEDVPINS 420

Query: 421 LVFARSRQIVKEDGALSMRKK 441
           L   R+RQ++KE+ A  +R +
Sbjct: 421 LALGRARQVIKENRATKLRTR 441


>gi|240850747|ref|YP_002972147.1| UDP-N-acetylglucosamine pyrophosphorylase [Bartonella grahamii
           as4aup]
 gi|240267870|gb|ACS51458.1| UDP-N-acetylglucosamine pyrophosphorylase [Bartonella grahamii
           as4aup]
          Length = 449

 Score =  457 bits (1176), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 217/441 (49%), Positives = 310/441 (70%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M R  L+IVLAAG G RMKSS  KVL KIAG P+I HV++ I  AG   +A+V+G+GA+E
Sbjct: 1   MVRSCLSIVLAAGEGTRMKSSLPKVLHKIAGLPLICHVLKQIELAGSSQLAVVVGFGAKE 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           +T +          + Q  + GTAHAVL+A+ A++   DD++I++GD PL+   +L +  
Sbjct: 61  VTHVVQSFVKDAMIFEQKERLGTAHAVLSARLALQKEVDDILIVFGDTPLIQQDSLHQMR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
            ++A G  +   GF+  NP GYGRLL KN ++IAI EE DA+DEE+KI +CN G++A+ G
Sbjct: 121 AQLADGADVVFAGFHTQNPTGYGRLLEKNGQLIAILEEKDASDEEKKISFCNGGILAMRG 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
            Y +  L ++  N V +EYYLTDI   A  +G  +  ++V  +++ G NN  ELS  +++
Sbjct: 181 KYALSLLEKVGNNNVKKEYYLTDIAALATREGLDVRVVEVPFEDIVGINNGLELSEADSL 240

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           WQ R  R +M+SGVT++ PET++ S+DT I+P  VIEP+V+FG  V +++   I AFSYL
Sbjct: 241 WQKRKARDLMLSGVTLLKPETLYFSYDTEIEPGVVIEPNVYFGLSVKVQSGAVIHAFSYL 300

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EG  +GK   IGP+AR+R  T + K+V+IGNFCEVK+A + E SKINHLSY+GD+ +G +
Sbjct: 301 EGAVVGKDAQIGPYARLRPGTELAKSVKIGNFCEVKQAKVGESSKINHLSYIGDAEIGAH 360

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
            NIGAGTITCNYDG +KYKT I + AF+GSN++L++P+ IG G+YVASGS+IT++ P NS
Sbjct: 361 TNIGAGTITCNYDGFNKYKTMIGDYAFVGSNTALVSPLVIGDGSYVASGSVITENIPMNS 420

Query: 421 LVFARSRQIVKEDGALSMRKK 441
           + F R+RQ++KE  A   R++
Sbjct: 421 MAFGRARQVIKEGYATKFRER 441


>gi|256111500|ref|ZP_05452514.1| glucosamine-1-phosphate acetyltransferase / UDP-N-acetylglucosamine
           pyrophosphorylase [Brucella melitensis bv. 3 str. Ether]
 gi|265992998|ref|ZP_06105555.1| glmU [Brucella melitensis bv. 3 str. Ether]
 gi|262763868|gb|EEZ09900.1| glmU [Brucella melitensis bv. 3 str. Ether]
          Length = 454

 Score =  457 bits (1176), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 217/439 (49%), Positives = 306/439 (69%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L+IVLAAG G RMKS+  KVL ++AG P++ HV+  +   G  +VALV+G GAE++ 
Sbjct: 4   RTCLSIVLAAGEGTRMKSNLPKVLHRVAGLPLVCHVVNAVRGTGKSDVALVVGRGAEDVR 63

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                    V  + Q  + GTAHAVL A++AI  GYDD++I++GD PL+ + +L  A ++
Sbjct: 64  SAVEKIAGPVSAFEQKERLGTAHAVLAAREAIARGYDDLLIVFGDTPLIEAQSLLAARER 123

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +AQG  + V+GF   +P GYGRL+ +  +++AI EE +ATDE++KI +CN GLMA+ G +
Sbjct: 124 LAQGADLVVIGFRPASPHGYGRLIEEGGQLVAIIEEKEATDEQKKIGFCNGGLMALRGQH 183

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +     +  +    EYYLTDI+  A   G ++ +I+V    V G NNR EL+  E IWQ
Sbjct: 184 ALALFDAVGNDNAKGEYYLTDIVAIAHGKGLNVTAIEVPVDNVIGINNRAELAEAETIWQ 243

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
           +R RR++M+SGVT+IAPETVF S+DT+I+PD VIEP+VFFG  V + +   I +FS+LEG
Sbjct: 244 NRKRRELMLSGVTLIAPETVFFSYDTVIEPDVVIEPNVFFGPSVHVASGALIHSFSHLEG 303

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             +G+K  IGPFAR+R    + +  ++GNFCEVK A + +G+KINHL+Y+GD+V+G + N
Sbjct: 304 AQVGEKAEIGPFARLRPGADLAEKSKVGNFCEVKNAKVGKGAKINHLAYIGDAVIGASSN 363

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG +K+KT I +NAFIGSNSSL+AP+ IG   Y+ASGS+IT D P ++L 
Sbjct: 364 IGAGTITCNYDGYNKFKTIIGDNAFIGSNSSLVAPVEIGDNAYIASGSVITADVPADALA 423

Query: 423 FARSRQIVKEDGALSMRKK 441
             R+RQ  KE  A  +R+K
Sbjct: 424 LGRARQETKEGRAKILREK 442


>gi|319407170|emb|CBI80809.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase [Bartonella
           sp. 1-1C]
          Length = 449

 Score =  456 bits (1174), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 223/441 (50%), Positives = 312/441 (70%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M R  L+IVLAAG G RMKSS  KVL K+AG P++ HV+  I       +A+V+G GAE+
Sbjct: 1   MVRSCLSIVLAAGEGTRMKSSLPKVLHKVAGLPLVCHVIRQIELLNSSQLAVVVGVGAED 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           +T+I      +V  + Q  + GTAHAVL+A+ A++   DDV+I++GD PL+  +TL K  
Sbjct: 61  VTKIVQSFVKNVMIFEQKERLGTAHAVLSARIALEKEVDDVLIVFGDTPLIEQNTLVKIR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
           +++A+   + V GF   NP GYGRLL KN +IIAI EE DA+DEE+KI +CN G+MAI G
Sbjct: 121 EQLAKEADVVVTGFYTSNPTGYGRLLNKNGKIIAIVEEQDASDEEKKISFCNGGIMAIKG 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
            Y++  L ++  N +  EYYLTDI+  A  +G +I  ++V    V G NN +EL  ++ +
Sbjct: 181 KYVLSLLDKVNNNNLKGEYYLTDIVSIAACEGLNIQVVEVPFDHVVGINNCFELFEVDVL 240

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           WQ R  R  M+SGV ++ PE+V+ S+DT I+ D VIEP+V+FG GV + +   I AFSYL
Sbjct: 241 WQKRKARDFMLSGVRILKPESVYFSYDTEIESDVVIEPNVYFGSGVKVRSGAVIHAFSYL 300

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EGV IG  T IGP+AR+R  T +E++V+IGNFCE+K+A I E SKINHLSY+GD+ +GK+
Sbjct: 301 EGVVIGIDTEIGPYARLRTGTELERSVKIGNFCEIKQAKIGECSKINHLSYIGDAEIGKH 360

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
            NIGAGTITCNYDG +K+K  I +N FIGSNS+L++P+ IG+G Y+ASGS+IT++ P +S
Sbjct: 361 TNIGAGTITCNYDGFNKHKIVIGDNTFIGSNSALVSPLIIGEGAYIASGSVITENVPADS 420

Query: 421 LVFARSRQIVKEDGALSMRKK 441
           +   R+RQI+KED A  +R++
Sbjct: 421 MALGRARQIIKEDRAEKLRER 441


>gi|256059224|ref|ZP_05449430.1| hypothetical protein Bneo5_02532 [Brucella neotomae 5K33]
 gi|261323174|ref|ZP_05962371.1| glmU [Brucella neotomae 5K33]
 gi|261299154|gb|EEY02651.1| glmU [Brucella neotomae 5K33]
          Length = 454

 Score =  456 bits (1173), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 217/439 (49%), Positives = 306/439 (69%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L+IVLAAG G RMKS+  KVL ++AG P++ HV+  +   G  +VALV+G GAE++ 
Sbjct: 4   RTCLSIVLAAGEGTRMKSNLPKVLHRVAGLPLVCHVVNAVRGTGKSDVALVVGRGAEDVR 63

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                    V  + Q  + GTAHAVL A++AI  GYDD++I++GD PL+ + +L  A ++
Sbjct: 64  SAVEKIAGPVSAFEQKERLGTAHAVLAAREAIARGYDDLLIVFGDTPLIEAQSLLAARER 123

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           + QG  + V+GF   +P GYGRL+ +  +++AI EE +ATDE++KI +CN GLMA+ G +
Sbjct: 124 LVQGADLVVIGFRPASPHGYGRLIEEGGQLVAIIEEKEATDEQKKIGFCNGGLMALRGQH 183

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +  L  +  +    EYYLTDI+  A   G ++ +I+V    V G NNR EL+  E IWQ
Sbjct: 184 ALALLDAVGNDNAKGEYYLTDIVAIAHGKGLNVTAIEVPVDNVIGINNRAELAEAETIWQ 243

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
           +R RR++M+SGVT+IAPETVF S+DT+I+PD VIEP+VFFG  V + +   I +FS+LEG
Sbjct: 244 NRKRRELMLSGVTLIAPETVFFSYDTVIEPDVVIEPNVFFGPSVHVASGALIHSFSHLEG 303

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             +G+K  IGPFAR+R    + +  ++GNFCEVK A + +G+KINHL+Y+GD+V+G + N
Sbjct: 304 AQVGEKAEIGPFARLRPGADLAEKSKVGNFCEVKNAKVGKGAKINHLTYIGDAVIGASSN 363

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG +K+KT I +NAFIGSNSSL+AP+ IG   Y+ASGS+IT D P ++L 
Sbjct: 364 IGAGTITCNYDGYNKFKTIIGDNAFIGSNSSLVAPVEIGDNAYIASGSVITADVPADALA 423

Query: 423 FARSRQIVKEDGALSMRKK 441
             R+RQ  KE  A  +R+K
Sbjct: 424 LGRARQETKEGRAKILREK 442


>gi|256015359|ref|YP_003105368.1| UDP-N-acetylglucosamine pyrophosphorylase [Brucella microti CCM
           4915]
 gi|255998019|gb|ACU49706.1| UDP-N-acetylglucosamine pyrophosphorylase [Brucella microti CCM
           4915]
          Length = 454

 Score =  456 bits (1172), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 217/439 (49%), Positives = 305/439 (69%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L+IVLAAG G RMKS+  KVL ++AG P++ HV+  +   G  +VALV+G GAE++ 
Sbjct: 4   RTCLSIVLAAGEGTRMKSNLPKVLHRVAGLPLVCHVVNAVRGTGKSDVALVVGRGAEDVR 63

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                    V  + Q  + GTAHAVL A++AI  GYDD++I++GD PL+ + +L  A ++
Sbjct: 64  SAVEKIAGPVSAFEQKERLGTAHAVLAAREAIARGYDDLLIVFGDTPLIEAQSLLAARER 123

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +AQG  + V+GF   +P GYGRL+ +   ++AI EE +ATDE++KI +CN GLMA+ G +
Sbjct: 124 LAQGADLVVIGFRPASPHGYGRLIEEGGRLVAIIEEKEATDEQKKIGFCNGGLMALRGQH 183

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +     +  +    EYYLTDI+  A   G ++ +I+V    V G NNR EL+  E IWQ
Sbjct: 184 ALALFDAVGNDNAKGEYYLTDIVAIAHGKGLNVTAIEVPVDNVIGINNRAELAEAETIWQ 243

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
           +R RR++M+SGVT+IAPETVF S+DT+I+PD VIEP+VFFG  V + +   I +FS+LEG
Sbjct: 244 NRKRRELMLSGVTLIAPETVFFSYDTVIEPDVVIEPNVFFGPSVHVASGALIHSFSHLEG 303

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             +G+K  IGPFAR+R    + +  ++GNFCEVK A + +G+KINHL+Y+GD+V+G + N
Sbjct: 304 AQVGEKAEIGPFARLRPGADLAEKSKVGNFCEVKNAKVGKGAKINHLTYIGDAVIGASSN 363

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG +K+KT I +NAFIGSNSSL+AP+ IG   Y+ASGS+IT D P ++L 
Sbjct: 364 IGAGTITCNYDGYNKFKTIIGDNAFIGSNSSLVAPVEIGDNAYIASGSVITADVPADALA 423

Query: 423 FARSRQIVKEDGALSMRKK 441
             R+RQ  KE  A  +R+K
Sbjct: 424 LGRARQETKEGRAKILREK 442


>gi|49475738|ref|YP_033779.1| UDP-N-acetylglucosamine pyrophosphorylase [Bartonella henselae str.
           Houston-1]
 gi|81647814|sp|Q6G321|GLMU_BARHE RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|49238545|emb|CAF27785.1| UDP-N-acetylglucosamine pyrophosphorylase [Bartonella henselae str.
           Houston-1]
          Length = 448

 Score =  456 bits (1172), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 217/439 (49%), Positives = 309/439 (70%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L+IVLAAG G RMKSS  KVL KIAG P+I HV++ I  AG+  +A+V+G+GA+++ 
Sbjct: 2   RSCLSIVLAAGEGTRMKSSLPKVLHKIAGLPLICHVIKQIELAGVSQLAVVVGFGAKDVV 61

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
            +      +   + Q  + GTAHAVL+A+ A++ G DDV+I++GD PL+   +L +   +
Sbjct: 62  HVVESFVKNAMIFEQKERLGTAHAVLSARLALQKGVDDVLIVFGDTPLIEQDSLLQLRAQ 121

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +A G  + V GF A NP GYGRLL KN ++IAI EE DA+DEE+K+ +CN G++A++G Y
Sbjct: 122 LAGGADVVVAGFRAFNPTGYGRLLEKNGKLIAIIEEKDASDEEKKLSFCNGGILALNGKY 181

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +  L +I  N   +EYYLTDI+  A  +G  +  ++V    + G NN +EL   +++WQ
Sbjct: 182 ALSLLEKIGNNNSKREYYLTDIVSIASQEGLDVRVVEVPFDNIIGVNNCFELFEADSLWQ 241

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
            R  R +M+SGVT++ PETV+ S+DT I+P  +IEP+V+FG GV + +   I AFSYLEG
Sbjct: 242 KRKARDLMLSGVTILKPETVYFSYDTQIKPGVMIEPNVYFGLGVKVHSGAVIHAFSYLEG 301

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             +G    IGP+AR+R  T +  +V+IGNFCEVKKA I + SKINHLSY+GD+ +G  VN
Sbjct: 302 AVVGTDARIGPYARLRPGTELAGSVKIGNFCEVKKAKIGKASKINHLSYIGDAEIGAQVN 361

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG HK+K  I ++AFIGSNS+L++P+ IG G+Y+ASGS+IT+D P NS+ 
Sbjct: 362 IGAGTITCNYDGFHKHKIMIGDHAFIGSNSALVSPLMIGDGSYIASGSVITEDVPMNSIA 421

Query: 423 FARSRQIVKEDGALSMRKK 441
             R+RQ+ K+D A+ +R +
Sbjct: 422 LGRARQVTKKDYAMKLRAR 440


>gi|254720430|ref|ZP_05182241.1| hypothetical protein Bru83_13062 [Brucella sp. 83/13]
 gi|265985450|ref|ZP_06098185.1| UDP-N-acetylglucosamine pyrophosphorylase [Brucella sp. 83/13]
 gi|306838993|ref|ZP_07471814.1| UDP-N-acetylglucosamine pyrophosphorylase [Brucella sp. NF 2653]
 gi|264664042|gb|EEZ34303.1| UDP-N-acetylglucosamine pyrophosphorylase [Brucella sp. 83/13]
 gi|306405899|gb|EFM62157.1| UDP-N-acetylglucosamine pyrophosphorylase [Brucella sp. NF 2653]
          Length = 454

 Score =  455 bits (1170), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 217/440 (49%), Positives = 305/440 (69%)

Query: 2   KRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI 61
           +R  L+IVLAAG G RMKS+  KVL ++AG P++ HV+  +   G  +VALV+G GAEE+
Sbjct: 3   ERTCLSIVLAAGEGTRMKSNLPKVLHRVAGLPLVCHVVNAVRGTGKSDVALVVGRGAEEV 62

Query: 62  TRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMD 121
                     V  + Q  + GTAHAVL A++AI  GYDD++I++GD PL+ + +L  A +
Sbjct: 63  RGAVEKIAGPVSAFEQKERLGTAHAVLAAREAIARGYDDLLIVFGDTPLIEAQSLLAARE 122

Query: 122 KIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
           ++AQG  + V+GF   +P GYGRL+    +++AI EE +ATDE++KI +CN GLMA+ G 
Sbjct: 123 RLAQGADLVVIGFRPASPHGYGRLIEAGGQLVAIIEEKEATDEQKKIGFCNGGLMAVRGQ 182

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIW 241
           + +  L  +  +    EYYLTDI+  A   G ++ +I+V    V G NNR EL+  E IW
Sbjct: 183 HALALLDAVGNDNAKGEYYLTDIVAIAHGKGLNVTAIEVPVDNVIGINNRAELAEAETIW 242

Query: 242 QSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLE 301
           Q+R RR++++SGVT+IAPETVF S DT+I+PD VIEP+VFFG  V + +   I +FS+LE
Sbjct: 243 QNRKRRELILSGVTLIAPETVFFSSDTVIEPDVVIEPNVFFGPSVHVASGALIHSFSHLE 302

Query: 302 GVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNV 361
           G  +G+   IGPFAR+R    + +  ++GNFCEVK A + +G+KINHL+Y+GD+V+G + 
Sbjct: 303 GAQVGETAEIGPFARLRPGADLAEKSKVGNFCEVKNAKVGKGAKINHLTYIGDAVIGASS 362

Query: 362 NIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSL 421
           NIGAGTITCNYDG +K+KT I +NAFIGSNSSL+AP+ IG   Y+ASGS+IT D P ++L
Sbjct: 363 NIGAGTITCNYDGYNKFKTIIGDNAFIGSNSSLVAPVVIGDNAYIASGSVITADVPADAL 422

Query: 422 VFARSRQIVKEDGALSMRKK 441
              R+RQ  KE  A  +R+K
Sbjct: 423 ALGRARQDTKEGRAKILREK 442


>gi|121601801|ref|YP_989051.1| putative UDP-N-acetylglucosamine pyrophosphorylase [Bartonella
           bacilliformis KC583]
 gi|189040830|sp|A1USU8|GLMU_BARBK RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|120613978|gb|ABM44579.1| putative UDP-N-acetylglucosamine pyrophosphorylase [Bartonella
           bacilliformis KC583]
          Length = 449

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 217/439 (49%), Positives = 313/439 (71%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M R  L+IVLAAG G RMKS   KVL KIAG P++ HV++ I  AG   +A+V+G GAE+
Sbjct: 1   MVRNCLSIVLAAGEGTRMKSPLPKVLHKIAGLPLVCHVIKQIELAGSLQLAVVVGSGAED 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           IT++    T +   + Q  + GTAHAVL+A+ A++   DD++I++GD PL+   +L +  
Sbjct: 61  ITKVVQSFTKNAMIFEQKERLGTAHAVLSARLALQEEVDDILIVFGDTPLIEHSSLVRIR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
             +A G  + V GF A +P GYGRL+ KN ++I I EE DA+DEE+K+  CN G+MA++G
Sbjct: 121 AFLADGADVVVAGFYASDPTGYGRLIKKNGKLITIVEEKDASDEEKKVSLCNGGIMALNG 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
            Y +  L +I  N + QEYYLTD++  A     +I  +++    V G NN +EL   + +
Sbjct: 181 KYALSLLNKIDNNNMQQEYYLTDVVSIASRQNLNIQVVEIPFDNVIGINNCFELFEADAL 240

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           WQ R  R +M+SGVT++ PE+V+ S+DT I+P  +IEP+V+FG GV I++   IRAFSYL
Sbjct: 241 WQKRKARDLMLSGVTILKPESVYFSYDTEIEPGVLIEPNVYFGPGVKIQSGAVIRAFSYL 300

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EG  +G+   IGP+AR+R  T +E++V++GNFCE+K+A + E SKINHLSY+GD+ +G N
Sbjct: 301 EGAVVGRDAQIGPYARLRFGTELERSVKVGNFCEIKQAKVGEFSKINHLSYIGDTEIGTN 360

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
            NIGAG ITCNYDG +K+KT I+++ FIGSNS L+AP++IG+G+Y+ASGS+IT+D P NS
Sbjct: 361 TNIGAGAITCNYDGFNKHKTVIDDDVFIGSNSVLVAPLSIGKGSYIASGSVITEDVPINS 420

Query: 421 LVFARSRQIVKEDGALSMR 439
           +VF R+RQ++KED A+ +R
Sbjct: 421 MVFGRARQVIKEDRAIKLR 439


>gi|319783822|ref|YP_004143298.1| UDP-N-acetylglucosamine pyrophosphorylase [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317169710|gb|ADV13248.1| UDP-N-acetylglucosamine pyrophosphorylase [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 451

 Score =  454 bits (1167), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 208/427 (48%), Positives = 298/427 (69%)

Query: 2   KRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI 61
           +R  L+++LAAG G RMKS   KVL +I G PM++HV++    AG  + ALV+G+GA+E+
Sbjct: 3   QRSCLSVILAAGEGTRMKSVLPKVLHQIGGLPMVAHVVKAAEEAGAGSQALVIGHGADEM 62

Query: 62  TRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMD 121
            +         E ++Q+ + GTAHAVL A+DAI  GYDD+++M+GD PL+ +  L  A  
Sbjct: 63  RKAAAKFAPKAETFVQEKRLGTAHAVLAARDAISKGYDDILVMFGDTPLIDADALTVARL 122

Query: 122 KIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
           K+A+G ++ V+GF   +P GYGRL+ K+ ++ AIREE D ++EERKI +CN+G+MA+ G 
Sbjct: 123 KLAEGAAVVVIGFRPPSPTGYGRLIEKDGKLTAIREEKDCSEEERKITFCNAGMMAVAGA 182

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIW 241
           + +  L ++       EYYLTDI+E A   G ++ + +   +   G NNR EL+  E IW
Sbjct: 183 HALALLDRVGNKNAKGEYYLTDIVEIASARGLNVVATEASFESALGINNRAELAQAEAIW 242

Query: 242 QSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLE 301
           Q+R R + M+SGVT+IAPETV+ SHDT I  DT++EP+V+FG GV I    +I AFS++E
Sbjct: 243 QARRRHEAMLSGVTLIAPETVYFSHDTEIGTDTIVEPNVWFGPGVKIATGAKIHAFSHIE 302

Query: 302 GVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNV 361
           G  I     +GP+AR+R    +    ++GNFCEVK+A I+EG+K+NHL+Y+GD+ VG   
Sbjct: 303 GATIASNCDVGPYARLRPGADLRNKAKVGNFCEVKQAVIEEGAKVNHLTYIGDARVGAGA 362

Query: 362 NIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSL 421
           NIGAGTITCNYDG  K+ T I E AF+GSNSSL+AP+TIG+G Y+ASGS+IT+  P+++L
Sbjct: 363 NIGAGTITCNYDGYSKFFTDIGEGAFVGSNSSLVAPVTIGKGGYIASGSVITESVPDDAL 422

Query: 422 VFARSRQ 428
            F R+RQ
Sbjct: 423 AFGRARQ 429


>gi|319404152|emb|CBI77745.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase [Bartonella
           rochalimae ATCC BAA-1498]
          Length = 449

 Score =  453 bits (1166), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 219/441 (49%), Positives = 312/441 (70%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M R  L+IVLAAG G RMKSS  KVL K+AG P++ HV+  I       +A+V+G GAE+
Sbjct: 1   MVRSCLSIVLAAGEGTRMKSSLPKVLHKVAGLPLVCHVIRQIELLNSSQLAVVVGVGAED 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           +T+       +   + Q  + GTAHAVL+A+ A++   DDV+I++GD PL+  +TL K  
Sbjct: 61  VTKTVQSFVKNAMIFEQKERLGTAHAVLSARIALEKEVDDVLIVFGDTPLIEQNTLVKIR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
           +++++G  + V GF   NP GYGRLL K+ +IIAI EE DA+DEE+KI +CN G+MAI G
Sbjct: 121 EQLSKGADVVVTGFYTSNPTGYGRLLNKDGKIIAIVEEQDASDEEKKISFCNGGIMAIKG 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
            Y +  L ++  N +  EYYLTDI+  A  +G +I  ++V    V G NN +EL  ++ +
Sbjct: 181 KYALSLLDKVNNNNLKGEYYLTDIVSIAACEGLNIQVVEVPFDNVVGINNCFELFEVDVL 240

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           WQ R  R +M+SGV ++ PE+V+ S+DT ++ D VIEP+V+FG GV +++   I AFSYL
Sbjct: 241 WQKRKARDLMLSGVRILKPESVYFSYDTEVESDVVIEPNVYFGSGVKVQSGAVIHAFSYL 300

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EGV IG    IGP+AR+R  T +E++V+IGNFCE+K+A I E SKINHLSY+GD+ +GK+
Sbjct: 301 EGVVIGMDAEIGPYARLRPGTELERSVKIGNFCEIKQAKIGECSKINHLSYIGDAEIGKH 360

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
            NIGAGTITCNYDG +K+K  I +NAFIGSNS+L++P+ IG+G Y+ASGS+IT++ P +S
Sbjct: 361 TNIGAGTITCNYDGFNKHKIVIGDNAFIGSNSALVSPLIIGEGAYIASGSVITENVPADS 420

Query: 421 LVFARSRQIVKEDGALSMRKK 441
           +   R+RQI+KED A  +R++
Sbjct: 421 MALGRARQIIKEDRAEKLRER 441


>gi|148558383|ref|YP_001257571.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Brucella ovis ATCC 25840]
 gi|148369668|gb|ABQ62540.1| UDP-N-acetylglucosamine pyrophosphorylase [Brucella ovis ATCC
           25840]
          Length = 469

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 216/439 (49%), Positives = 306/439 (69%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L+IVLAAG G RMKS+  KVL ++A  P++ HV+  +   G  +VALV+G GAE++ 
Sbjct: 19  RTCLSIVLAAGEGTRMKSNLPKVLHRVASLPLVCHVVNAVRGTGKSDVALVVGRGAEDVR 78

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                    V  + Q  + GTAHAVL A++AI  GYDD++I++GD  L+ + +L  A ++
Sbjct: 79  SAVEKIAGPVSAFEQKERLGTAHAVLAAREAIARGYDDLLIVFGDTALIEAQSLLVARER 138

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +AQG  + V+GF   +P GYGRL+ +  +++AI EE +ATDE++KI +CN GLMA+ G +
Sbjct: 139 LAQGADLVVIGFRPASPHGYGRLIEEGGQLVAIIEEKEATDEQKKIGFCNGGLMALRGQH 198

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
           ++  L  +  +    EYYLTDI+  A   G ++ +I+V    V G NNR EL+  E IWQ
Sbjct: 199 VLALLDAVGNDNAKGEYYLTDIVAIAHGKGLNVTAIEVPVDNVIGINNRAELAEAETIWQ 258

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
           +R RR++M+SGVT+IAPETVF S+DT+I+PD VIEP+VFFG  V + +   I +FS+LEG
Sbjct: 259 NRKRRELMLSGVTLIAPETVFFSYDTVIEPDVVIEPNVFFGPSVHVASGALIHSFSHLEG 318

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             +G+K  IGPFAR+R    + +  ++GNFCEVK A + +G+KINHL+Y+GD+V+G + N
Sbjct: 319 AQVGEKAEIGPFARLRPGADLAEKSKVGNFCEVKNAKVGKGAKINHLTYIGDAVIGASSN 378

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG +K+KT I +NAFIGSNSSL+AP+ IG   Y+ASGS+IT D P ++L 
Sbjct: 379 IGAGTITCNYDGYNKFKTIIGDNAFIGSNSSLVAPVEIGDNAYIASGSVITADVPADALA 438

Query: 423 FARSRQIVKEDGALSMRKK 441
             R+RQ  KE  A  +R+K
Sbjct: 439 LGRARQETKEGRAKILREK 457


>gi|319405605|emb|CBI79228.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase [Bartonella
           sp. AR 15-3]
          Length = 449

 Score =  451 bits (1160), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 215/439 (48%), Positives = 312/439 (71%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M R  L+IVLAAG G RM+SS  KVL K+AG P++ HV+  I   G   +A+V+G GAE+
Sbjct: 1   MVRSCLSIVLAAGEGTRMQSSLPKVLHKVAGLPLVCHVIRQIKLLGSTQLAVVVGVGAED 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           +T++      +   + Q  + GTAHAVL+A+ A++   DDV+I++GD PL+  +TL K  
Sbjct: 61  VTKVVQSFVENAMIFEQKKRLGTAHAVLSARFALQKEVDDVLIVFGDTPLIEQNTLVKIR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
           +++A+G  + V GF   NP GYGRLL K+ +I+AI EE DA+DEE+KI +CN G+MAI+G
Sbjct: 121 EQLAKGADVVVTGFYTSNPTGYGRLLNKDGKIVAIVEERDASDEEKKISFCNGGIMAING 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
            Y++  L ++  N + +EYYLTDI+  A  +G +I  ++V   +V G NN +EL  ++ +
Sbjct: 181 KYVLSLLDKVNNNNLKEEYYLTDIVSIAACEGLNIQVVEVSFDKVVGINNCFELFEVDVL 240

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           WQ R  R +M+SGV ++ PE+V+ S+DT ++ D VIEP+V+FG GV + +   I AFSYL
Sbjct: 241 WQKRKARDLMLSGVRILNPESVYFSYDTEVEADVVIEPNVYFGLGVKVRSGAVIHAFSYL 300

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EGV IG    IGP+AR+R  T +E++V+IGNFCE+K+  I E SKINHLSY+GD+ +G +
Sbjct: 301 EGVVIGTNAQIGPYARLRPGTELERSVKIGNFCEIKQTKIGEFSKINHLSYIGDAEIGMH 360

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
            NIGAGTITCNYDG +K+K  I +NAFIGSNS+L++P+ IG+G Y+ASGS+IT + P +S
Sbjct: 361 TNIGAGTITCNYDGFNKHKIVIEDNAFIGSNSALVSPLIIGEGAYIASGSVITGNVPADS 420

Query: 421 LVFARSRQIVKEDGALSMR 439
           + F R++Q++KE  A  +R
Sbjct: 421 MAFGRAQQVIKEGRAKKLR 439


>gi|239833945|ref|ZP_04682273.1| Nucleotidyl transferase [Ochrobactrum intermedium LMG 3301]
 gi|239822008|gb|EEQ93577.1| Nucleotidyl transferase [Ochrobactrum intermedium LMG 3301]
          Length = 466

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 212/430 (49%), Positives = 302/430 (70%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L+IVLAAG G RMKSS  KVL ++AG P++SHV++ +   G  +VALV+G GA+E+ 
Sbjct: 16  RTCLSIVLAAGEGTRMKSSLPKVLHQVAGLPLVSHVVKAVQGTGKSDVALVVGRGADEVR 75

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                    V  + Q  + GTAHAVL A++AI+ GYDD++I++GD PL+ + +L+KA ++
Sbjct: 76  AAVEKNAGPVSAFEQKERLGTAHAVLAAREAIERGYDDLLIVFGDTPLIEAQSLQKARER 135

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +A    + V+GF  +NP GYGRL+ + ++++AI EE +A++ +++I +CN GLMA+ G +
Sbjct: 136 LAGDADVVVIGFRPENPHGYGRLIEEGDKLVAIVEEKEASEAQKQIGFCNGGLMAVRGQH 195

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +  L  +  N    EYYLTDI+  A     ++ +I+V    V G NNR EL+  E IWQ
Sbjct: 196 ALALLDAVDNNNAKGEYYLTDIVAIAHGRDMNVTAIEVPVDNVIGINNRVELAEAEAIWQ 255

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
            R RR+MM++GVT+IAP TVF SHDT+I+ D ++EP+VFFG  V + +   I +FS+LEG
Sbjct: 256 DRKRREMMLAGVTLIAPGTVFFSHDTLIEADVIVEPNVFFGPHVHVASGALIHSFSHLEG 315

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             +G K  IGPFAR+R    + +  ++GNFCEVK AT+ +G+KINHL+Y+GD++VG + N
Sbjct: 316 AEVGPKAEIGPFARLRPGANLGEKTKVGNFCEVKNATLHKGAKINHLTYIGDAIVGASSN 375

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG +KYKT I ENAF+GSNSSL+AP+ IG   Y+ASGS IT + P ++L 
Sbjct: 376 IGAGTITCNYDGYNKYKTVIGENAFVGSNSSLVAPVEIGDNAYIASGSTITDNVPADALA 435

Query: 423 FARSRQIVKE 432
           F R+RQ  KE
Sbjct: 436 FGRARQETKE 445


>gi|163868515|ref|YP_001609724.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Bartonella tribocorum CIP 105476]
 gi|189040831|sp|A9IVJ6|GLMU_BART1 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|161018171|emb|CAK01729.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase [Bartonella
           tribocorum CIP 105476]
          Length = 454

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 213/441 (48%), Positives = 309/441 (70%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M R  L+IVL+AG G RMKS   KVL KIAG P+I HV++ I  A    VA+V+G G +E
Sbjct: 1   MVRSCLSIVLSAGEGTRMKSPLPKVLHKIAGLPLICHVLKQIELAESSQVAVVVGCGGQE 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           +T +       V  + Q  + GTAHAVL+A+ A++ G DD++I++GD PL+   +L +  
Sbjct: 61  VTHVVQSFVKDVMIFEQKERLGTAHAVLSARFALQKGVDDILIVFGDTPLIQQESLHQMR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
            ++A G  +   GF+  +P GYGRLL KN ++IAI EE DA++EE+KI +CN G++A+ G
Sbjct: 121 AQLADGADVVFAGFHTQDPTGYGRLLEKNGQLIAIVEEKDASEEEKKISFCNGGILAMRG 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
            + +  L ++  N + +EYYLTDI   A  +G  +  ++V  + + G NN  ELS  +++
Sbjct: 181 KHALSLLEKVDNNNMKKEYYLTDIASLASREGLDVRVVEVPFENIVGINNCLELSRADSL 240

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           WQ R  R +M+SGVT++ PETV+ S+DT I+P  VIEP+V+FG GV +++   IRAFSYL
Sbjct: 241 WQKRKARDLMLSGVTLLKPETVYFSYDTEIEPGVVIEPNVYFGLGVKVQSGAVIRAFSYL 300

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EG  +G+   IGP+AR+R  T + K+V++GNFCEVK+A + E SKINHLSY+GD+ +G +
Sbjct: 301 EGAVVGQDAQIGPYARLRPGTELAKSVKVGNFCEVKQAKVGESSKINHLSYIGDAEIGAH 360

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
            NIGAGTITCNYDG +KYKT I ++AF+GSN++L++P+ IG G+YVASGS+IT++ P NS
Sbjct: 361 TNIGAGTITCNYDGFNKYKTVIGDHAFVGSNTALVSPLVIGDGSYVASGSVITENIPMNS 420

Query: 421 LVFARSRQIVKEDGALSMRKK 441
           + F R+RQ++KE  A   R +
Sbjct: 421 MAFGRARQVIKEGYATKFRAR 441


>gi|49474351|ref|YP_032393.1| UDP-N-acetylglucosamine pyrophosphorylase [Bartonella quintana str.
           Toulouse]
 gi|81646986|sp|Q6FZH5|GLMU_BARQU RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|49239855|emb|CAF26249.1| UDP-N-acetylglucosamine pyrophosphorylase [Bartonella quintana str.
           Toulouse]
          Length = 448

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 218/437 (49%), Positives = 305/437 (69%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L+IVLAAG G RMKSS  KVL KIAG P++ HV++ I  AG   +A+V+G GA+++T
Sbjct: 2   RSCLSIVLAAGEGTRMKSSLPKVLHKIAGLPLVCHVIKQIELAGASQLAVVVGAGAQDVT 61

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
            +      SV  + Q  + GTAHAVL+A+ A++   DDV+I++GD PL+   +L K  ++
Sbjct: 62  HVVQSFIKSVMIFEQKERLGTAHAVLSARLALQKEVDDVLIVFGDTPLIKQDSLLKVREQ 121

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +A G  + V GF A +P GYGRLL KN ++IAI EE DA+DEE+KI +CN G++A++G  
Sbjct: 122 LAVGADVVVAGFYASDPTGYGRLLEKNGKLIAIVEEKDASDEEKKISFCNGGILALNGKR 181

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +  L ++      QEYYLTDI+  A  +G  +  ++V    + G NN +EL   +++WQ
Sbjct: 182 ALSLLEKVNNYNSKQEYYLTDIVSIASREGLEVQVVEVPFDNIVGINNCFELFEADSLWQ 241

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
            R  R +M+SGVT++ PETV+ S+DT I+   VIEP+V+FG GV +++   I AFSYLEG
Sbjct: 242 KRKARDLMLSGVTILKPETVYFSYDTEIEQGVVIEPNVYFGLGVKVQSGAVIHAFSYLEG 301

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             +G    IGP+A +R  T + ++V+IGNFCEVKKA I E SKINHLSY+GD+ +G   N
Sbjct: 302 AVVGIDAQIGPYAHLRPGTELARSVKIGNFCEVKKAKIGEASKINHLSYIGDAEIGAQTN 361

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG HKYK  I ++AFIGSNS+L++P+ IG G+Y+ASGS+IT+D P NS+ 
Sbjct: 362 IGAGTITCNYDGFHKYKIVIGDHAFIGSNSALVSPLMIGNGSYIASGSVITEDVPINSMA 421

Query: 423 FARSRQIVKEDGALSMR 439
           F R+RQ+ K+D A  +R
Sbjct: 422 FGRARQVTKKDYAAKLR 438


>gi|110634121|ref|YP_674329.1| UDP-N-acetylglucosamine pyrophosphorylase / glucosamine-1-phosphate
           N-acetyltransferase [Mesorhizobium sp. BNC1]
 gi|119370579|sp|Q11HG1|GLMU_MESSB RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|110285105|gb|ABG63164.1| UDP-N-acetylglucosamine pyrophosphorylase [Chelativorans sp. BNC1]
          Length = 454

 Score =  449 bits (1154), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 215/440 (48%), Positives = 299/440 (67%), Gaps = 1/440 (0%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  LA++LAAG G RMKS+  KVL KI G  M+ HVM   ++AG + +ALV+G GAE++ 
Sbjct: 4   RTCLAVILAAGEGTRMKSTLPKVLHKIGGLEMVGHVMNAASSAGADALALVVGNGAEQVR 63

Query: 63  RINFPPTLSV-EYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMD 121
                 T    + ++Q+ + GTAHAVL A++A+  GYDDV++++GD PL+    L  A +
Sbjct: 64  AFAEKQTADRRDIFVQEERLGTAHAVLAAREAMSRGYDDVLVVFGDHPLLDPSVLLSARE 123

Query: 122 KIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
           K+A+G ++AV+GF    P GYGRL+ K   ++AIREE D ++EERKI +CNSG+MAI G 
Sbjct: 124 KLAEGAAVAVLGFRPPVPTGYGRLIEKEGRLVAIREEKDCSEEERKITFCNSGVMAIAGK 183

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIW 241
           + +  + Q+K      EYYLTDI+E A   G  + + +   +   G NNR EL+  E +W
Sbjct: 184 HALALIDQVKNENAKGEYYLTDIVEIANRQGLLVVASEAGRESAVGINNRAELAEAEAVW 243

Query: 242 QSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLE 301
           Q + RR++M+SGVT+IAPETVFLS+DT I PDTVIEP+V+FG GV I +   I AFS++E
Sbjct: 244 QQKRRRELMLSGVTLIAPETVFLSYDTQIGPDTVIEPNVWFGPGVRIASGAHIHAFSHIE 303

Query: 302 GVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNV 361
              +     +GPFAR+R    +++  +IGNFCE+K A I+ G+K+ HLSY+GD+ VG   
Sbjct: 304 EAVVETGATVGPFARLRPGAQVQEKAKIGNFCEIKNARIEPGAKVPHLSYIGDATVGAGA 363

Query: 362 NIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSL 421
           NIGAGTITCNYDG  K+ T I   AFIG+NS+L+AP+TIG G YVASGS++T+D P ++L
Sbjct: 364 NIGAGTITCNYDGFLKHHTEIGAGAFIGTNSALVAPVTIGAGAYVASGSVLTEDVPADAL 423

Query: 422 VFARSRQIVKEDGALSMRKK 441
            F R+RQ   E     +R K
Sbjct: 424 AFGRARQATYEGRGKVLRDK 443


>gi|319898842|ref|YP_004158935.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase [Bartonella
           clarridgeiae 73]
 gi|319402806|emb|CBI76357.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase [Bartonella
           clarridgeiae 73]
          Length = 449

 Score =  447 bits (1151), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 216/441 (48%), Positives = 310/441 (70%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M R  L+IVLAAG G RMKSS  KVL K+AG P++ HV+  I       +A+V+G GAE+
Sbjct: 1   MVRSCLSIVLAAGEGTRMKSSLPKVLHKVAGLPLVCHVIRQIELLDFTQLAVVVGGGAED 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           +T++      +   + Q  + GTAHAVL+A+ A++   DDV+I++GD PL+   TL K  
Sbjct: 61  VTKVVQSFVKNAMIFEQKERLGTAHAVLSARFALQQEVDDVLIIFGDTPLIEQDTLVKIR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
           +++A+G  + V GF   NPKGYGRLL KN +I+AI EE DA+DEE+KI +CN G+MAI+G
Sbjct: 121 EQLAKGADVVVTGFYTSNPKGYGRLLKKNGKIVAIIEEKDASDEEKKISFCNGGIMAING 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
            Y +  L ++  + + +EYYLTDI+  A  +G ++  ++V    V G NN +EL  ++ +
Sbjct: 181 KYALSLLDKVDNDNLKKEYYLTDIVSIAACEGLNVQVVEVPFDNVVGINNCFELFEVDIL 240

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           WQ R  R +M+SGV ++ PE+V+ S+DT ++ D VIEP+V+FG GV + +   I AFSYL
Sbjct: 241 WQKRKARDLMLSGVRILKPESVYFSYDTEVEKDVVIEPNVYFGQGVKVRSGAVIHAFSYL 300

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EGV IG    IGP+AR+R  T +E++V+IGNFCE+K A I E SKINHLSY+GD+ +G +
Sbjct: 301 EGVVIGMDAQIGPYARLRPGTELERSVKIGNFCEIKHAKIGEFSKINHLSYIGDAEIGMH 360

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
            NIGAGTITCNYDG  K+K  I +NAFIGSNS+L++P+ IG+  Y+ASGS+IT++ P +S
Sbjct: 361 TNIGAGTITCNYDGFKKHKIVIGDNAFIGSNSALVSPLIIGERAYIASGSVITENIPADS 420

Query: 421 LVFARSRQIVKEDGALSMRKK 441
           +   R+RQ++KED A  +R++
Sbjct: 421 MALGRARQVIKEDRAKKLRER 441


>gi|13470986|ref|NP_102555.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Mesorhizobium loti MAFF303099]
 gi|75543852|sp|Q98LX2|GLMU_RHILO RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|14021729|dbj|BAB48341.1| UDP-N-acetylglucosamine pyrophosphorylase [Mesorhizobium loti
           MAFF303099]
          Length = 458

 Score =  447 bits (1151), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 212/429 (49%), Positives = 301/429 (70%), Gaps = 4/429 (0%)

Query: 2   KRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI 61
           +R  L+++LAAG G RMKS+  KVL +IAG PM++HV++   AAG  + A+V+G+GAEE+
Sbjct: 3   QRSCLSVILAAGEGTRMKSALPKVLHQIAGLPMVAHVVKAADAAGASSDAIVIGHGAEEM 62

Query: 62  TR--INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKA 119
            +    F P    E ++Q+ + GTAHAVL A++AI  GYDD+++M+GD PL+ +  L  A
Sbjct: 63  RKAVTKFSP--KAETFVQEERLGTAHAVLAAREAISRGYDDILVMFGDTPLIDAEALNLA 120

Query: 120 MDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAID 179
             K+A+G ++AV+GF    P GYGRL+ K  ++IAIREE D ++ E+KI +CN+G+MA+ 
Sbjct: 121 RLKLAEGAAVAVIGFRPPLPNGYGRLVEKGGKLIAIREEKDCSEAEKKIGFCNAGMMAVA 180

Query: 180 GLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIEN 239
           G + +  L  +       EYYLTDI+E A   G  + + +   +   G NNR EL+  E 
Sbjct: 181 GAHALKLLDAVGNKNAKGEYYLTDIVEIAGAQGLDVVATEASFENALGINNRAELAQAEG 240

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSY 299
           IWQ+R R++ M+SGVT+IAPETV+ SHDT I  DTV+EP+V+FG GV I    +I AFS+
Sbjct: 241 IWQARRRQEAMLSGVTLIAPETVYFSHDTEIGADTVVEPNVWFGPGVKIAGGAKIHAFSH 300

Query: 300 LEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGK 359
           +EG  I     +GPFAR+R    +    ++GNFCEVK+A I+EG+K+NHL+Y+GD+ VG 
Sbjct: 301 IEGATIAANCDVGPFARLRPGADLRNKAKVGNFCEVKQAVIEEGAKVNHLTYIGDARVGA 360

Query: 360 NVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPEN 419
             NIGAGTITCNYDG  K+ T I E AF+GSNSSL+AP++IG+G Y+ASGS+IT+  P++
Sbjct: 361 GANIGAGTITCNYDGFSKFFTDIGEGAFVGSNSSLVAPVSIGKGGYIASGSVITESVPDD 420

Query: 420 SLVFARSRQ 428
           +L F R+RQ
Sbjct: 421 ALAFGRARQ 429


>gi|90419662|ref|ZP_01227572.1| UDP-N-acetylglucosamine pyrophosphorylase [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336599|gb|EAS50340.1| UDP-N-acetylglucosamine pyrophosphorylase [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 454

 Score =  443 bits (1139), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 205/431 (47%), Positives = 285/431 (66%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M R+ L+I+LAAG G RM+SS SKVL K+AG  MI HV+    AAG ++VALV+G     
Sbjct: 1   MARRCLSIILAAGEGTRMRSSKSKVLHKVAGLEMIRHVVRAARAAGSDDVALVVGRDGTS 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           +         SV  + Q  + GT HAVL A++A+  G+DD+++++GD PL+ + TL +A 
Sbjct: 61  VADAARREIASVAAHEQTERLGTGHAVLAAREALAQGFDDILVLFGDTPLIGADTLARAR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
           + +A+G  + VVGF   +P GYGRL+    E++AIREE DA  EER++ +CN+G+MA  G
Sbjct: 121 ETLAEGADVCVVGFRPLDPTGYGRLIEAEGELVAIREEKDADAEERRVGFCNAGVMAFRG 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
              +  L  I       EYYLTD++  AR  G  + +I+    EV G N R EL+ +E +
Sbjct: 181 DNALAMLDAIGNANAKGEYYLTDLVAIARAAGCRVRAIEADASEVLGVNTREELAQVEAL 240

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           WQ  +RRQ+M+SGVT+  P +VF SHDT ++PD  +EP V FG GV +E    I AFS+L
Sbjct: 241 WQGAWRRQVMLSGVTLQDPGSVFFSHDTELEPDVFVEPQVVFGPGVRVEAGATIHAFSHL 300

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EG H+G    +GPFAR+R    + +  ++GNFCEVK A I  G+K+NHLSY+GD+ VG  
Sbjct: 301 EGCHVGPSASVGPFARLRPGADLAQGAKVGNFCEVKNAEIGVGAKVNHLSYIGDTSVGAA 360

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
            NIGAGTITCNYDG  K++T I   +FIGSNS+L+AP+ IG+G YV +GS++T D P+ +
Sbjct: 361 ANIGAGTITCNYDGALKHRTEIGAGSFIGSNSALVAPVRIGEGAYVGTGSVVTDDVPDGA 420

Query: 421 LVFARSRQIVK 431
           L  AR RQ+ K
Sbjct: 421 LAIARERQVTK 431


>gi|260463944|ref|ZP_05812140.1| UDP-N-acetylglucosamine pyrophosphorylase [Mesorhizobium
           opportunistum WSM2075]
 gi|259030319|gb|EEW31599.1| UDP-N-acetylglucosamine pyrophosphorylase [Mesorhizobium
           opportunistum WSM2075]
          Length = 452

 Score =  442 bits (1136), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 213/427 (49%), Positives = 294/427 (68%)

Query: 2   KRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI 61
           +R  L+I+LAAG G RMKS+  KVL +IAG PM++HV +   AAG  + ALV+G+GAEE+
Sbjct: 3   QRSCLSIILAAGEGTRMKSALPKVLHQIAGLPMVAHVAKAAEAAGAGDQALVIGHGAEEM 62

Query: 62  TRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMD 121
            +         E ++Q+ + GTAHAVL A++AI  GYDDV++M+GD PL+    L  A  
Sbjct: 63  RKAAAKFAPKAEIFVQEKRLGTAHAVLAAREAISRGYDDVLVMFGDTPLIDPGALTVARL 122

Query: 122 KIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
           K+A+G ++ V+GF   NP GYGRL+ K  +++AIREE D ++EE+KI +CN GLMA+ G 
Sbjct: 123 KLAEGAAVVVIGFRTPNPTGYGRLIEKGGKLVAIREEKDCSEEEKKITFCNGGLMAMAGS 182

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIW 241
             +  L  +       EYYLTDI+E A   G  + + +   +   G NNR EL+  E IW
Sbjct: 183 QALKLLDAVGNTNAKGEYYLTDIVEIASGQGLDVVATEASFENALGINNRAELAQAEGIW 242

Query: 242 QSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLE 301
           Q R R + M+SGVT+IAPETVF SHDT I  DT++EP V+FG GV I    +I AFS++E
Sbjct: 243 QQRRRYEAMLSGVTLIAPETVFFSHDTEIGADTIVEPDVWFGPGVKIAGGAKIHAFSHIE 302

Query: 302 GVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNV 361
           G  +     +GPFAR+R    + +  ++GNFCEVK+A ++EG+K+NHL+Y+GD+ VG   
Sbjct: 303 GATVAANCDVGPFARLRPGADLREKAKVGNFCEVKQAVVEEGAKVNHLTYIGDARVGAGA 362

Query: 362 NIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSL 421
           NIGAGTITCNYDG  K+ T I E AF+GSNSSL+AP+TIG+G Y+ASGS+IT+  P+++L
Sbjct: 363 NIGAGTITCNYDGYSKFFTDIGEGAFVGSNSSLVAPVTIGKGGYIASGSVITESVPDDAL 422

Query: 422 VFARSRQ 428
            F R+RQ
Sbjct: 423 AFGRARQ 429


>gi|163760205|ref|ZP_02167288.1| probable udp-n-acetylglucosamine pyrophosphorylase protein [Hoeflea
           phototrophica DFL-43]
 gi|162282604|gb|EDQ32892.1| probable udp-n-acetylglucosamine pyrophosphorylase protein [Hoeflea
           phototrophica DFL-43]
          Length = 455

 Score =  441 bits (1135), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 215/448 (47%), Positives = 294/448 (65%), Gaps = 13/448 (2%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M R  LA+VLAAG   RMKSS SKVL  +   P+I+HV  + AAAG+  +ALV+G  A+ 
Sbjct: 1   MARTCLAVVLAAGDATRMKSSKSKVLHTVGNLPLIAHVTGSAAAAGVRKIALVVGRDADA 60

Query: 61  ITR-------INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSS 113
           +         +   P +  E      ++GT HAVL A+D I  GYDDV+++YGD P++  
Sbjct: 61  VAMAARSGHDVPIAPVMQTE------RKGTGHAVLMAKDIIAEGYDDVVVLYGDAPMIDP 114

Query: 114 HTLKKAMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNS 173
            +L+ A+ + + G  + V+GF A +P GYGRL+ ++ E++AIRE+ +AT EE +I +CN 
Sbjct: 115 ESLRAAVTERSAGADVVVLGFRAADPTGYGRLIERDGELVAIREQKEATAEELEIDFCNG 174

Query: 174 GLMAIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYE 233
           G++   G   +  L  I  +    EYYLTDI+E AR  G    +I+  E+++ GCN R E
Sbjct: 175 GIITFSGAQAISLLEAIGNDNAKGEYYLTDIVEIARERGLKCVAIEASEEDMMGCNTRAE 234

Query: 234 LSLIENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQ 293
           L+ IE +WQ R R + M+SGVTMI P TV+LS DT +  D VIEP+V+FG GV +     
Sbjct: 235 LAEIEVVWQQRARHRAMLSGVTMIDPATVYLSFDTELGNDVVIEPNVWFGPGVRVGQSAV 294

Query: 294 IRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVG 353
           I AFS+LEG  +G    IGPFAR+R    + + V++GNFCEVKKA I EG+K+NHLSY+G
Sbjct: 295 IHAFSHLEGTVVGAHAQIGPFARLRPGADLAEKVKVGNFCEVKKARIGEGAKVNHLSYIG 354

Query: 354 DSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIIT 413
           D+V+G   NIGAGTITCNYDG +K+ T I   AFIGSNSSL+AP+ IG G YV SGS++T
Sbjct: 355 DAVIGAGANIGAGTITCNYDGQNKHLTEIGAGAFIGSNSSLVAPVKIGDGAYVGSGSVVT 414

Query: 414 QDTPENSLVFARSRQIVKEDGALSMRKK 441
            D PE++L  AR+RQ  K   A  +R+K
Sbjct: 415 MDVPEDALAVARARQETKPGRAKRLREK 442


>gi|298291787|ref|YP_003693726.1| UDP-N-acetylglucosamine pyrophosphorylase [Starkeya novella DSM
           506]
 gi|296928298|gb|ADH89107.1| UDP-N-acetylglucosamine pyrophosphorylase [Starkeya novella DSM
           506]
          Length = 450

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 212/444 (47%), Positives = 301/444 (67%), Gaps = 9/444 (2%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYG----A 58
           R+ L IVLAAG G RM S+  KVL ++AG+PM+SHV++T  AAG  ++A+V+G G    A
Sbjct: 2   RQLLVIVLAAGEGTRMLSALPKVLHRLAGRPMVSHVLDTALAAGAAHLAVVVGPGHEAVA 61

Query: 59  EEITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKK 118
            E+ R+        E ++Q  ++GTAHAVL A++A+  GYDDV++MYGD PLV   T+ +
Sbjct: 62  AEVRRV----APEAELFVQSERRGTAHAVLAAREALARGYDDVVVMYGDTPLVRIETIGE 117

Query: 119 AMDKIAQGYSIAVVGFNADNPKGYGRLLIKNN-EIIAIREENDATDEERKIHYCNSGLMA 177
               +A G +++V+GF  D+P GYGRL+   +  ++AIRE  +A+ EE  +  CN+GLMA
Sbjct: 118 LRGPLAGGAAVSVLGFRPDDPTGYGRLVTDGDGALVAIREHKEASPEELAVGLCNAGLMA 177

Query: 178 IDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLI 237
           +DG   +D L  +      +E+YLTD++E AR  G++ A  +   +EV G N+R +L+  
Sbjct: 178 LDGRAALDILQSVGDANAKKEFYLTDVVEIARALGRAAAVCEAAVEEVVGVNSRAQLAEA 237

Query: 238 ENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAF 297
           E I Q+R RR  M +G T++APETVF S DT +  D VIEP+VFFG GVS+E    IRAF
Sbjct: 238 EAILQARLRRHAMDNGATLVAPETVFFSADTKLGRDVVIEPNVFFGPGVSVEEGATIRAF 297

Query: 298 SYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVV 357
           S++EG H+G   I+GPFAR+R    + + V +GNF E+K + +  G K+NHLSYVGDS V
Sbjct: 298 SHVEGAHVGAGAIVGPFARLRPGAELGEGVHVGNFVEIKASDLAPGVKVNHLSYVGDSSV 357

Query: 358 GKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTP 417
           G N NIGAGTITCNYDG  K++T I  NAFIG+NS L+AP+T+G G Y+ +GS+IT+D P
Sbjct: 358 GANTNIGAGTITCNYDGFRKHRTTIGANAFIGTNSLLVAPVTVGDGAYLGTGSVITEDVP 417

Query: 418 ENSLVFARSRQIVKEDGALSMRKK 441
            ++L   R+RQ+ K   A  +R++
Sbjct: 418 ADALAIGRARQVNKPGLAKRLRER 441


>gi|307942222|ref|ZP_07657573.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Roseibium sp. TrichSKD4]
 gi|307774508|gb|EFO33718.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Roseibium sp. TrichSKD4]
          Length = 450

 Score =  418 bits (1075), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 197/439 (44%), Positives = 295/439 (67%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L+IVLAAG G RM+SS  KV+ +I   P++ HV++ ++A+G++  A+V+G    E+ 
Sbjct: 4   RSCLSIVLAAGLGTRMRSSMPKVMHEIGNLPLVGHVLKALSASGVKETAVVVGPDMPELE 63

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
           +     +   + + Q  + GTAHA L A++ ++  +DDV+I++GD PL+++  + + +  
Sbjct: 64  KTVANLSEGAQCFTQVDRLGTAHAALAAREVLEEEHDDVLILFGDTPLITTDMISEVLGA 123

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +A G  + VVGF   NP GYGRLL+K  +++AIREE DA+DEER++ +CNSG+M   G  
Sbjct: 124 LAAGADLVVVGFETANPFGYGRLLMKGEQLLAIREEKDASDEEREVTFCNSGIMGFAGSK 183

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
           ++  L QI  +  + EYYLTD +E A   G  + +++  E+++ G N R +LS  E ++Q
Sbjct: 184 VLALLDQIGNDTANGEYYLTDAVELANASGLKVVAVNAPEEDLQGINTRAQLSDCEAVFQ 243

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
            R R + M  GVT+  P +V+ SHDT I  D V+EP+V FG GV IE   +IRAFS+LEG
Sbjct: 244 QRKRLEAMARGVTLQDPASVYFSHDTRIAQDVVVEPNVVFGPGVRIETGSRIRAFSHLEG 303

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             +G ++ IGP+AR+R  T +E N R+GNF E+K A +++G+K+NHLSYVGD+ VG   N
Sbjct: 304 AVVGAESQIGPYARLRPGTNLEGNNRVGNFVEMKNAAVEKGAKVNHLSYVGDASVGARTN 363

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG +K+KT I  + F+GSNS+L+AP+T+G G ++A+GS IT+   EN+L 
Sbjct: 364 IGAGTITCNYDGFNKHKTEIGSDCFVGSNSTLVAPVTLGDGAFIAAGSTITKAVSENALA 423

Query: 423 FARSRQIVKEDGALSMRKK 441
             RSRQ   E  A  +R +
Sbjct: 424 VGRSRQSELEGRANVLRSR 442


>gi|304391605|ref|ZP_07373547.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Ahrensia sp. R2A130]
 gi|303295834|gb|EFL90192.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Ahrensia sp. R2A130]
          Length = 460

 Score =  417 bits (1073), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 195/421 (46%), Positives = 280/421 (66%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG G RM+S + KVL  +AG  M++HV++T  + G + VA+V+G  AE +  +   
Sbjct: 12  VILAAGEGKRMRSDTPKVLHPVAGLAMVNHVIDTAISTGSDTVAVVVGNQAERVEAVVRG 71

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
            + +V  +IQ  ++GTAHAVL A+  I+    D++I+YGDVPL+ S  +  A + +  G 
Sbjct: 72  HSDTVSTHIQHERKGTAHAVLAARAVIEKAGGDLVILYGDVPLIRSEAIDSAREALRSGC 131

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            + V+GF+   P GYGRLL    +++AIREE DATDEERK+ +CNSG+MA    + +D L
Sbjct: 132 DVVVLGFHTAKPTGYGRLLTDGAQLLAIREEKDATDEERKVTFCNSGIMAFRAEHALDLL 191

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
             +       EYYLTD +E AR  G    +I+V E +  G N+R +L+ +E +WQ R R 
Sbjct: 192 DAVGSGNAQGEYYLTDTVEIARERGLKAVAIEVPEADTLGVNDRVQLAQVEELWQQRRRE 251

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
             M  GVTM +P TV L HDT +  D +IEP+V F  GVSI +   IRAFS+LEG  +G+
Sbjct: 252 AAMRDGVTMTSPGTVILHHDTQLASDCIIEPNVVFAAGVSISSGATIRAFSHLEGATVGE 311

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
             ++GP+AR+R    + K+ ++GNF E+K AT+ EG+K+NHLSY+GD+ VG   NIGAGT
Sbjct: 312 GAVVGPYARLRPGADLGKSTKVGNFVEIKGATLGEGAKVNHLSYIGDAEVGAKANIGAGT 371

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           ITCNYDG +K+KT I E AFIGSN+SL+AP+T+G G   A+GS+I++D   ++L   R+ 
Sbjct: 372 ITCNYDGYNKWKTRIGEGAFIGSNTSLVAPVTVGAGIITAAGSVISRDVEADALAITRAE 431

Query: 428 Q 428
           Q
Sbjct: 432 Q 432


>gi|158423342|ref|YP_001524634.1| glucosamine-1-phosphate N-acetyltransferase [Azorhizobium
           caulinodans ORS 571]
 gi|172047944|sp|A8I4D4|GLMU_AZOC5 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|158330231|dbj|BAF87716.1| glucosamine-1-phosphate N-acetyltransferase [Azorhizobium
           caulinodans ORS 571]
          Length = 448

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 207/441 (46%), Positives = 288/441 (65%)

Query: 2   KRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI 61
           +R  L +VLAAG G RM S   KVL +IAG+ M+ HV+ET   AG   VA+V+G   E++
Sbjct: 3   ERSLLVVVLAAGEGTRMASRLPKVLHRIAGRSMLHHVLETTRQAGATRVAVVIGPDREDV 62

Query: 62  TRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMD 121
                      + ++Q  + GTAHAVL A+ A++   DDV+++Y D PL+   TL+    
Sbjct: 63  AAEAHRVRPDAQVFVQTERLGTAHAVLAARAALEEPADDVLVLYADTPLLRPETLENLRA 122

Query: 122 KIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
            +A G ++AV+GF   +P GYGRLL + + ++AIREE DAT +ER++ +CN+G+MA+   
Sbjct: 123 PLADGAAVAVLGFRPADPTGYGRLLTQGDALVAIREEKDATPDERRVDFCNAGVMALRAR 182

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIW 241
             +  L +I       EYYLTD +E AR DG S  + + +  EV G N+R +L+  E I 
Sbjct: 183 EALSILTRIGNANAKGEYYLTDAVEIARADGLSAVATEAEVDEVAGVNSRLQLAEAEAIL 242

Query: 242 QSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLE 301
           Q R RR  M  G T++APETVFLS DT +  D ++EP+V FG GV++E+ V I AFS+LE
Sbjct: 243 QGRLRRAAMAGGATLVAPETVFLSVDTRLGRDVLVEPNVVFGPGVTVEDDVVIHAFSHLE 302

Query: 302 GVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNV 361
           G H+ +   IGP+AR+R  T + + VRIGNF E K A I  G+K+NHLSYVGD+ VG N 
Sbjct: 303 GAHLERGVSIGPYARLRPGTRLGEGVRIGNFVETKAALIDAGAKVNHLSYVGDAHVGSNA 362

Query: 362 NIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSL 421
           N+GAGTITCNYDG  K++T I   AFIG+NSSL+AP+++G G Y+ SGS+IT D P ++L
Sbjct: 363 NVGAGTITCNYDGFSKHRTEIGAGAFIGTNSSLVAPVSVGAGAYIGSGSVITDDVPADAL 422

Query: 422 VFARSRQIVKEDGALSMRKKK 442
              R RQ VKE  A ++R  +
Sbjct: 423 ALGRGRQAVKEGWAAALRAAR 443


>gi|217976895|ref|YP_002361042.1| UDP-N-acetylglucosamine pyrophosphorylase [Methylocella silvestris
           BL2]
 gi|217502271|gb|ACK49680.1| UDP-N-acetylglucosamine pyrophosphorylase [Methylocella silvestris
           BL2]
          Length = 460

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 210/444 (47%), Positives = 290/444 (65%), Gaps = 7/444 (1%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLG--YGAEE 60
           R  LAIVLAAG G RM+S   K + K+AG+ M+ HV+  +A AG + + +V+G   GA E
Sbjct: 17  RTCLAIVLAAGNGKRMRSKLPKAMHKLAGRSMLGHVLSAVAKAGADKIVVVVGPDQGALE 76

Query: 61  I-TRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKA 119
              R+  P    VE  IQ  ++GTAHAVL A++AI  GYDD+I+ + D PLV   T  K 
Sbjct: 77  AEARLIVP---DVELVIQAERRGTAHAVLAAREAIAAGYDDIIVAFADTPLVQPETFSKM 133

Query: 120 MDKIAQG-YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAI 178
              +A G  +I  +GF A +P GYGRL++K+  + +IRE+ DA  +ERK+  CN+GLM I
Sbjct: 134 RIALAAGETAIVCLGFEAKDPTGYGRLIMKDGVLESIREDRDANPDERKLSTCNAGLMGI 193

Query: 179 DGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIE 238
            G + +D L  I      +EYYLTDI+  AR    +  ++ V++ EV G N+R +L+L E
Sbjct: 194 AGRHALDLLGAIGCENSQREYYLTDIVAIARAQKLASCALIVQQDEVMGVNDRAQLALAE 253

Query: 239 NIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFS 298
            + QSR R Q M  G T++ PE+V L++DT +  D  IEPHV FG GV ++    IR+FS
Sbjct: 254 ALMQSRLRTQAMSLGATLVDPESVTLAYDTTLGEDVTIEPHVVFGPGVEVKTGALIRSFS 313

Query: 299 YLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVG 358
           +LEG ++G+   +GPFAR+R    + + V IGNF EVK + +  G+KINHLSY+GD+ VG
Sbjct: 314 HLEGANVGENATVGPFARLRPGARLMQEVHIGNFVEVKASEVGAGAKINHLSYIGDASVG 373

Query: 359 KNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPE 418
              N+GAGTITCNYDG  KY+T I E AFIGS+S+L+AP+ IG G YVA+GS++T+D   
Sbjct: 374 AKSNLGAGTITCNYDGFAKYRTEIGEGAFIGSHSALVAPVAIGAGAYVATGSVVTRDVLP 433

Query: 419 NSLVFARSRQIVKEDGALSMRKKK 442
           +SLV AR+RQ  K   A   R+KK
Sbjct: 434 DSLVVARARQTEKPGWAAGFRQKK 457


>gi|254469635|ref|ZP_05083040.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Pseudovibrio sp. JE062]
 gi|211961470|gb|EEA96665.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Pseudovibrio sp. JE062]
          Length = 452

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 201/438 (45%), Positives = 291/438 (66%), Gaps = 6/438 (1%)

Query: 6   LAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRIN 65
           LAIVLAAG G RM+S+  KV+ +I G P++ HV+ ++  AG + VA+V+G    E+ ++ 
Sbjct: 7   LAIVLAAGLGTRMRSALPKVMHEIGGLPLVGHVLNSVVHAGADKVAVVVG---PEMPKLE 63

Query: 66  FPPTLSVEY---YIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
               + V +   ++Q  + GTAHAV  A+DA K   D V++++GD PLV + TL +  ++
Sbjct: 64  EHVAIRVPHATCHVQVDRLGTAHAVKAAEDAYKSASDHVLVLFGDTPLVKADTLHRLRER 123

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           ++ G  + V+GF AD+P GYGRLL  + E++AIREE +ATDEER++  CN+G+MA  G  
Sbjct: 124 LSGGADVVVLGFEADDPFGYGRLLESDGELVAIREEKEATDEERRVTLCNAGIMAFKGSA 183

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
           + D + +IK +    EYYLTD +E AR  G  + S    E+EV G NNR +L+  E ++Q
Sbjct: 184 LPDLIAEIKNDNAKGEYYLTDAVEVARSKGMRVVSELADEKEVQGINNRSQLASCEAVFQ 243

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
              R   M +GVT+ APETV+ S DT I PD V+EP+V FG GV +++  +IRAFS+LE 
Sbjct: 244 QVQRETFMENGVTLQAPETVYFSWDTEIDPDVVVEPNVVFGPGVHVDSGARIRAFSHLEK 303

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
            H+     +GP+AR+R    I +   IGNF E+K A ++ G+K+NHLSY+GD+ VG   N
Sbjct: 304 AHVSADATVGPYARLRPGADIGEGAHIGNFVEIKNAKVESGAKVNHLSYIGDARVGAKSN 363

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG  K+ T I   +F+GS+S L+AP+T+G G +VA+GS++T D PEN+L 
Sbjct: 364 IGAGTITCNYDGYLKHHTDIGAGSFVGSDSVLVAPLTLGDGAFVAAGSVVTSDVPENALA 423

Query: 423 FARSRQIVKEDGALSMRK 440
             R +Q+ KE  A  MR+
Sbjct: 424 IGRGQQVNKEGRAKVMRE 441


>gi|209885339|ref|YP_002289196.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Oligotropha carboxidovorans OM5]
 gi|254798781|sp|B6JFB2|GLMU_OLICO RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|209873535|gb|ACI93331.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Oligotropha carboxidovorans OM5]
          Length = 451

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 202/440 (45%), Positives = 288/440 (65%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L +VLAAG G RM+SS  KVL ++AG+ ++++V+    A   + +A+V+G   + + 
Sbjct: 4   RSSLTLVLAAGEGTRMRSSRPKVLHEVAGRSLLANVLLAAPAGKQDRLAVVVGPDHQAVA 63

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                     + ++Q  ++GTAHAVL A++AI  G DD+++++GD PLV++ T  +    
Sbjct: 64  DEARKLRPEAQMFVQSERKGTAHAVLAAREAIAGGADDLLVVFGDTPLVTAETFARLQAA 123

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +    +I V+GF A +P GYGRLL++ NE+IAIRE+ DA++ ERK+  CN+G+MA  G  
Sbjct: 124 LTGDVAIVVLGFRAKDPAGYGRLLVQGNELIAIREQADASEAERKVDLCNAGMMAFAGKS 183

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +  L +I       EYYLTD I  AR  G   A I+  E EV G N + +L+  E + Q
Sbjct: 184 ALTILERIGNANSKGEYYLTDAIGIAREMGLRAAVIETDEDEVRGINTKAQLAEAETVMQ 243

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
           +R RRQ M +GVT++APETVFLS DT    D VIEP V  G GVSI++   I +FS++  
Sbjct: 244 ARLRRQAMEAGVTLVAPETVFLSADTTFGRDVVIEPFVVIGPGVSIDDGAVIHSFSHVTQ 303

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             IGKK  IGP+ARIR  T++ + VRIGNF E K A ++ G K+NHLSYVGD+ VG N N
Sbjct: 304 SSIGKKVSIGPYARIRPGTSLGEGVRIGNFVETKAAVLESGVKVNHLSYVGDAHVGTNAN 363

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTI CNYDG  K++T +   AF+GSNSSL+AP+ IG G+Y+ SGS+IT++ PE++LV
Sbjct: 364 IGAGTIMCNYDGFDKHRTEVGAGAFVGSNSSLVAPVKIGAGSYIGSGSVITREVPEDALV 423

Query: 423 FARSRQIVKEDGALSMRKKK 442
             R+ Q+ +   A   R++K
Sbjct: 424 VERNEQVTRPGWAKRYRERK 443


>gi|300023165|ref|YP_003755776.1| UDP-N-acetylglucosamine pyrophosphorylase [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299524986|gb|ADJ23455.1| UDP-N-acetylglucosamine pyrophosphorylase [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 450

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 208/424 (49%), Positives = 266/424 (62%), Gaps = 2/424 (0%)

Query: 6   LAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRIN 65
           L +VLAAG+G RMKSS  KVL KIAG+ M++HV+ T++     +VA+V+G G E +    
Sbjct: 7   LFVVLAAGKGTRMKSSEPKVLHKIAGQSMLAHVLATVSDV-QGDVAVVVGPGMEAVATEA 65

Query: 66  FPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQ 125
              T   + ++Q  QQGTA AVL A+ A+     DV+++Y D PL+   T+ +    +  
Sbjct: 66  RRVTPPAQVFVQATQQGTADAVLAARPALAGHSGDVVVLYADTPLIRPETVARLRAALDA 125

Query: 126 GYSIAVVGFNADNPKGYGRLLI-KNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
           G  IAV+GF A +P GYGRLL      + AIREE DA++ ER+I  CNSG+MA     + 
Sbjct: 126 GAHIAVLGFRAKDPTGYGRLLTDPKGTLSAIREEKDASEAERRIDLCNSGVMAFRVPDVA 185

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSR 244
             L QI       E+YLTD IE     G     ++  E EV G N R +L+  E IWQ R
Sbjct: 186 KLLGQIGNANAKGEFYLTDAIEIGVRSGLRAGVVECSEDEVLGVNARDQLAEAEAIWQKR 245

Query: 245 YRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVH 304
            R Q M SGVTMIAPETV+LS DT I PD VIEPHV FG GV+IE  V+I  FS+ EG  
Sbjct: 246 ARAQFMASGVTMIAPETVWLSFDTQIAPDVVIEPHVIFGVGVTIEEGVRILGFSHFEGAV 305

Query: 305 IGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIG 364
           IGK   +GPF+R R    I  +  +GNF EVK  T+  G+K NHL+Y+GD V+G   N+G
Sbjct: 306 IGKDARVGPFSRFRPGARIGADAHVGNFVEVKNTTLGPGAKANHLAYLGDGVIGAKANVG 365

Query: 365 AGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFA 424
           AGT+ CNYDG  K+KT I E AFIGSNSSL+AP+TIG G YV SGS+IT+D    +L   
Sbjct: 366 AGTVFCNYDGYAKHKTEIGEGAFIGSNSSLVAPVTIGAGAYVGSGSVITRDVTPGALALE 425

Query: 425 RSRQ 428
           RS Q
Sbjct: 426 RSSQ 429


>gi|182678773|ref|YP_001832919.1| UDP-N-acetylglucosamine pyrophosphorylase [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182634656|gb|ACB95430.1| UDP-N-acetylglucosamine pyrophosphorylase [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 452

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 199/440 (45%), Positives = 282/440 (64%), Gaps = 1/440 (0%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R+ LA+VLAAG G RMKS+  KVL  +AG+ M++HV+ T+  A + ++ +V+G   E + 
Sbjct: 10  RRCLAVVLAAGLGSRMKSAQPKVLHALAGRSMLAHVLATLREADVSDIVVVVGPDQEGVA 69

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
           +            IQ  + GTAHAVL A+ +++ G+DD+++++ D PLVS+ T       
Sbjct: 70  QEAAAMIPHATIAIQAERLGTAHAVLAARKSLEKGFDDLLVVFADTPLVSAETFIAMRAV 129

Query: 123 IAQGYSIAVV-GFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
           +A+  + A+V GF A +P GYGRL+++  ++IAIREE DA   ER +  CN GLMA+ G 
Sbjct: 130 LAETKAAALVLGFEAADPTGYGRLILEQGQLIAIREERDADPSERALTLCNGGLMALAGE 189

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIW 241
             +  L +I K     EYYLTDI+  AR  G+    + V E EV G N+R +L+  E++ 
Sbjct: 190 QALGLLDRIGKANAQGEYYLTDIVALARDTGQEAEVLIVPEDEVMGVNDRVQLARAESLL 249

Query: 242 QSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLE 301
           Q R R + M +G T+I P ++FLS DT +  D ++EPHV FG GV+I    +IRAFS+LE
Sbjct: 250 QDRLREKAMRAGATLIDPASIFLSFDTQLDRDVIVEPHVVFGPGVTIGEGARIRAFSHLE 309

Query: 302 GVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNV 361
              +G   IIGPFAR+R    + + V IGNF E+K   +  G+KINHLSY+GD+ +G   
Sbjct: 310 EARVGAGAIIGPFARLRPGADLAEAVHIGNFVEIKATKVGAGAKINHLSYIGDASIGAKT 369

Query: 362 NIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSL 421
           NIGAGTITCNYDG  K+KT I   AFIGS ++L+AP+ +G G YV +GS+IT D PE++L
Sbjct: 370 NIGAGTITCNYDGFGKFKTEIGAGAFIGSQTALVAPVKVGDGAYVGTGSVITHDVPEDAL 429

Query: 422 VFARSRQIVKEDGALSMRKK 441
             AR RQI K   A + R+K
Sbjct: 430 AIARERQIDKPGWAKAFREK 449


>gi|114704727|ref|ZP_01437635.1| UDP-N-acetylglucosamine pyrophosphorylase [Fulvimarina pelagi
           HTCC2506]
 gi|114539512|gb|EAU42632.1| UDP-N-acetylglucosamine pyrophosphorylase [Fulvimarina pelagi
           HTCC2506]
          Length = 453

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 193/433 (44%), Positives = 279/433 (64%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M R  L I+LAAG G RM+SS SKVL ++   P++ HV     +AG   +A+V+G   + 
Sbjct: 1   MSRTCLTIILAAGEGTRMRSSRSKVLHEVGHLPLVRHVARAALSAGAAQLAVVVGRDGKA 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           +         +V+ + QD + GT HAVL A+ AI  G+DD+++++GD PL++  TL +A 
Sbjct: 61  VADAVREDAPNVQPFRQDERLGTGHAVLAARSAIMQGFDDIVVLFGDTPLLTEDTLMRAR 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
            ++A G  + V+GF   +P GYGRL+ +  E++AIRE  DA++ ER I +CN+G+MA  G
Sbjct: 121 GELAGGAGVCVIGFRPADPTGYGRLIEEEGELVAIREHKDASELERAIGFCNAGIMAFAG 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
              +  L +I  +    EYYLTD++  AR DG  + +I+    E  G NNR EL+ +E++
Sbjct: 181 WGALAMLDKIGNDNAKGEYYLTDLVAIARADGHRVTAIEAPVAETIGVNNRSELAEVESL 240

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           WQ   R + MI G T+  P++V+ ++DT I  D  IEP+V FG GV IE    I  FS++
Sbjct: 241 WQDVARERAMIGGATLTDPKSVYFAYDTEIAEDVTIEPNVIFGPGVIIEANALIHGFSHI 300

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           +G  IG    +GPFAR+R    + +N ++GNFCEVK+A I  G+K+NHLSY+GD+ VG  
Sbjct: 301 KGARIGAGASVGPFARLRPGANLGENSKVGNFCEVKQADIAAGAKVNHLSYIGDAKVGAA 360

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
            NIGAGTITCNYDG  K+ T I  NAFIGSNS+L+AP+ IG G Y+ SGS+IT+D  +++
Sbjct: 361 ANIGAGTITCNYDGALKHLTEIGANAFIGSNSALVAPVRIGNGAYIGSGSVITEDVEDDA 420

Query: 421 LVFARSRQIVKED 433
           L   R RQ+ K +
Sbjct: 421 LGLGRGRQVNKPE 433


>gi|118589917|ref|ZP_01547321.1| UDP-N-acetylglucosamine pyrophosphorylase [Stappia aggregata IAM
           12614]
 gi|118437414|gb|EAV44051.1| UDP-N-acetylglucosamine pyrophosphorylase [Stappia aggregata IAM
           12614]
          Length = 451

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 199/439 (45%), Positives = 289/439 (65%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L+IVLAAG G RMKS+  KV+ +I G P++ HV++ +  AG E +++V G    E+ 
Sbjct: 4   RSCLSIVLAAGLGTRMKSNLPKVMHEIGGLPLVGHVVKALKQAGSERISVVTGPDMPELE 63

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
            +          ++Q  + GTAHA L A+ A+    DDV+I++GD PLV+S T+ K    
Sbjct: 64  TLVRVLAPEATCHVQHERLGTAHAALAARFALNTTSDDVLILFGDTPLVTSETIGKVRHA 123

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +A+G  +AV+GF A +P GYGRL+ +N  +IAIREE DA+D+ERKI +CNSG+M   G +
Sbjct: 124 LAEGADVAVLGFEARHPFGYGRLVTENGWLIAIREEKDASDDERKITFCNSGIMGFSGKH 183

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +  L  I       E+YLTD +E A + G  + ++   E E  G N R +L+  E  +Q
Sbjct: 184 ALSLLDAIGNANAKSEFYLTDAVEIANIRGLKVVAVSASEVETQGINTRAQLAACEADFQ 243

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
            R R+  + +G TM+AP TVF SHDT+++ D VIE +V FG GV +    +IRAFS+LEG
Sbjct: 244 DRMRQAALENGCTMLAPHTVFFSHDTVLEADCVIEQNVVFGPGVKVAAGARIRAFSHLEG 303

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             +G+ +++GP+AR+R    +  + R+GNF EVK AT  +G+K NHLSY+GD+ VG   N
Sbjct: 304 ASVGENSVVGPYARLRPGAVLGADTRVGNFVEVKNATFGDGAKANHLSYIGDASVGSKSN 363

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG  K++T I   +F+GSNS+L+AP+T+G GT+VA+GS+IT +   +S+ 
Sbjct: 364 IGAGTITCNYDGYLKHRTDIGAGSFVGSNSTLVAPVTLGDGTFVAAGSVITDNVGPDSMA 423

Query: 423 FARSRQIVKEDGALSMRKK 441
           F R+RQ VKE  A  +R++
Sbjct: 424 FGRARQTVKEGRAKELRER 442


>gi|218532413|ref|YP_002423229.1| UDP-N-acetylglucosamine pyrophosphorylase [Methylobacterium
           chloromethanicum CM4]
 gi|218524716|gb|ACK85301.1| UDP-N-acetylglucosamine pyrophosphorylase [Methylobacterium
           chloromethanicum CM4]
          Length = 461

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 197/436 (45%), Positives = 280/436 (64%), Gaps = 5/436 (1%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRI-- 64
           AIVLAAG+G RM+S   KVL  +A + M+ HV+  +  AG   +A+V+  G E++ R   
Sbjct: 15  AIVLAAGKGTRMRSDQPKVLHALANRSMLGHVLAAVQEAGAARLAVVVEPGREDVVREIE 74

Query: 65  NFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIA 124
              P  SV  Y Q  + GTAHAVL A+ +++ G  DVI+ +GD PLV++ T  +    + 
Sbjct: 75  RLAPGASV--YPQAERLGTAHAVLAARASLEGG-QDVIVAFGDTPLVTAETYARLRAPLR 131

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
           +G ++AV+ F A +P GYGR+L +   ++AIREE DA+ EER +   N+GLMA+ G + +
Sbjct: 132 EGAAVAVLAFEAADPTGYGRVLTEGGRVLAIREEKDASQEERAVRLSNAGLMALSGAHAL 191

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSR 244
             L +I  +  ++EYYLTD +  A  DG S+A + V E E  G N+R +LS  E   Q+R
Sbjct: 192 SLLERIGNDNANREYYLTDAVALAAADGLSVAVVPVDEAEAQGVNDRVQLSQAEATIQAR 251

Query: 245 YRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVH 304
            RR   + G T+IAPETVF S DTI+  D V+EPH  FG GV I +   IRAFS+L    
Sbjct: 252 LRRAAQLGGATLIAPETVFFSVDTILGRDVVVEPHCVFGPGVVIGDGCTIRAFSHLHDAR 311

Query: 305 IGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIG 364
           + +   IGP  R+R    +E  V +GNF E+K AT+  G+K +HL+Y+GD+ +G   NIG
Sbjct: 312 LMEGADIGPHVRLRGGAVLEAGVHLGNFVEIKNATLHAGAKASHLAYLGDAEIGAGANIG 371

Query: 365 AGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFA 424
           AGTITCNYDG  K++T I E AFIGSNS+L+AP+++G G  V +GS+IT+D P ++L  A
Sbjct: 372 AGTITCNYDGVSKHRTLIGEGAFIGSNSALVAPVSVGAGALVGAGSVITRDVPADALAVA 431

Query: 425 RSRQIVKEDGALSMRK 440
           R RQI +E  A ++R+
Sbjct: 432 RGRQITREGAAKTLRQ 447


>gi|85716463|ref|ZP_01047434.1| UDP-N-acetylglucosamine pyrophosphorylase [Nitrobacter sp. Nb-311A]
 gi|85696652|gb|EAQ34539.1| UDP-N-acetylglucosamine pyrophosphorylase [Nitrobacter sp. Nb-311A]
          Length = 452

 Score =  401 bits (1031), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/440 (45%), Positives = 281/440 (63%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L IVLAAG G RM+SS  KVL  + G+ ++SHV+    +     +A+V+G G E + 
Sbjct: 4   RSCLTIVLAAGEGTRMRSSLPKVLHSVGGRTLLSHVLAAAPSGPGTLLAVVVGPGQEAVA 63

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                    V  ++QD + GTAHAVL A+ AI  G DD++I +GD PL+S+ TL +    
Sbjct: 64  DEARRVRPEVMAFVQDERLGTAHAVLAAKKAISHGADDLLIAFGDTPLISADTLTRMRAP 123

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +  G ++AV+GF+AD+P GYGRL++ +  + AIRE+ DA  +ER+I  CN+G+MA DG  
Sbjct: 124 LQAGAALAVLGFHADDPAGYGRLIVTDGRLTAIREDADANPDERRITLCNAGVMAFDGRT 183

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +  + +I       EYYLTD +      G + A I+  E EV G N + +L+  E + Q
Sbjct: 184 ALQIIEKIGNANSKGEYYLTDAVGVVGELGLTAAVIETSEDEVRGINTKAQLAEAEQVMQ 243

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
            R R+  + +GVTM+APETVFLS DT    D  IEPHV  G GV+I +   I AFS+L  
Sbjct: 244 IRLRKAALEAGVTMVAPETVFLSADTSFGKDVTIEPHVVIGQGVTIADGAVIHAFSHLVQ 303

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             IG+   +GP+AR+R  T++    RIGNF E K A ++ G+K+NHL+Y+GD+ VG N N
Sbjct: 304 ASIGRNASVGPYARLRPGTSVGDGARIGNFVETKAAVLEAGAKVNHLTYIGDAHVGANAN 363

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG +K++T I E AF+GSNSSL+AP+ IG G YV SGS++T++ P+++L 
Sbjct: 364 IGAGTITCNYDGFNKHRTEIGEGAFVGSNSSLVAPLRIGAGAYVGSGSVVTKNVPDDALA 423

Query: 423 FARSRQIVKEDGALSMRKKK 442
             R +Q ++E  A   R+ K
Sbjct: 424 VGRGQQTLREGWAKRFREMK 443


>gi|312113569|ref|YP_004011165.1| UDP-N-acetylglucosamine pyrophosphorylase [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311218698|gb|ADP70066.1| UDP-N-acetylglucosamine pyrophosphorylase [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 447

 Score =  401 bits (1031), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 201/436 (46%), Positives = 286/436 (65%), Gaps = 3/436 (0%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A+VLAAG+G RMKS+  KVL  + G P+++HV++  A AG E  ++++   A+    +  
Sbjct: 6   AVVLAAGQGTRMKSALPKVLHPVGGLPLVAHVIKAAADAGAEACSVIVPPDAKGFDALRL 65

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQG 126
           P  ++  ++ Q  + GTAHAVL A+ A++     V+++ GD PLV+  +L +    IA G
Sbjct: 66  P--IAARFFEQHERLGTAHAVLQARPALETSSLPVVVLCGDTPLVTPDSLARLAAVIANG 123

Query: 127 YSIAVVGFNADNPKGYGRLLI-KNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMD 185
             +AV+GFNA NPKGYGRL+   +  ++AIRE+ DA++ ER I  CNSG++A  G  I+ 
Sbjct: 124 ADMAVMGFNARNPKGYGRLITDASGALVAIREDKDASEAERAITLCNSGILAFRGDLILS 183

Query: 186 WLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRY 245
            L +I  +   +E+YLTD +E AR  G  +A   + E EV G N R +L+  E I+Q R 
Sbjct: 184 LLDRIGNDNAQREFYLTDAVEVARARGLHVACEIIDEDEVRGVNTRAQLAEAEAIFQRRA 243

Query: 246 RRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHI 305
           R   M  G T+IAP+TV  +HDTII  D VIEP+V F  GV IE+ V IR FS+LEG  +
Sbjct: 244 REAAMAGGTTLIAPDTVTFAHDTIIGQDVVIEPNVIFAAGVVIEDGVTIRGFSHLEGARV 303

Query: 306 GKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGA 365
           G+ + IGPFAR R  T +E    +GNF E+K + + EG+K+NHLSY+GD+ +G   NIGA
Sbjct: 304 GRGSTIGPFARFRPGTVLEAGAHVGNFVELKASHVGEGAKVNHLSYIGDANIGAKTNIGA 363

Query: 366 GTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFAR 425
           GTITCNYDG  K+KT+I   AFIGSNSSL+AP+TIG G Y+ SGS+I++D P ++L   R
Sbjct: 364 GTITCNYDGYSKFKTNIGAGAFIGSNSSLVAPVTIGDGAYIGSGSVISEDVPPHALALTR 423

Query: 426 SRQIVKEDGALSMRKK 441
           + Q+ K++ A   R +
Sbjct: 424 APQVHKDEWAKKKRAR 439


>gi|92117329|ref|YP_577058.1| nucleotidyl transferase [Nitrobacter hamburgensis X14]
 gi|119370583|sp|Q1QME9|GLMU_NITHX RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|91800223|gb|ABE62598.1| UDP-N-acetylglucosamine pyrophosphorylase [Nitrobacter hamburgensis
           X14]
          Length = 452

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 195/440 (44%), Positives = 283/440 (64%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L IVLAAG G RM+SS  KVL  +AG+ +++HV+    +    ++A V+G G E + 
Sbjct: 4   RSCLTIVLAAGEGTRMRSSLPKVLHPVAGQTLLAHVLTAAPSGPGTSLAAVVGPGHEAVA 63

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                    V  ++Q  + GTAHAVL A++AI  G DD++I +GD PL+S+ TL +    
Sbjct: 64  DEARHVRPDVMTFVQHERLGTAHAVLAAREAIARGADDLVIAFGDTPLISADTLARMRAP 123

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +  G S+ V+GF+A +P GYGRL++ N  + AIRE+ DA+ +ER I  CN+G+MA DG  
Sbjct: 124 LQAGASLVVLGFHAADPTGYGRLIVDNGRLTAIREQADASADERSITLCNAGVMAFDGKT 183

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +  + +I       EYYLTD +   R  G + A I+  E EV G N + +L+  E + Q
Sbjct: 184 ALQIIEKIGNANSKGEYYLTDAVSIVRESGLTAAVIETSEDEVRGINTKAQLAEAEQVMQ 243

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
           +R R++ + +GVTM+AP+TVFL+ DT    D  IEP+V  G GV+I +   I +FS+L  
Sbjct: 244 ARLRKEALDAGVTMVAPDTVFLAADTSFGKDVTIEPYVVIGPGVTIADGAVIHSFSHLVQ 303

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             IG+   +GP+AR+R  T++ +  R+GNF E K A ++ G+K+NHL+YVGD+ +G N N
Sbjct: 304 ASIGRNASVGPYARLRPGTSLGEGARVGNFVETKAAVLEAGAKVNHLTYVGDAHIGANAN 363

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG  KY+T I E AF+GSNSSL+AP+ IG G YV SGS++T++ P+++L 
Sbjct: 364 IGAGTITCNYDGFGKYRTEIGEGAFVGSNSSLVAPVKIGAGAYVGSGSVVTRNVPDDALA 423

Query: 423 FARSRQIVKEDGALSMRKKK 442
             R +Q V+E  A   R+ K
Sbjct: 424 VGRGQQTVREGWARRFREMK 443


>gi|323137920|ref|ZP_08072995.1| UDP-N-acetylglucosamine pyrophosphorylase [Methylocystis sp. ATCC
           49242]
 gi|322396923|gb|EFX99449.1| UDP-N-acetylglucosamine pyrophosphorylase [Methylocystis sp. ATCC
           49242]
          Length = 455

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 208/430 (48%), Positives = 289/430 (67%), Gaps = 1/430 (0%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           RK LAIVLAAG G RMKS   KVL ++AG+ M++HV+  +  A + NVA+V+G G +++ 
Sbjct: 8   RKALAIVLAAGEGTRMKSDIPKVLHEVAGRSMLAHVLAAVGGAQVGNVAVVVGPGRDDVR 67

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                     + ++Q  + GTAHAVL A+ AI  G DD+++++GD PLV+  T+      
Sbjct: 68  AEAERLVPGAQTFVQAERLGTAHAVLAARAAIAGGCDDLLVLFGDTPLVTRETIIALRAA 127

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKN-NEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
           +A G  +AV+GF A +P GYGRL+  +   ++AIRE+ DA+D ER I  CN+GLMAIDG 
Sbjct: 128 LAAGAGVAVLGFEAADPFGYGRLIRDDAGRLMAIREQKDASDAERAISLCNAGLMAIDGA 187

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIW 241
             + +L +I  +  + EYYLTD++E AR +G+    +   E EV G N+R +L+  E I 
Sbjct: 188 CALGFLEKIGNSNANGEYYLTDVVELARAEGREARIVVADESEVLGVNDRIQLARAEAIA 247

Query: 242 QSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLE 301
           Q+R RR  M +G TMIAPETVFLS DT    D +IEP+V  G GV I +   I +FS+LE
Sbjct: 248 QTRLRRAAMAAGATMIAPETVFLSADTRFGRDVLIEPNVVIGPGVEIADRAVIHSFSHLE 307

Query: 302 GVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNV 361
           G  +G    IGPFAR+R  T + +N ++GNF E+K AT+  G+K+NHL+Y+GD+ +G N 
Sbjct: 308 GAKVGPGATIGPFARLRPGTALAENAKVGNFVEIKNATVARGAKVNHLTYIGDADIGANA 367

Query: 362 NIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSL 421
           NIGAGTITCNYDG  KY+T I ENAFIGSNS+L+AP+ +G G YV SGS++T+D   ++L
Sbjct: 368 NIGAGTITCNYDGFFKYRTQIGENAFIGSNSALVAPVKVGAGAYVGSGSVVTKDVSADAL 427

Query: 422 VFARSRQIVK 431
             AR RQ+ K
Sbjct: 428 AVARGRQMEK 437


>gi|154248339|ref|YP_001419297.1| nucleotidyl transferase [Xanthobacter autotrophicus Py2]
 gi|254798823|sp|A7INP6|GLMU_XANP2 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|154162424|gb|ABS69640.1| Nucleotidyl transferase [Xanthobacter autotrophicus Py2]
          Length = 448

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 206/440 (46%), Positives = 281/440 (63%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L +VLAAG G RM S   KVL K+AG+ M+ HV+    AAG    A+V+G G E++ 
Sbjct: 4   RSLLVVVLAAGEGTRMASRLPKVLHKVAGRTMLHHVLAATRAAGATRTAVVVGPGREDVA 63

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                     E + Q  + GTAHAVL A+ A++ G DDV+++Y D PLV   TL      
Sbjct: 64  AEVRKIVPDAEVFEQTERLGTAHAVLAARAALENGADDVLVLYADTPLVRPETLGLLRAP 123

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +  G ++A +GF   +P GYGRL+   +E++AIREE DA+  E+ I +CN+GLMA+ G +
Sbjct: 124 LKAGAAVAALGFEPADPTGYGRLVTAGDELVAIREEKDASAAEKAIRFCNAGLMALAGAH 183

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +  L +I       EYYLTD +E AR DG S  +      EV G N+R +L+  E I Q
Sbjct: 184 ALSILERIGNANAKGEYYLTDAVEIARADGLSAVAARADADEVAGVNSRVQLAEAEAILQ 243

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
            R R   M  G T++APETVFLS DT++  D ++EPHV FG GVS+ + V I +F +LEG
Sbjct: 244 RRLRLAAMAGGATLVAPETVFLSADTVLGRDVIVEPHVVFGPGVSVGDDVVIHSFCHLEG 303

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             +     IGP+AR+R  T ++  VRIGNF E K A I+ G+K+NHLSYVGD+ VG + N
Sbjct: 304 ARLESGVTIGPYARLRPGTQLDSGVRIGNFVETKAAHIESGAKVNHLSYVGDAHVGADAN 363

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           +GAGTITCNYDG  KY+T I   AFIG NS+L+AP+T+G+G +V +G++IT D PE++L 
Sbjct: 364 LGAGTITCNYDGFGKYRTEIGAGAFIGVNSALVAPVTVGKGAFVGTGAVITSDVPEDALA 423

Query: 423 FARSRQIVKEDGALSMRKKK 442
            ARSRQ+VKE  A + R  +
Sbjct: 424 IARSRQVVKEGWAKAFRAAR 443


>gi|170748837|ref|YP_001755097.1| UDP-N-acetylglucosamine pyrophosphorylase [Methylobacterium
           radiotolerans JCM 2831]
 gi|170655359|gb|ACB24414.1| UDP-N-acetylglucosamine pyrophosphorylase [Methylobacterium
           radiotolerans JCM 2831]
          Length = 458

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 188/429 (43%), Positives = 269/429 (62%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R   AIVLAAG+G RM+S   KVL +IAG+ M+ HV+  + AAG   +A+V   G +++ 
Sbjct: 9   RSLTAIVLAAGKGTRMRSDLPKVLHRIAGRSMLGHVLAAVQAAGAGRIAVVAEPGRDDVA 68

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                       + Q  + GTAHAVL A++ +    DDV+I +GD PLVS+ T  +    
Sbjct: 69  AEIARAAPGARVFPQAERLGTAHAVLAAREILADPDDDVVIAFGDTPLVSADTFLRLRAP 128

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +A G ++AV+ F    P GYGR+L + + ++AIREE DA+  ER +  CN+GLMA+ G +
Sbjct: 129 LADGAAVAVLAFETATPAGYGRVLTEGDRVLAIREEKDASAAERAVTLCNAGLMALAGRH 188

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +  L +I  +  + EYYL D +  A  DG  +  + V E E  G N+R +LS+ E   Q
Sbjct: 189 ALALLARIGNDNAAGEYYLPDAVALAVADGLPVTVVPVDEAEAQGVNDRVQLSVAEAAIQ 248

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
           ++ RR  M+ G T+IAPETVFLSHDT++  D ++EPHV FG GV +     +RAF++L  
Sbjct: 249 AQLRRSAMLGGATLIAPETVFLSHDTVLGRDVIVEPHVVFGPGVRVAEGCTVRAFAHLTE 308

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             +     +GPF R+R    +E    +GNF E+K A +  G+K  HL+Y+GD+ +G   N
Sbjct: 309 TSLEAGVKVGPFVRLRGHAVLEAGAELGNFVELKNARMGAGAKAAHLTYLGDAEIGAKAN 368

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG  K++T I   AFIGSNS+L+AP+++G+G YVASGS+IT D P +++ 
Sbjct: 369 IGAGTITCNYDGVLKHRTTIGAGAFIGSNSALVAPVSVGEGAYVASGSVITDDVPADAMA 428

Query: 423 FARSRQIVK 431
            AR RQ VK
Sbjct: 429 VARGRQAVK 437


>gi|170743599|ref|YP_001772254.1| UDP-N-acetylglucosamine pyrophosphorylase [Methylobacterium sp.
           4-46]
 gi|168197873|gb|ACA19820.1| UDP-N-acetylglucosamine pyrophosphorylase [Methylobacterium sp.
           4-46]
          Length = 451

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 200/440 (45%), Positives = 278/440 (63%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L +VLAAG+G RM+S   KVL  +AG+PM++HV+  +  AG   +A+V   G  ++ 
Sbjct: 11  RSLLCVVLAAGKGTRMRSDLPKVLHPLAGRPMLAHVLAAVREAGATGLAVVAEPGRADVA 70

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                     E + Q  + GTAHAVL A+ A++ G+DDV++ +GD PL+   T  +    
Sbjct: 71  AAVAAAAPGAEVFPQAERLGTAHAVLAARAALEAGHDDVLVAFGDTPLIRPETYARLRAP 130

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +A+G ++AV+ F A +P GYGR+L + + ++AIREE DA+ EER++   N+GLMA+ G  
Sbjct: 131 LAEGAALAVLAFEAADPTGYGRVLTEGDRVVAIREEKDASPEERRVRLSNAGLMALSGRL 190

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +D L +I     + EYYL D +  A   G  +A + V+E E  G N+R +L+  E   Q
Sbjct: 191 ALDLLDRIGNANAAGEYYLPDAVALAVRAGGRVAVVPVEEAEAQGVNDRVQLAAAEATLQ 250

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
            R RR  M+ G T+IAPETVFLSHDT +  D V+EPHV FG GVS+ +   I AFS+LE 
Sbjct: 251 QRLRRAAMLGGATLIAPETVFLSHDTRLGRDVVVEPHVVFGPGVSVGDGCVIHAFSHLEQ 310

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             +    +IGP+AR+R    +    RIGNF EVK A I  G+K+NHLSYVGD+ VG   N
Sbjct: 311 AVLEPGVVIGPYARLRPGAVLATGARIGNFVEVKNAAIGAGAKVNHLSYVGDAEVGPRAN 370

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           +GAGTITCNYDG  K++T I   AF+GSNS+L+AP+ IG+G YV SGS+IT D P  +L 
Sbjct: 371 LGAGTITCNYDGLRKHRTVIGAGAFVGSNSALVAPVAIGEGAYVGSGSVITDDVPPEALA 430

Query: 423 FARSRQIVKEDGALSMRKKK 442
             R RQ+VK   A +  K +
Sbjct: 431 LGRGRQVVKPGWAKAKDKDR 450


>gi|254502672|ref|ZP_05114823.1| Nucleotidyl transferase family [Labrenzia alexandrii DFL-11]
 gi|222438743|gb|EEE45422.1| Nucleotidyl transferase family [Labrenzia alexandrii DFL-11]
          Length = 443

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 195/434 (44%), Positives = 281/434 (64%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           +VLAAG G RMKS   KV+  + G P++ HV++ +   G   +++V G G  E+  +   
Sbjct: 1   MVLAAGLGTRMKSDLPKVMHPVGGLPIVGHVLKVLGQTGSSRLSVVTGPGMPELEELVGD 60

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
                  ++Q  + GTAHA L A+ A++   DDV++++GD PLV++ T++K    +A G 
Sbjct: 61  LAPDARCFVQTDRLGTAHAALAAEKALENVTDDVLVLFGDTPLVTAATVEKVRGALAGGA 120

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            + V+GF  D P GYGRLL  +  ++AIREE DA+D ERKI +CNSG+M   G   +  L
Sbjct: 121 DVVVLGFETDTPFGYGRLLTDDGRLVAIREEKDASDSERKITFCNSGIMGFAGEKALGIL 180

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
             I  +    EYYLTD +E A   G  + ++   E E  G N R +L+  E  +Q+  R 
Sbjct: 181 QAIGNDNAKGEYYLTDAVEVANAKGLKVVAVAGTEAETQGINTRAQLAACEADFQASKRE 240

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
           Q + SGVT++APETVF +HDT+I+PD +IE +V FG GV++ +  QIR+FS+LEG  +G 
Sbjct: 241 QFLESGVTLLAPETVFFAHDTVIEPDVIIEQNVVFGTGVTVRSGAQIRSFSHLEGADVGN 300

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
             ++GP+AR+R  T + K+VR+GNF E K A   +G+K NHLSYVGD+ VG+  NIGAGT
Sbjct: 301 GAVVGPYARLRPGTVLGKDVRVGNFVEAKNAVFGDGAKANHLSYVGDARVGEASNIGAGT 360

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           ITCNYDG  K+ THI    F+GSNS+L+AP+T+G G +VA+GS+IT+D   +++ F RSR
Sbjct: 361 ITCNYDGFLKHHTHIGTGTFVGSNSTLVAPVTLGDGAFVAAGSVITRDVAGDAMAFGRSR 420

Query: 428 QIVKEDGALSMRKK 441
           Q  K+  A  +R K
Sbjct: 421 QQSKDGMAKVLRDK 434


>gi|299133938|ref|ZP_07027132.1| UDP-N-acetylglucosamine pyrophosphorylase [Afipia sp. 1NLS2]
 gi|298591774|gb|EFI51975.1| UDP-N-acetylglucosamine pyrophosphorylase [Afipia sp. 1NLS2]
          Length = 451

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 197/443 (44%), Positives = 287/443 (64%), Gaps = 6/443 (1%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLG---YGAE 59
           R  L +VLAAG G RM+S+  KVL ++AG+ ++++V+    A   + +A+V+G     A 
Sbjct: 4   RSSLTLVLAAGEGTRMRSTLPKVLHEVAGRSLLANVLLAAPAGKQDRLAVVVGPDHQAAS 63

Query: 60  EITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKA 119
           +  R   P     + ++Q  ++GTAHAVL A+ AI  G DD+++++GD PLV++ T  + 
Sbjct: 64  DEARKLRP---QAQVFVQSERKGTAHAVLAARTAIAEGADDLLVVFGDTPLVTAETFARL 120

Query: 120 MDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAID 179
              +A   ++AV+GF A +P GYGRLL++ ++++AIRE+ DA + ER++  CN+G+MA  
Sbjct: 121 RAALAGNVAMAVLGFRAKDPTGYGRLLVEGDQLVAIREQADANEAERRVDLCNAGMMAFA 180

Query: 180 GLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIEN 239
           G   +    +I       EYYLTD +  AR  G     I+  E EV G N + +L+  EN
Sbjct: 181 GKTALQIFDRIGNANSKGEYYLTDAVGIAREMGLRATVIETHEDEVRGINTKTQLAEAEN 240

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSY 299
           + Q R RR+ M +GVT++APETVFLS DT    D VIEP V  G GVSI +   I +FS+
Sbjct: 241 VMQQRLRREAMEAGVTLVAPETVFLSSDTTFGRDVVIEPFVVIGPGVSIADGAVIHSFSH 300

Query: 300 LEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGK 359
           +    IGKK  +GP+ARIR  T++ + VRIGNF E K A ++ G K+NHLSYVGD+ VG 
Sbjct: 301 VTQSSIGKKVSVGPYARIRPGTSLGEGVRIGNFVETKAAVLESGVKVNHLSYVGDAHVGT 360

Query: 360 NVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPEN 419
           N NIGAGTI CNYDG  K++T +   AF+GSNSSL+AP+ IG G+Y+ SGS+IT++ PE+
Sbjct: 361 NANIGAGTIMCNYDGFDKHRTEVGAGAFVGSNSSLVAPVKIGAGSYIGSGSVITREVPED 420

Query: 420 SLVFARSRQIVKEDGALSMRKKK 442
           +LV  R+ Q+ +   A   R++K
Sbjct: 421 ALVVERNEQVTRPGWAKRYRERK 443


>gi|328543947|ref|YP_004304056.1| UDP-N-acetylglucosamine pyrophosphorylase protein [polymorphum
           gilvum SL003B-26A1]
 gi|326413691|gb|ADZ70754.1| UDP-N-acetylglucosamine pyrophosphorylase protein [Polymorphum
           gilvum SL003B-26A1]
          Length = 451

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 191/439 (43%), Positives = 282/439 (64%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  LAI+LAAG G RM+S   KV+  I   PM+ HV++ +     + +A+V+G G E + 
Sbjct: 4   RSLLAIILAAGLGTRMRSDLPKVMHPIGNLPMLGHVLKALDDGSRKRIAVVVGPGMERLE 63

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
            +          ++Q  + GTAHAVL A+ A++   DDV++++GD PLV+   + +    
Sbjct: 64  ALVAALAPGATCHLQQERLGTAHAVLAARAALQDPADDVLVLFGDTPLVTPAAIARVRAA 123

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +A+G  +AV+GF+A  P+GYGRLL++   ++AIREE DA+D ER + +CNSG+M   G  
Sbjct: 124 LARGADMAVLGFHARAPQGYGRLLMEGERLVAIREEKDASDAERAVTFCNSGIMGFRGAI 183

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
             D +  I K     EYYLTD +E A     ++ +    E EV G N R +L+  E ++Q
Sbjct: 184 AEDLIGSIGKANAQGEYYLTDAVELANARRLAVVAETADEDEVQGINTRAQLAACEAVFQ 243

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
           +R RR  M +GVT+ APE VF SHDT+++ D  +EP+V FG GV +E   +IRAFS+LEG
Sbjct: 244 ARMRRAAMDAGVTLQAPEMVFFSHDTVLEADVFVEPNVVFGPGVHVEGGTRIRAFSHLEG 303

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
            H+G+   +GPFAR+R    +  +  IGNF E+K AT+ EG+K+NHL+Y+GD+ +G   N
Sbjct: 304 AHVGRDATVGPFARLRPGAELAADTHIGNFVEIKNATVAEGAKVNHLTYIGDADIGAKSN 363

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG  K++T I    F+GSN++L+AP+ +G G YVA+GS++T   P ++L 
Sbjct: 364 IGAGTITCNYDGYLKHRTTIGAGCFVGSNATLVAPVALGDGAYVAAGSVVTDAVPADALA 423

Query: 423 FARSRQIVKEDGALSMRKK 441
             R RQ VK   A ++R++
Sbjct: 424 IGRGRQEVKPGRARALRER 442


>gi|255264336|ref|ZP_05343678.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Thalassiobium sp. R2A62]
 gi|255106671|gb|EET49345.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Thalassiobium sp. R2A62]
          Length = 449

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 198/434 (45%), Positives = 279/434 (64%), Gaps = 1/434 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG G RM S   KVL ++AG P++ H M + AA   E+  +V G+GAE +  I   
Sbjct: 6   IILAAGMGTRMASDMPKVLHQVAGAPLLVHAMMSGAALSPEHTVIVTGHGAERVGPIATA 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
              + E  IQ+ + GTAHAV  A++A+     D I++YGD P +   TL+ AM +    +
Sbjct: 66  FDEAAEVVIQEDRLGTAHAVAQAKNALAGFSGDAIVLYGDTPFIRPETLE-AMIEARSDH 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
           ++ V+GF+A +P  YGRL+ K + +  I E  DAT+ ER I  CNSG++  D   + D +
Sbjct: 125 AVVVLGFDAADPARYGRLVTKGDTLERIVEFKDATEAERAITLCNSGVICADAETLFDLI 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
             +  +  S EYYLTDI+  AR  G S + +   E E  G N+R +L++ E  +Q+R R 
Sbjct: 185 DAVGNDNASGEYYLTDIVGLARDRGLSASVVRCDENETMGVNSRIDLAVAEAAFQTRART 244

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
           +++  GVTM APETVFLSHDT+I  DT+IEP+V FG GV++E+   +RAFS+LEG H+ +
Sbjct: 245 ELLTLGVTMTAPETVFLSHDTVIGRDTIIEPNVVFGPGVTVESETTLRAFSHLEGCHVSR 304

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
            +I+GP+AR+R  T + +N +IGNF E K A I EG+K+NHLSYVGD+ VG + NIGAGT
Sbjct: 305 GSIVGPYARLRPGTELAENTKIGNFVETKNAIIAEGAKVNHLSYVGDADVGAHANIGAGT 364

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           +TCNYDG  K+KT I   AFIGSN+ L+AP+T+G     ASGS+IT D  + +L   R +
Sbjct: 365 VTCNYDGVFKHKTTIGAGAFIGSNTMLVAPVTVGAEAMTASGSVITTDVEDGALAVGRGK 424

Query: 428 QIVKEDGALSMRKK 441
           Q  K   A  M +K
Sbjct: 425 QTNKSGLARKMFEK 438


>gi|316934182|ref|YP_004109164.1| UDP-N-acetylglucosamine pyrophosphorylase [Rhodopseudomonas
           palustris DX-1]
 gi|315601896|gb|ADU44431.1| UDP-N-acetylglucosamine pyrophosphorylase [Rhodopseudomonas
           palustris DX-1]
          Length = 452

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 199/444 (44%), Positives = 283/444 (63%), Gaps = 8/444 (1%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYG----A 58
           R  L IVLAAG G RM+SS  KVL  +AG+ +++HV+        + +A+V+G       
Sbjct: 4   RTSLTIVLAAGEGTRMRSSLPKVLNPVAGRSLLAHVLSAAPHGERDRLAVVIGPDHQAVG 63

Query: 59  EEITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKK 118
           +E  R+    T     +IQ  + GTAHAVL A++ +  G DDV++ +GD PL+S+ T  +
Sbjct: 64  DEAKRVRADAT----TFIQAQRLGTAHAVLAAREVLAEGADDVLVAFGDTPLISAETFTR 119

Query: 119 AMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAI 178
             + +  G S+ V+GF A +P GYGRL+++N E++AIRE+ DA+++E  I  CN+G+MAI
Sbjct: 120 LREPLRGGSSLVVLGFRAADPTGYGRLVVQNGELVAIREQADASEDELNITLCNAGVMAI 179

Query: 179 DGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIE 238
           DG   +D L +I       EYYLTD +   R  G + + I+  E EV G N + +L+  E
Sbjct: 180 DGKIALDVLGKIGNANAKGEYYLTDAVGIVRDLGLTASVIETGEDEVRGINTKAQLAEAE 239

Query: 239 NIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFS 298
            + Q+R R+  M +GVT+IAPETV+L+ DT+   D VIEP V  G GVSI +   I +FS
Sbjct: 240 TVMQTRLRQAAMAAGVTLIAPETVYLATDTMFGKDVVIEPFVVIGPGVSIGDGAVIHSFS 299

Query: 299 YLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVG 358
           +L    IG K  +GP+AR+R  T++    +IGNF E K A I  G+K+NHL+Y+GD+ +G
Sbjct: 300 HLADARIGAKAQVGPYARLRPGTSLGDGAKIGNFVETKAAQIDAGAKVNHLTYIGDAHIG 359

Query: 359 KNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPE 418
            + NIGAGTITCNYDG  K+KT I   AFIGSNSSL+AP+ IG G YV SGS+IT+D P+
Sbjct: 360 ASANIGAGTITCNYDGFDKHKTEIGAGAFIGSNSSLVAPVKIGAGAYVGSGSVITKDVPD 419

Query: 419 NSLVFARSRQIVKEDGALSMRKKK 442
           ++L   R+ Q +K+  A   R  K
Sbjct: 420 DALAVERNDQRLKDGWAKRFRDAK 443


>gi|240140972|ref|YP_002965452.1| putative glmU-like gene; bifunctional N-acetyl
           glucosamine-1-phosphate uridyltransferase (N-terminal);
           glucosamine-1-phosphate acetyl transferase (C-terminal)
           [Methylobacterium extorquens AM1]
 gi|240010949|gb|ACS42175.1| putative glmU-like gene; bifunctional: N-acetyl
           glucosamine-1-phosphate uridyltransferase (N-terminal);
           glucosamine-1-phosphate acetyl transferase (C-terminal)
           [Methylobacterium extorquens AM1]
          Length = 461

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 194/436 (44%), Positives = 279/436 (63%), Gaps = 5/436 (1%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRI-- 64
           AIVLAAG+G RM+S   KVL  +A + M+ HV+  +  AG   +A+V+  G E++ R   
Sbjct: 15  AIVLAAGKGTRMRSDRPKVLHALANRSMLGHVLAAVQEAGAARLAVVVEPGREDVVREIE 74

Query: 65  NFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIA 124
              P   +  + Q  + GTAHAVL A+ +++ G  DVI+ +GD PLV++ T  +    + 
Sbjct: 75  RLAPGAGI--HPQAERLGTAHAVLAARASLE-GGQDVIVAFGDTPLVTAETYARLRAPLR 131

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
           +G ++AV+ F A +P GYGR+L +   ++AIREE DA+ EER +   N+GLMA+ G + +
Sbjct: 132 EGAAVAVLAFEAADPTGYGRVLTEGGRVLAIREEKDASQEERAVRLSNAGLMALSGAHAL 191

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSR 244
             L +I  +  ++EYYLTD +  A  DG S+A + V E E  G N+R +LS  E   Q+R
Sbjct: 192 SLLERIGNDNANREYYLTDAVALAAGDGLSVAVVPVDEAEAQGVNDRVQLSQAEATIQAR 251

Query: 245 YRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVH 304
            RR   + G T+IAPETVF S DTI+  D V+EPH  FG GV I +   IRAFS+L    
Sbjct: 252 LRRAAQLGGATLIAPETVFFSVDTILGRDVVVEPHCVFGPGVVIGDGCTIRAFSHLHDAR 311

Query: 305 IGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIG 364
           + +   IGP  R+R    +E  V +GNF E+K AT+  G+K +HL+Y+GD+ +G   NIG
Sbjct: 312 LMEGADIGPHVRLRGGAVLEAGVHLGNFVEIKNATLHAGAKASHLTYLGDAEIGAGANIG 371

Query: 365 AGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFA 424
           AGTITCNYDG  K++T I E AFIGSNS+L+AP+++G G  V +GS+IT+D P ++L  A
Sbjct: 372 AGTITCNYDGVSKHRTLIGEGAFIGSNSALVAPVSVGAGALVGAGSVITRDVPADALAVA 431

Query: 425 RSRQIVKEDGALSMRK 440
           R RQI +E  A ++R+
Sbjct: 432 RGRQITREGAAKTLRQ 447


>gi|254563483|ref|YP_003070578.1| bifunctional N-acetyl glucosamine-1-phosphate uridyltransferase/
           glucosamine-1-phosphate acetyl transferase
           [Methylobacterium extorquens DM4]
 gi|254270761|emb|CAX26766.1| putative glmU-like gene; bifunctional: N-acetyl
           glucosamine-1-phosphate uridyltransferase (N-terminal);
           glucosamine-1-phosphate acetyl transferase (C-terminal)
           [Methylobacterium extorquens DM4]
          Length = 461

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 194/436 (44%), Positives = 279/436 (63%), Gaps = 5/436 (1%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRI-- 64
           AIVLAAG+G RM+S   KVL  +A + M+ HV+  +  AG   +A+V+  G E++ R   
Sbjct: 15  AIVLAAGKGTRMRSDRPKVLHALANRSMLGHVLAAVQEAGAARLAVVVEPGREDVVREIE 74

Query: 65  NFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIA 124
              P   +  + Q  + GTAHAVL A+ +++ G  DVI+ +GD PLV++ T  +    + 
Sbjct: 75  RLAPGAGI--HPQAERLGTAHAVLAARASLEDG-QDVIVAFGDTPLVTAETYARLRAPLR 131

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
           +G ++AV+ F A +P GYGR+L +   ++AIREE DA+ EER +   N+GLMA+ G + +
Sbjct: 132 EGAAVAVLAFEAADPTGYGRVLTEGGRVLAIREEKDASQEERVVRLSNAGLMALSGAHAL 191

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSR 244
             L +I  +  ++EYYLTD +  A  DG S+A + V E E  G N+R +LS  E   Q+R
Sbjct: 192 SLLERIGNDNANREYYLTDAVALAAGDGLSVAVVPVDEAEAQGVNDRVQLSQAEATIQAR 251

Query: 245 YRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVH 304
            RR   + G T+IAPETVF S DTI+  D V+EPH  FG GV I +   IRAFS+L    
Sbjct: 252 LRRAAQLGGATLIAPETVFFSVDTILGRDVVVEPHCVFGPGVVIGDGCTIRAFSHLHDAR 311

Query: 305 IGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIG 364
           + +   IGP  R+R    +E  V +GNF E+K AT+  G+K +HL+Y+GD+ +G   NIG
Sbjct: 312 LMEGADIGPHVRLRGGAVLEAGVHLGNFVEIKNATLHAGAKASHLTYLGDAEIGAGANIG 371

Query: 365 AGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFA 424
           AGTITCNYDG  K++T I E AFIGSNS+L+AP+++G G  V +GS+IT+D P ++L  A
Sbjct: 372 AGTITCNYDGVSKHRTLIGEGAFIGSNSALVAPVSVGAGALVGAGSVITRDVPADALAVA 431

Query: 425 RSRQIVKEDGALSMRK 440
           R RQI +E  A ++R+
Sbjct: 432 RGRQITREGAAKTLRQ 447


>gi|163853553|ref|YP_001641596.1| UDP-N-acetylglucosamine pyrophosphorylase [Methylobacterium
           extorquens PA1]
 gi|163665158|gb|ABY32525.1| UDP-N-acetylglucosamine pyrophosphorylase [Methylobacterium
           extorquens PA1]
          Length = 461

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 193/436 (44%), Positives = 279/436 (63%), Gaps = 5/436 (1%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRI-- 64
           AIVLAAG+G RM+S   KVL  +A + M+ HV+  +  AG   +A+V+  G E++ R   
Sbjct: 15  AIVLAAGKGTRMRSDRPKVLHALANRSMLGHVLAAVQEAGAARLAVVVEPGREDVVREIE 74

Query: 65  NFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIA 124
              P   +  + Q  + GTAHAVL A+ +++ G  DV++ +GD PLV++ T  +    + 
Sbjct: 75  RLAPGAGI--HPQAERLGTAHAVLAARASLEDG-QDVLVAFGDTPLVTAETYARLRAPLR 131

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
           +G ++AV+ F A +P GYGR+L +   ++AIREE DA+ EER +   N+GLMA+ G + +
Sbjct: 132 EGAAVAVLAFEAADPTGYGRVLTEGGRVLAIREEKDASQEERVVRLSNAGLMALSGAHAL 191

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSR 244
             L +I  +  ++EYYLTD +  A  DG S+A + V E E  G N+R +LS  E   Q+R
Sbjct: 192 SLLERIGNDNANREYYLTDAVALAAGDGLSVAVVPVDEAEAQGVNDRVQLSQAEATIQAR 251

Query: 245 YRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVH 304
            RR   + G T+IAPETVF S DTI+  D V+EPH  FG GV I +   IRAFS+L    
Sbjct: 252 LRRAAQLGGATLIAPETVFFSVDTILGRDVVVEPHCVFGPGVVIGDGCTIRAFSHLHDAR 311

Query: 305 IGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIG 364
           + +   IGP  R+R    +E  V +GNF E+K AT+  G+K +HL+Y+GD+ +G   NIG
Sbjct: 312 LMEGADIGPHVRLRGGAVLEAGVHLGNFVEIKNATLHAGAKASHLTYLGDAEIGAGANIG 371

Query: 365 AGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFA 424
           AGTITCNYDG  K++T I E AFIGSNS+L+AP+++G G  V +GS+IT+D P ++L  A
Sbjct: 372 AGTITCNYDGVSKHRTLIGEGAFIGSNSALVAPVSVGAGALVGAGSVITRDVPADALAVA 431

Query: 425 RSRQIVKEDGALSMRK 440
           R RQI +E  A ++R+
Sbjct: 432 RGRQITREGAAKTLRQ 447


>gi|115524791|ref|YP_781702.1| nucleotidyl transferase [Rhodopseudomonas palustris BisA53]
 gi|122296013|sp|Q07MW2|GLMU_RHOP5 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|115518738|gb|ABJ06722.1| UDP-N-acetylglucosamine pyrophosphorylase / glucosamine-1-phosphate
           N-acetyltransferase [Rhodopseudomonas palustris BisA53]
          Length = 452

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 203/444 (45%), Positives = 283/444 (63%), Gaps = 8/444 (1%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYG----A 58
           R  L IVLAAG G RM+SS  KVL ++AG+ +++HV++         +A+V+G      A
Sbjct: 4   RTSLTIVLAAGEGTRMRSSLPKVLHQVAGETLLAHVLKAAPEGDGAALAVVIGPDHQAVA 63

Query: 59  EEITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKK 118
           EE+ R+    T     Y+Q  + GTAHAVL A++AI  G DD+++ +GD PL+S+ T  +
Sbjct: 64  EEVGRVRPQAT----TYVQRERLGTAHAVLAAREAIAAGADDLLVAFGDTPLISAATFAR 119

Query: 119 AMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAI 178
               +AQG ++  +GF   +P GYGRLL++N+ ++ IRE+ DA+ +ER I  CN+G+MAI
Sbjct: 120 LRQPLAQGVALVALGFRPADPTGYGRLLVQNDRLVGIREQADASADERAIGLCNAGVMAI 179

Query: 179 DGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIE 238
           DG   +  L +I       EYYLTD +  AR  G   A I+  E EV G N + +L+  E
Sbjct: 180 DGKAALRILERIGSANAKGEYYLTDAVAIARELGLEAAVIETSEDEVRGINTKAQLAEAE 239

Query: 239 NIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFS 298
            + Q+R R+  + +GVTMIAPETVFL+ DT    D  IEP V  G GVSI +   I AFS
Sbjct: 240 AVMQARLRQAALDAGVTMIAPETVFLAADTTFGKDVTIEPFVVIGAGVSIGDGAVIHAFS 299

Query: 299 YLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVG 358
           +L    IGK   +GP+AR+R  T++    +IGNF E K A I  G+K+NHL+Y+GD+ +G
Sbjct: 300 HLVQAKIGKNASVGPYARLRPGTSLGDGAKIGNFVETKAAQIDPGAKVNHLTYIGDAHIG 359

Query: 359 KNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPE 418
            N NIGAGTITCNYDG  K+KT I   AF+GSNSSL+AP+ IG G YV SGS++T+D P+
Sbjct: 360 PNANIGAGTITCNYDGFGKHKTEIGAGAFVGSNSSLVAPLKIGAGAYVGSGSVVTRDVPD 419

Query: 419 NSLVFARSRQIVKEDGALSMRKKK 442
           ++L   R++Q V E  A   R+ K
Sbjct: 420 DALAVERNQQKVSEGWAKRFREAK 443


>gi|75675976|ref|YP_318397.1| UDP-N-acetylglucosamine pyrophosphorylase [Nitrobacter winogradskyi
           Nb-255]
 gi|94716191|sp|Q3SRP6|GLMU_NITWN RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|74420846|gb|ABA05045.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase [Nitrobacter
           winogradskyi Nb-255]
          Length = 452

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 194/444 (43%), Positives = 285/444 (64%), Gaps = 8/444 (1%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYG----A 58
           R  L IVLAAG G RM+SS  KVL  + G+ ++SHV+         ++ +V+G G    A
Sbjct: 4   RNCLTIVLAAGEGTRMRSSLPKVLHPVGGQTLLSHVLAAAPGGPGTSLTVVIGPGHQAVA 63

Query: 59  EEITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKK 118
           +E  R+  P  ++   ++QD + GTAHAVL A++AI  G DD++I +GD PL+S+ T  +
Sbjct: 64  DEAKRVR-PDVMT---FVQDERLGTAHAVLAAKEAIIRGADDLLIAFGDTPLISADTFAR 119

Query: 119 AMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAI 178
               +  G S+AV+GF+A +P GYGRL++ +  + AIRE+ DA+ EER++  CN+G+MA 
Sbjct: 120 MRAPLRAGASLAVLGFHARDPAGYGRLIVTDGRLTAIREDADASPEERRMTLCNAGVMAF 179

Query: 179 DGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIE 238
           DG   +  + +I       EYYLTD +      G + A I+  E EV G N + +L+  E
Sbjct: 180 DGRTALRIIEKIGNANSKGEYYLTDAVGLVAELGLTAAVIETGEDEVRGINTKAQLAEAE 239

Query: 239 NIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFS 298
            + Q+R R+  + +GVTM+APETVFLS DT    D  IEP+V  G GV+I +   + AFS
Sbjct: 240 QVMQARLRKAALDAGVTMVAPETVFLSADTSFGRDVTIEPYVIIGQGVTIADGAVVHAFS 299

Query: 299 YLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVG 358
           +L    IG+   +GP+AR+R  T++    RIGNF E K A ++ G+K+NHL+Y+GD+ VG
Sbjct: 300 HLVQASIGRNASVGPYARLRPGTSVGDGARIGNFVETKAAVLEAGAKVNHLTYIGDAHVG 359

Query: 359 KNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPE 418
              NIGAGTITCNYDG +K++T I E AF+GSNSSL+AP+ IG G Y+ SGS++T++ P+
Sbjct: 360 AKANIGAGTITCNYDGFNKHRTEIGEGAFVGSNSSLVAPLRIGAGAYIGSGSVVTKNVPD 419

Query: 419 NSLVFARSRQIVKEDGALSMRKKK 442
           ++L   R +Q ++E  A   R+ K
Sbjct: 420 DALAVGRGQQTLREGWAKRFREMK 443


>gi|39935725|ref|NP_948001.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Rhodopseudomonas palustris CGA009]
 gi|81562576|sp|Q6N6F8|GLMU_RHOPA RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|39649578|emb|CAE28100.1| UDP-N-acetylglucosamine pyrophosphorylase [Rhodopseudomonas
           palustris CGA009]
          Length = 452

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 199/444 (44%), Positives = 279/444 (62%), Gaps = 8/444 (1%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYG----A 58
           R  L IVLAAG G RM+SS  KVL  +AG+ +++HV+        + +A+V+G       
Sbjct: 4   RNSLTIVLAAGEGTRMRSSLPKVLNPVAGRSLLAHVLSAAPHGERDRLAVVIGPDHQAVG 63

Query: 59  EEITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKK 118
           +E  R+     +    +IQ  + GTAHAVL A++AI  G DD++I +GD PL+S+ T  +
Sbjct: 64  DEAKRVRSDAAI----HIQAQRLGTAHAVLAAREAIAQGADDLLIAFGDTPLISAETFAR 119

Query: 119 AMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAI 178
             + +  G S+ V+GF A +P GYGRL++++ ++ AIRE+ DA+ +E KI  CN+G+MAI
Sbjct: 120 LREPLHDGSSLVVLGFRAADPTGYGRLVVQDGKLTAIREQADASADELKITLCNAGVMAI 179

Query: 179 DGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIE 238
           DG   +D L +I       EYYLTD +   R  G + + I+  E EV G N + +L+  E
Sbjct: 180 DGKIALDVLDKIGNANAKGEYYLTDAVGIVRDLGLTASVIETSEDEVRGINTKAQLAEAE 239

Query: 239 NIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFS 298
            + Q+R R   M +GVT+IAPETV+L+ DT    D VIEP V  G GVSI +   I +FS
Sbjct: 240 TVMQTRLRLAAMAAGVTLIAPETVYLAADTTFGKDVVIEPFVVIGPGVSIADGAVIHSFS 299

Query: 299 YLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVG 358
           +L    IG K  +GP+AR+R  T++    +IGNF E K A I  G+K+NHL+Y+GD+ +G
Sbjct: 300 HLTEAKIGSKAQVGPYARLRPGTSLGDGAKIGNFVETKAAQIDAGAKVNHLTYIGDAHIG 359

Query: 359 KNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPE 418
            + NIGAGTITCNYDG  K+KT I   AFIGSNSSL+AP+ IG G YV SGS+IT+D P+
Sbjct: 360 ASANIGAGTITCNYDGFDKHKTEIGAGAFIGSNSSLVAPVKIGTGAYVGSGSVITKDVPD 419

Query: 419 NSLVFARSRQIVKEDGALSMRKKK 442
            +L   R+ Q  K+  A   R  K
Sbjct: 420 GALAVERNVQTAKDGWAKRFRDAK 443


>gi|254460944|ref|ZP_05074360.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Rhodobacterales bacterium HTCC2083]
 gi|206677533|gb|EDZ42020.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 451

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 191/424 (45%), Positives = 274/424 (64%), Gaps = 1/424 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RMKS   KVL  IAG PM+ H M++ A        +V G+GAE+++     
Sbjct: 6   IILAAGKGTRMKSDLPKVLHHIAGAPMLVHAMKSGATLDPAKTIIVAGHGAEQVSDAAKA 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
              + +  +Q  Q GTAHAV  A++ +     D +++YGD P ++  TL+  M      +
Sbjct: 66  FDETADVVLQTEQLGTAHAVAQAKEVLFDFDGDALVLYGDTPFINPKTLEH-MTAARSDH 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            + V+GF A +P  YGRL+++   +  I E  DA+DEER+I  CNSG++      + D +
Sbjct: 125 DVVVLGFEAADPGRYGRLIMEGEHLKKIVEFKDASDEERQITLCNSGVICAKSAILFDLI 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
             +  +  S EYYLTDI+E A+  G +  S+   E E  G N+R +L+  + I+QS+ R 
Sbjct: 185 AAVGNDNASGEYYLTDIVEIAQRKGLNATSVTCDESETLGVNSRVQLAEADAIFQSKARV 244

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
            +M +GVT+ AP+TV+LSHDT I PDT+IEP+V FG  V++EN   IRAFS+LEG H+ +
Sbjct: 245 ALMEAGVTLHAPDTVYLSHDTHIGPDTIIEPNVVFGASVTVENGANIRAFSHLEGCHVSR 304

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
              +GP+AR+R  T + +  R+GNF E+K A I EG+K+NHLSYVGD+ VG   NIGAGT
Sbjct: 305 GATVGPYARLRPGTELAEFTRVGNFVEIKNAVIDEGAKVNHLSYVGDAHVGARANIGAGT 364

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           ITCNYDG  K+ T I E++FIGSN+ L+AP+ IG     ASG+++TQD P+++L  ARS+
Sbjct: 365 ITCNYDGVMKHHTEIGEDSFIGSNTLLVAPVAIGANAMTASGTVVTQDVPDDALAIARSK 424

Query: 428 QIVK 431
           QI K
Sbjct: 425 QINK 428


>gi|296444556|ref|ZP_06886520.1| UDP-N-acetylglucosamine pyrophosphorylase [Methylosinus
           trichosporium OB3b]
 gi|296257824|gb|EFH04887.1| UDP-N-acetylglucosamine pyrophosphorylase [Methylosinus
           trichosporium OB3b]
          Length = 432

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 199/427 (46%), Positives = 277/427 (64%), Gaps = 3/427 (0%)

Query: 18  MKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFPPTLSVEYYIQ 77
           MKS   KVL ++AG+ M++HV+  + AA +E  A+V+G G E++             ++Q
Sbjct: 1   MKSRRPKVLHEVAGRSMLAHVLAAVGAAEVEAAAVVVGAGREDVAGEARRLCPGARSFVQ 60

Query: 78  DCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGYSIAVVGFNAD 137
           + Q GTAHAVL A++AI  GYDD+I+++ D PLVS  T+      +A+G  +AV+ F A 
Sbjct: 61  ERQLGTAHAVLAAREAIAEGYDDLIVLFADTPLVSPATIAALRRSLAEGAGVAVLAFEAA 120

Query: 138 NPKGYGRLLIKNNE--IIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWLLQIKKNKV 195
            P GYGR+L ++ E  + AIREE DA++EER++  CN+GLMAIDG   +  +  +  +  
Sbjct: 121 TPYGYGRIL-RDGEGGVRAIREEKDASEEERRVTLCNAGLMAIDGASALALMEGVGSDNA 179

Query: 196 SQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRRQMMISGVT 255
             E+YLTD++E+A   G     +   E+EV G N+R +L+  E I Q R RR  M+ G T
Sbjct: 180 QGEFYLTDVVERAVAAGLPTRVVLAAEEEVLGVNDRVQLARAEQIAQQRLRRAAMLGGAT 239

Query: 256 MIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGKKTIIGPFA 315
           +IAPETVFLS DT +  D  IEPHV  G GV+I +   I AFS+LEG  +G    IGP+A
Sbjct: 240 LIAPETVFLSFDTQLGRDVTIEPHVVIGPGVAIGDGATIHAFSHLEGASVGAGAQIGPYA 299

Query: 316 RIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGT 375
           R+R    +    +IGNF E+K A I EG+K+NHLSY+GD++VG + NIGAG ITCNYDG 
Sbjct: 300 RLRPGARLAAAAKIGNFVEIKAADIGEGAKVNHLSYIGDAIVGAHANIGAGVITCNYDGF 359

Query: 376 HKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSRQIVKEDGA 435
            KY+T I  NAF+GSNSSL+AP+ IG G YV SGS+IT+D   ++L  AR RQ+ K   A
Sbjct: 360 FKYRTTIGANAFVGSNSSLVAPVAIGDGAYVGSGSVITRDVGVDALAVARGRQMEKGGWA 419

Query: 436 LSMRKKK 442
            + R ++
Sbjct: 420 SAFRARQ 426


>gi|192291311|ref|YP_001991916.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Rhodopseudomonas palustris TIE-1]
 gi|254798790|sp|B3QIT8|GLMU_RHOPT RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|192285060|gb|ACF01441.1| UDP-N-acetylglucosamine pyrophosphorylase [Rhodopseudomonas
           palustris TIE-1]
          Length = 452

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 199/444 (44%), Positives = 279/444 (62%), Gaps = 8/444 (1%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYG----A 58
           R  L IVLAAG G RM+SS  KVL  +AG+ +++HV+        + +A+V+G       
Sbjct: 4   RNSLTIVLAAGEGTRMRSSLPKVLNPVAGRSLLAHVLSAAPHGERDRLAVVIGPDHRAVG 63

Query: 59  EEITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKK 118
           +E  R+     +    +IQ  + GTAHAVL A++AI  G DD++I +GD PL+S+ T  +
Sbjct: 64  DEAKRVRSDAAI----HIQAQRLGTAHAVLAAREAIAEGADDLLIAFGDTPLISAETFAR 119

Query: 119 AMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAI 178
             + +  G S+ V+GF A +P GYGRL++++ ++ AIRE+ DA+ +E KI  CN+G+MAI
Sbjct: 120 LREPLHDGSSLVVLGFRAADPTGYGRLVVQDGKLTAIREQADASADELKITLCNAGVMAI 179

Query: 179 DGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIE 238
           DG   +D L +I       EYYLTD +   R  G   + I+  E EV G N + +L+  E
Sbjct: 180 DGKIALDVLDKIGNANAKGEYYLTDAVGIVRDLGLIASVIETSEDEVRGINTKAQLAEAE 239

Query: 239 NIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFS 298
            + Q+R R   M +GVT+IAPETV+L+ DT    D VIEP V  G GVSI +   I +FS
Sbjct: 240 TVMQTRLRLAAMAAGVTLIAPETVYLAADTTFGKDVVIEPFVVIGPGVSIADGAVIHSFS 299

Query: 299 YLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVG 358
           +L    IG K  +GP+AR+R  T++    +IGNF E K A I  G+K+NHL+Y+GD+ +G
Sbjct: 300 HLAEAKIGSKAQVGPYARLRPGTSLGDGAKIGNFVETKAAQIDAGAKVNHLTYIGDAHIG 359

Query: 359 KNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPE 418
            + NIGAGTITCNYDG  K+KT I   AFIGSNSSL+AP+ IG G YV SGS+IT+D P+
Sbjct: 360 ASANIGAGTITCNYDGFDKHKTEIGAGAFIGSNSSLVAPVKIGTGAYVGSGSVITKDVPD 419

Query: 419 NSLVFARSRQIVKEDGALSMRKKK 442
           ++L   R+ Q  K+  A   R  K
Sbjct: 420 DALAVERNVQTAKDGWAKRFRDAK 443


>gi|148255550|ref|YP_001240135.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Bradyrhizobium sp. BTAi1]
 gi|146407723|gb|ABQ36229.1| UDP-N-acetylglucosamine pyrophosphorylase [Bradyrhizobium sp.
           BTAi1]
          Length = 430

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/427 (45%), Positives = 276/427 (64%), Gaps = 4/427 (0%)

Query: 18  MKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLG--YGAEEITRINFPPTLSVEYY 75
           M++S  KVL  +AG+ M++HV+    +     +A+VLG  + A E       P   V+ +
Sbjct: 1   MRASLPKVLHPVAGESMLAHVLAAAPSGDGARLAVVLGPEHAAVETEAKRLRP--DVDIF 58

Query: 76  IQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGYSIAVVGFN 135
           IQ  + GTAHAVL A++AI  G DD++I +GD PL+++ T  +   ++A+G ++AV+GF 
Sbjct: 59  IQRERLGTAHAVLAAREAIARGADDLLIAFGDTPLITAATFARLRAQLAEGAALAVLGFR 118

Query: 136 ADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWLLQIKKNKV 195
           A +P GYGRLL+  ++++AIRE+ DAT+ ER I  CN+G+MA+DG + +  L +I     
Sbjct: 119 AADPTGYGRLLMDGSKLVAIREQADATEAERAITLCNAGVMAMDGRHALAILDKIGNANS 178

Query: 196 SQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRRQMMISGVT 255
             EYYL D +  AR  G   A I+  E EV G N + +L+  E + Q+R R+  M +GVT
Sbjct: 179 KGEYYLVDAVAIARAQGLDAAVIETSEDEVRGINTKAQLAEAEAVMQNRLRQAAMDAGVT 238

Query: 256 MIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGKKTIIGPFA 315
           +IAPETV+L+ DT    D  IEP V  G GVSI +   I +FS+L    +G+ T++GPFA
Sbjct: 239 LIAPETVYLAADTKFGKDVTIEPFVVIGPGVSIGDGAVIHSFSHLVQSTLGRNTLLGPFA 298

Query: 316 RIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGT 375
           R+R  T++    +IGNF E K A ++ G K+NHLSY+GD+ VG + NIGAGTITCNYDG 
Sbjct: 299 RLRPGTSMGDGAKIGNFVEAKAAVLEAGVKVNHLSYIGDAHVGAHSNIGAGTITCNYDGF 358

Query: 376 HKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSRQIVKEDGA 435
           +K+KT I E AFIG+N+SL+API IG   Y+ SGS+IT+D PE++L   RS Q  +E  A
Sbjct: 359 NKHKTRIGEGAFIGTNTSLVAPINIGARAYIGSGSVITRDVPEDALALERSPQTTREGAA 418

Query: 436 LSMRKKK 442
              R  K
Sbjct: 419 ARFRSAK 425


>gi|126736660|ref|ZP_01752399.1| UDP-N-acetylglucosamine pyrophosphorylase [Roseobacter sp. CCS2]
 gi|126713775|gb|EBA10647.1| UDP-N-acetylglucosamine pyrophosphorylase [Roseobacter sp. CCS2]
          Length = 447

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/434 (44%), Positives = 271/434 (62%), Gaps = 1/434 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+L AG G RM S   KVL +IAG PM+ H M++ AA       +V G+GA  + +    
Sbjct: 6   IILGAGMGTRMNSDMPKVLHEIAGAPMLVHAMKSGAALDPARTVIVAGHGAALVEKAAKA 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               V   IQ  Q GTAHAV  A+DA+K    D +++YGD P +   TL  AM      +
Sbjct: 66  YEPDVAVAIQTEQLGTAHAVDQARDALKGFSGDALVLYGDTPFIRPETLA-AMTAARLTH 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I V+GF A +   YGRL++K++++  I E  DATD+ER +  CNSG++A D   + D +
Sbjct: 125 DIVVLGFEALDAGRYGRLIMKDDQLDRIVEFKDATDDERAVTLCNSGVIAADNATLFDLI 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
             +  +  S EYYLTDII  AR  G S   +   E E  G N+R ELS  E ++Q + R 
Sbjct: 185 SAVGNDNASGEYYLTDIIAIARARGMSATVVRCDESETLGINSRAELSKAEALFQMQART 244

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
                GVT+ APETVF +HDT++  DTV+EP+V FG GV++E+   IRAFS+LEG H+ +
Sbjct: 245 AAQADGVTLTAPETVFFAHDTVVGRDTVVEPNVVFGPGVTVESGATIRAFSHLEGCHVSR 304

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
             ++GP+AR+R    + +NV++GNF E+K A I +G+K+NHLSY+GD+ +G   NIGAGT
Sbjct: 305 GAVVGPYARLRPGAELAENVKVGNFVEIKNAQIADGAKVNHLSYIGDATIGARSNIGAGT 364

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           ITCNYDG  K+KT I E+ FIGSN+ L+AP+T+G      SGS++T+D P   L  AR++
Sbjct: 365 ITCNYDGVFKHKTTIGEDTFIGSNTMLVAPVTVGDAAMTGSGSVVTKDVPPGDLAVARAK 424

Query: 428 QIVKEDGALSMRKK 441
           Q  K   A+ + +K
Sbjct: 425 QENKAGFAVRLFEK 438


>gi|86749972|ref|YP_486468.1| nucleotidyl transferase [Rhodopseudomonas palustris HaA2]
 gi|109892117|sp|Q2IW53|GLMU_RHOP2 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|86573000|gb|ABD07557.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase
           [Rhodopseudomonas palustris HaA2]
          Length = 452

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 195/444 (43%), Positives = 280/444 (63%), Gaps = 8/444 (1%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYG----A 58
           R  L IVLAAG G RM+SS  KVL  +AG+P+++HV+        + +A+V+G      A
Sbjct: 4   RTSLTIVLAAGEGTRMRSSLPKVLHPVAGRPLLAHVLAAAPHGEGDKLAVVIGPDHQAVA 63

Query: 59  EEITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKK 118
           +E  RI        + Y+Q  + GTAHAVL A+ A+  G DD++I +GD PL+S+ T  +
Sbjct: 64  DEARRIR----PDAQIYVQTERLGTAHAVLAAKQAVAGGADDLLIAFGDTPLISAETFAR 119

Query: 119 AMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAI 178
             + +  G ++ V+GF A +P GYGRL+++++ + AIRE+ DA+ +E KI  CN+G+MAI
Sbjct: 120 LREPLRNGGALVVLGFRAVDPTGYGRLVVEDDRLAAIREQADASPDELKITLCNAGVMAI 179

Query: 179 DGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIE 238
           DG   +D L  I       EYYLTD +   R  G     I+  E EV G N + +L+  E
Sbjct: 180 DGRIALDVLGAIGNANKKGEYYLTDAVGIVRERGLVAGVIETDEDEVRGINTKAQLAEAE 239

Query: 239 NIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFS 298
            + Q+R R+  M +GVT+I+PET+ L+ DT    D  IEP V  G GVSI +   I +FS
Sbjct: 240 AVMQARLRQAAMAAGVTLISPETIHLAADTTFGRDVTIEPFVVIGPGVSIGDGAVIHSFS 299

Query: 299 YLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVG 358
           ++    +GK T IGP+AR+R  T++    +IGNF E K A I  G+K+NHL+Y+GD+ +G
Sbjct: 300 HIVDTSLGKNTSIGPYARLRPGTSLGDGAKIGNFVETKAAQIDAGAKVNHLTYIGDAHIG 359

Query: 359 KNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPE 418
              NIGAGTITCNYDG +K+KT I   AF+GSNSSL+AP+ IG G Y+ SGS+IT++ P+
Sbjct: 360 PGANIGAGTITCNYDGFNKHKTEIGAGAFVGSNSSLVAPVRIGAGAYIGSGSVITRNVPD 419

Query: 419 NSLVFARSRQIVKEDGALSMRKKK 442
           ++L   R+ Q V+E  A   R+ K
Sbjct: 420 DALAVERNDQSVREGWATRFREAK 443


>gi|126727128|ref|ZP_01742965.1| Glucosamine-1-phosphate N-acetyltransferase;
           UDP-N-acetylglucosamine pyrophosphorylase
           [Rhodobacterales bacterium HTCC2150]
 gi|126703556|gb|EBA02652.1| Glucosamine-1-phosphate N-acetyltransferase;
           UDP-N-acetylglucosamine pyrophosphorylase
           [Rhodobacterales bacterium HTCC2150]
          Length = 453

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 191/434 (44%), Positives = 275/434 (63%), Gaps = 1/434 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM S   KVL K+AG P+++H M + +  G +   +V G+G   + +    
Sbjct: 6   IILAAGKGSRMNSDLPKVLHKLAGVPLLAHAMNSASLGGAKKSVVVTGHGGAAVAKAALG 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
                    QD Q GTAHAVL A+DA+     D I++YGD P +S  TL++ M K    +
Sbjct: 66  IDAETLIANQDEQLGTAHAVLQAKDALGEMEGDCIVLYGDTPFISPETLEE-MSKARDSH 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            + V+GF  ++P  YGRL+   +++  I E  DA+ EE  +  CNSG++  +   + D L
Sbjct: 125 DVLVLGFETNDPGRYGRLITNGDKLDRIVEAKDASPEELAVTLCNSGVICANTSVLFDLL 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
            ++K +  + EYYLTDII  A   G S   +     E  G N R EL+  E  +Q++ R 
Sbjct: 185 SEVKDDNAANEYYLTDIIGIATSKGLSCGVVHCDIAETLGINTRAELAAAEADFQAKARI 244

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
             M +GV++ APETV+ ++DT+I  DT IEP+VFFG GV+IEN V+I+A  + EG HI +
Sbjct: 245 AAMENGVSLTAPETVYFAYDTVIGRDTTIEPNVFFGPGVTIENDVEIKANCHFEGCHISR 304

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
            +++GPFAR+R    + ++VR+GNF E+K A + EG+K+NHLSYVGD+ VGK  NIGAGT
Sbjct: 305 GSVVGPFARLRPGAELAEDVRVGNFVEIKNADLAEGAKVNHLSYVGDATVGKAANIGAGT 364

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           ITCNYDG  K++T I   AFIGSN+SL+AP++IG     ASGS+ITQ+ P  +L  +R++
Sbjct: 365 ITCNYDGVMKHRTEIGARAFIGSNTSLVAPVSIGIEAMTASGSVITQNVPIGALALSRAK 424

Query: 428 QIVKEDGALSMRKK 441
           Q+ KED A  +  K
Sbjct: 425 QVNKEDLATRLMDK 438


>gi|220921817|ref|YP_002497118.1| UDP-N-acetylglucosamine pyrophosphorylase [Methylobacterium
           nodulans ORS 2060]
 gi|219946423|gb|ACL56815.1| UDP-N-acetylglucosamine pyrophosphorylase [Methylobacterium
           nodulans ORS 2060]
          Length = 449

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 199/429 (46%), Positives = 277/429 (64%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L +VLAAG+G RM+S   KVL  +AG+PM+ HV+  + AAG + VA+V+  G  ++ 
Sbjct: 11  RSLLCVVLAAGKGTRMRSDLPKVLHPLAGRPMLGHVLAAVRAAGADAVAVVIEPGRADVA 70

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                     + + Q  + GTAHAVL A+ A++ G DDV+I +GD PL+   TL +    
Sbjct: 71  AAVEVAAPGAQVFPQAERLGTAHAVLAARPALEAGCDDVVIAFGDTPLIRPETLARLRAP 130

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +A+G  +AV+ F A +P GYGR+L   + ++AI EE DA  EER++   N+GLMA+ G  
Sbjct: 131 LAEGAGVAVLAFEAADPTGYGRVLTDGDRVVAICEEKDAGPEERRVSLSNAGLMALSGRL 190

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +D L +I     + EYYL D +  A  DG+ +A + V+E E  G N+R +L+  E + Q
Sbjct: 191 ALDLLGRIGNANAAGEYYLPDAVALAVADGERVAVVPVEEAEAQGVNDRVQLAAAEAVIQ 250

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
           +R RR+ M++G T+IAPETVFLSHDT +  D V+EPHV FG GV + +   I AFS+LE 
Sbjct: 251 ARLRREAMLAGATLIAPETVFLSHDTRLGRDVVVEPHVVFGPGVVVGDGCTIHAFSHLEK 310

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             +     IGP+AR+R    + +  RIGNF EVK A I  G+K+NHLSYVGD+ VG   N
Sbjct: 311 TVLEPGVQIGPYARLRPGAHLARGARIGNFVEVKNAAIGAGAKVNHLSYVGDAEVGAGAN 370

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           +GAGTITCNYDG +K++T I   AF+GSNS+L+AP+TIG   YV SGS++T D P  +L 
Sbjct: 371 LGAGTITCNYDGVNKHRTVIGAGAFVGSNSALVAPVTIGARAYVGSGSVVTDDVPAEALA 430

Query: 423 FARSRQIVK 431
             R RQ+VK
Sbjct: 431 LGRGRQVVK 439


>gi|307293429|ref|ZP_07573275.1| UDP-N-acetylglucosamine pyrophosphorylase [Sphingobium
           chlorophenolicum L-1]
 gi|306881495|gb|EFN12711.1| UDP-N-acetylglucosamine pyrophosphorylase [Sphingobium
           chlorophenolicum L-1]
          Length = 449

 Score =  385 bits (989), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 202/447 (45%), Positives = 276/447 (61%), Gaps = 18/447 (4%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R    I+LAAG+G RMKS+  KVL  IAG+PM+ H++ ++A    E   +V+G G E++ 
Sbjct: 5   RPLAVIILAAGQGTRMKSAKHKVLHPIAGRPMLLHLLASVAELQPERQVVVVGAGREQVE 64

Query: 63  RINFPPTLSVE-----YYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLK 117
           R       +VE       +Q+ Q GT HAV  A DA+     D++I+YGDVPLV + TL+
Sbjct: 65  R-------AVEGSGAVIAVQEQQLGTGHAVAQAHDALAGFAGDILILYGDVPLVRAETLR 117

Query: 118 KAMDKIAQG--YSIAVVGFNADNPKGYGRLLIKNNEII-AIREENDATDEERKIHYCNSG 174
             +D++  G      V+GF  ++   YGR++ ++  +I  + E  DA  EER +  CNSG
Sbjct: 118 AMLDRLNWGDEPRAVVLGFRPEDAAAYGRIIARDQGVIEKMVEYKDANAEERAVTLCNSG 177

Query: 175 LMAIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYEL 234
           LMA+    +   L QI  + V+ EYYL DI+    L G   A I+ +  EV G N+R EL
Sbjct: 178 LMAVRSTDLFVLLDQIGNDNVAGEYYLPDIV---MLPGAQSAVIEAEAWEVAGVNSRAEL 234

Query: 235 SLIENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQI 294
           + +E +WQ R R + M  GVT+IAPETVF +HDT++  D VIEP+V FG GVS+ +   I
Sbjct: 235 AGVEAVWQDRRRAEAMREGVTLIAPETVFFAHDTVLGRDVVIEPNVVFGPGVSVADDATI 294

Query: 295 RAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGD 354
            AFS+LEG  +GK   IGP+AR+R    I    ++GNF EVKKA + EG+K NHLSY+GD
Sbjct: 295 HAFSHLEGATVGKGADIGPYARLRPGAKIGVKAKVGNFVEVKKAELGEGAKANHLSYIGD 354

Query: 355 SVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQ 414
           + VG   NIGAGTITCNYDG  KYKT I   AFIGSNS+L+AP+ IG G  VA+GS++TQ
Sbjct: 355 ASVGAGANIGAGTITCNYDGFFKYKTEIGAGAFIGSNSALVAPVKIGDGAIVAAGSVVTQ 414

Query: 415 DTPENSLVFARSRQIVKEDGALSMRKK 441
               ++L   R +Q  K   A   R +
Sbjct: 415 AVEADALCLVRPKQEAKPGWAARFRAR 441


>gi|91977088|ref|YP_569747.1| nucleotidyl transferase [Rhodopseudomonas palustris BisB5]
 gi|119370588|sp|Q136Z3|GLMU_RHOPS RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|91683544|gb|ABE39846.1| UDP-N-acetylglucosamine pyrophosphorylase / glucosamine-1-phosphate
           N-acetyltransferase [Rhodopseudomonas palustris BisB5]
          Length = 452

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 190/433 (43%), Positives = 276/433 (63%), Gaps = 8/433 (1%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYG----A 58
           R  L IVLAAG G RM+SS  KVL  +AG+P+++HV+        + +A+V+G      A
Sbjct: 4   RTSLTIVLAAGEGTRMRSSLPKVLHPVAGRPLLAHVLAAAPHGADDKLAVVIGPDHQAVA 63

Query: 59  EEITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKK 118
           +E  RI        E ++Q  + GTAHAVL A+ AI  G D+++I +GD PL+S+ T  +
Sbjct: 64  DETKRIR----PDAETFVQSERLGTAHAVLAAKQAIARGADELLIAFGDTPLISAETFAR 119

Query: 119 AMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAI 178
             + +  G ++ V+GF A +P GYGRL+++ +++ AIRE+ DA+ +E KI  CN+G+MAI
Sbjct: 120 LREPLRNGSALVVLGFRAADPTGYGRLVVEGDQLAAIREQADASADELKITLCNAGVMAI 179

Query: 179 DGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIE 238
           DG   +D L QI       EYYLTD +   R  G   + I+  E EV G N + +L+  E
Sbjct: 180 DGRIALDVLAQIGNANKKGEYYLTDAVGIMRERGLRASVIETDEDEVRGINTKAQLAEAE 239

Query: 239 NIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFS 298
            + Q+R R+  M +GVT+I+PET+ L+ DT    D  IE  V  G GVSI +   I +FS
Sbjct: 240 AVMQTRLRQAAMTAGVTLISPETIHLAADTRFGKDVTIEQFVVIGPGVSIADGAVIHSFS 299

Query: 299 YLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVG 358
           ++ G  +G    +GP+AR+R  T++    +IGNF E K A I  G+K+NHL+Y+GD+ +G
Sbjct: 300 HIVGASVGSNASVGPYARLRPGTSLGDGAKIGNFVETKAARIDAGAKVNHLTYIGDAHIG 359

Query: 359 KNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPE 418
           +  NIGAGTITCNYDG +K++T I   AFIGSNSSL+AP+ IG G YV SGS++T++ P+
Sbjct: 360 EGANIGAGTITCNYDGFNKHRTEIGAGAFIGSNSSLVAPVKIGVGAYVGSGSVVTKNVPD 419

Query: 419 NSLVFARSRQIVK 431
           +SL   R+ Q V+
Sbjct: 420 DSLAVERNDQTVR 432


>gi|148557448|ref|YP_001265030.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Sphingomonas wittichii RW1]
 gi|166226130|sp|A5VF26|GLMU_SPHWW RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|148502638|gb|ABQ70892.1| UDP-N-acetylglucosamine pyrophosphorylase / glucosamine-1-phosphate
           N-acetyltransferase [Sphingomonas wittichii RW1]
          Length = 452

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 200/441 (45%), Positives = 272/441 (61%), Gaps = 5/441 (1%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R   A++LAAG+G RMKS   KVL  IAGKPM+ H++  +   G     +V G G E++ 
Sbjct: 4   RPFAALILAAGKGTRMKSDLHKVLHPIAGKPMLGHLIAAVDRLGAARKLVVTGAGREQVE 63

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
               P  L VE   Q+ Q GTAHAV   + A+     DV+I+YGDVPLV + T+++ +D+
Sbjct: 64  AFVAP--LGVEVATQEPQLGTAHAVQQGEAALADFDGDVLILYGDVPLVPAETIRRMLDR 121

Query: 123 I-AQGYSIAVV-GFNADNPKGYGRLLIKNNEIIA-IREENDATDEERKIHYCNSGLMAID 179
           +  +   +AVV GF  D+   YGR+L + +  I  + E  DAT E+R I  CNSGLMA+ 
Sbjct: 122 LQGEDAPVAVVLGFRPDDALAYGRILARGDGAIDDMVEYKDATTEQRAIDLCNSGLMAVR 181

Query: 180 GLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIEN 239
           G  +   L Q+  +  + EYYL DI+  AR +G     ++ +  EV G N+R EL+ +E 
Sbjct: 182 GRDLWRLLAQVGNDNAAGEYYLPDIVRIARAEGGRSVVVEAEAWEVAGVNSRAELAAVEA 241

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSY 299
            WQ R R   M  G T+IAPETV+ SHDT++  D VIEPHV FG GV+IE+ V I  FS+
Sbjct: 242 EWQRRRRLAAMADGATLIAPETVWFSHDTMVGRDVVIEPHVVFGPGVTIEDGVAIHGFSH 301

Query: 300 LEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGK 359
           +EG  +     IGP+AR+R    I +  +IGNF EVK     +G+K NHLSY+GD+ VG 
Sbjct: 302 VEGATVRTGAEIGPYARLRPGADIGEGAKIGNFVEVKNGRFGKGAKANHLSYIGDADVGA 361

Query: 360 NVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPEN 419
             NIGAGTITCNYDG  KY+T I E AFIGSNS+L+AP+TIG G  V +GS +T+D   +
Sbjct: 362 KANIGAGTITCNYDGFLKYRTVIGEGAFIGSNSALVAPVTIGDGAIVGAGSTVTRDVEAD 421

Query: 420 SLVFARSRQIVKEDGALSMRK 440
           +L  AR +Q  +   A   R+
Sbjct: 422 ALAVARGKQESRTGWAARFRE 442


>gi|90424104|ref|YP_532474.1| nucleotidyl transferase [Rhodopseudomonas palustris BisB18]
 gi|109892118|sp|Q214N1|GLMU_RHOPB RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|90106118|gb|ABD88155.1| UDP-N-acetylglucosamine pyrophosphorylase / glucosamine-1-phosphate
           N-acetyltransferase [Rhodopseudomonas palustris BisB18]
          Length = 458

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 195/442 (44%), Positives = 279/442 (63%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           ++R  L IVLAAG G RM+S++ KVL ++AG+ +++HV+         ++A+V+G     
Sbjct: 2   LRRTSLTIVLAAGEGTRMRSATPKVLHQVAGESLLAHVLNAAPRGDGASLAVVVGPDHAA 61

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           ++            ++Q  + GTAHAVL A++AI  G DD++I +GD PL+S+ T ++  
Sbjct: 62  VSNEAKRVRPDAATFVQRERLGTAHAVLAAREAIAAGADDLLIAFGDTPLISAATFERLR 121

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
             +  G ++AV+GF   +P GYGRLL++   ++AIRE+ DA+ EER+I  CN+G+MA DG
Sbjct: 122 QPLRDGATLAVLGFRPADPTGYGRLLVEGGRLVAIREQADASAEEREITLCNAGVMAFDG 181

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
              +  L +I       EYYLTD +   R  G     I+    EV G N + +L+  E +
Sbjct: 182 RTALAILERIGNANSKGEYYLTDAVAIVRDLGLEATVIETSADEVRGINTKAQLAEAEAV 241

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
            Q+R RR  + +GVTMIAP+TVFL+ DT    D  IEP V  G GVSI +   I AFS+L
Sbjct: 242 MQARLRRAALDAGVTMIAPDTVFLAADTTFGVDVTIEPFVVIGPGVSIADGAVIHAFSHL 301

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
               IGK   +GP+AR+R  T++    +IGNF E K A I  G+K+NHL+Y+GDS +G  
Sbjct: 302 VQAVIGKNASVGPYARLRPGTSLGDGAKIGNFVETKAAIIDAGAKVNHLTYIGDSHIGAG 361

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
            NIGAGTITCNYDG  K+KT I   AFIGSNSSL+AP+TIG G Y+ SGS+I++D P+++
Sbjct: 362 ANIGAGTITCNYDGFGKHKTKIGAGAFIGSNSSLVAPVTIGAGAYIGSGSVISRDVPDDA 421

Query: 421 LVFARSRQIVKEDGALSMRKKK 442
           L  AR +Q ++E  A   R+ K
Sbjct: 422 LAVARGQQAIREGWAKRFREAK 443


>gi|27379719|ref|NP_771248.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Bradyrhizobium japonicum USDA 110]
 gi|81737024|sp|Q89LD7|GLMU_BRAJA RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|27352872|dbj|BAC49873.1| UDP-N-acetylglucosamine pyrophosphorylase [Bradyrhizobium japonicum
           USDA 110]
          Length = 451

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 198/444 (44%), Positives = 287/444 (64%), Gaps = 8/444 (1%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYG----A 58
           R  L IVLAAG G RM+S   KVL  +A + +++HV+         ++A+V+G      A
Sbjct: 4   RSSLTIVLAAGEGTRMRSHLPKVLHPVAHQTLLAHVLTAAPKGTGTSLAVVIGPDHQAVA 63

Query: 59  EEITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKK 118
           +E  RI  P  ++   ++Q  + GTAHAVL A++AI  G DD++I +GD PL+S+ T  +
Sbjct: 64  DEARRIR-PDAVT---FVQAERLGTAHAVLAAREAIARGVDDLLIAFGDTPLISAETFAR 119

Query: 119 AMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAI 178
               +A G ++A +GF A +P GYGR +++ + ++AIRE+ DA+ +ERKI  CN+G+MAI
Sbjct: 120 LRAPLANGAALAALGFRAADPAGYGRFIVEGDRLVAIREQADASADERKIDLCNAGVMAI 179

Query: 179 DGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIE 238
           DG   +  L +I       EYYLTD +E  R  G     I+  E EV G N + +L+  E
Sbjct: 180 DGRRALAILDKIGNANSKGEYYLTDAVEIVREQGWESVVIETSEDEVRGINTKAQLAEAE 239

Query: 239 NIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFS 298
           ++ Q+R R+  M +GVT+IAPETV+LS DT+   D  IEP V  G GVSI +   I +FS
Sbjct: 240 SVMQARLRKAAMEAGVTLIAPETVYLSADTVFGKDVTIEPFVVIGPGVSIADGTVIHSFS 299

Query: 299 YLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVG 358
           ++    +G+   IGP+AR+R  T++    RIGNF E K AT++ G K+NHLSY+GD+ VG
Sbjct: 300 HIVETTLGRNVSIGPYARLRPGTSLGDGARIGNFVETKAATLEAGVKVNHLSYIGDATVG 359

Query: 359 KNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPE 418
            N NIGAGTITCNYDG  K+KT I + AF+G+NSSL+AP+ IG G Y+ SGS+IT+D P+
Sbjct: 360 ANSNIGAGTITCNYDGFKKHKTIIGQGAFVGTNSSLVAPVKIGNGAYIGSGSVITRDVPD 419

Query: 419 NSLVFARSRQIVKEDGALSMRKKK 442
           +++   R++Q ++E GA   R+ K
Sbjct: 420 DAMALERNQQTIREGGAARYREMK 443


>gi|146340708|ref|YP_001205756.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Bradyrhizobium sp. ORS278]
 gi|146193514|emb|CAL77530.1| bifunctional: N-acetyl glucosamine-1-phosphate uridyltransferase
           (N-terminal); glucosamine-1-phosphate acetyl transferase
           (C-terminal) [Bradyrhizobium sp. ORS278]
          Length = 449

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 197/440 (44%), Positives = 278/440 (63%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L IVLAAG G RM+SS  KVL  IAG+ M++HV+          +A+V+G G + + 
Sbjct: 5   RSSLTIVLAAGEGTRMRSSLPKVLHPIAGESMLAHVLAAAPQGDGAAIAVVIGPGHDAVE 64

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
           +        V  ++Q  + GTAHAVL A++AI  G DD+++ +GD PL+++ T  +    
Sbjct: 65  KEAKRLCPDVAIFVQRERLGTAHAVLAAREAIARGADDLLVAFGDTPLITAETFARLRAA 124

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +AQG ++AV+GF A +P GYGRLL+  ++++AIRE  DA++ ER I  CN+G+MA+DG  
Sbjct: 125 LAQGAALAVLGFRAVDPTGYGRLLLDGSKLVAIREHADASEAERAITLCNAGVMAMDGRR 184

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +  L +I       EYYL D +  AR  G     I+  E EV G N + +L+  E   Q
Sbjct: 185 ALAILDKIGNTNSKGEYYLVDAVAIARSQGLDAVVIETSEDEVRGINTKAQLAQAEAAMQ 244

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
           +R R+  M +GVT+IAPETV+L+ DT    D  IEP V  G GVSI +   + +FS++  
Sbjct: 245 ARLRQAAMDAGVTLIAPETVYLAADTTFGRDVTIEPFVVIGPGVSIGDGAVVHSFSHVVQ 304

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             +G  T++GPFAR+R  T++    +IGNF E K A ++ G K+NHLSY+GD+ VG + N
Sbjct: 305 SKLGSNTLLGPFARLRPGTSLGDGAKIGNFVEAKAAVLEPGVKVNHLSYIGDAHVGAHSN 364

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG +K+KT I E AFIG+N+SL+API IG   Y+ SGS+IT+D P+++L 
Sbjct: 365 IGAGTITCNYDGFNKHKTRIGEGAFIGTNTSLVAPINIGARAYIGSGSVITRDVPDDALA 424

Query: 423 FARSRQIVKEDGALSMRKKK 442
             RS Q  KE  A   R  K
Sbjct: 425 LERSPQTTKEGAAARFRNAK 444


>gi|190359464|sp|A4YUF4|GLMU_BRASO RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
          Length = 448

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 197/440 (44%), Positives = 278/440 (63%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R  L IVLAAG G RM+SS  KVL  IAG+ M++HV+          +A+V+G G + + 
Sbjct: 4   RSSLTIVLAAGEGTRMRSSLPKVLHPIAGESMLAHVLAAAPQGDGAAIAVVIGPGHDAVE 63

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
           +        V  ++Q  + GTAHAVL A++AI  G DD+++ +GD PL+++ T  +    
Sbjct: 64  KEAKRLCPDVAIFVQRERLGTAHAVLAAREAIARGADDLLVAFGDTPLITAETFARLRAA 123

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +AQG ++AV+GF A +P GYGRLL+  ++++AIRE  DA++ ER I  CN+G+MA+DG  
Sbjct: 124 LAQGAALAVLGFRAVDPTGYGRLLLDGSKLVAIREHADASEAERAITLCNAGVMAMDGRR 183

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
            +  L +I       EYYL D +  AR  G     I+  E EV G N + +L+  E   Q
Sbjct: 184 ALAILDKIGNTNSKGEYYLVDAVAIARSQGLDAVVIETSEDEVRGINTKAQLAQAEAAMQ 243

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
           +R R+  M +GVT+IAPETV+L+ DT    D  IEP V  G GVSI +   + +FS++  
Sbjct: 244 ARLRQAAMDAGVTLIAPETVYLAADTTFGRDVTIEPFVVIGPGVSIGDGAVVHSFSHVVQ 303

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             +G  T++GPFAR+R  T++    +IGNF E K A ++ G K+NHLSY+GD+ VG + N
Sbjct: 304 SKLGSNTLLGPFARLRPGTSLGDGAKIGNFVEAKAAVLEPGVKVNHLSYIGDAHVGAHSN 363

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG +K+KT I E AFIG+N+SL+API IG   Y+ SGS+IT+D P+++L 
Sbjct: 364 IGAGTITCNYDGFNKHKTRIGEGAFIGTNTSLVAPINIGARAYIGSGSVITRDVPDDALA 423

Query: 423 FARSRQIVKEDGALSMRKKK 442
             RS Q  KE  A   R  K
Sbjct: 424 LERSPQTTKEGAAARFRNAK 443


>gi|294012411|ref|YP_003545871.1| UDP-N-acetylglucosamine pyrophosphorylase [Sphingobium japonicum
           UT26S]
 gi|292675741|dbj|BAI97259.1| UDP-N-acetylglucosamine pyrophosphorylase [Sphingobium japonicum
           UT26S]
          Length = 484

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 198/447 (44%), Positives = 273/447 (61%), Gaps = 18/447 (4%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R    I+LAAG+G RMKS+  KVL  IAG+PM+ H++ ++A    E   +V+G G E++ 
Sbjct: 40  RPLAVIILAAGQGTRMKSARHKVLHPIAGRPMLLHLLASVAELQPERQVVVVGAGREQVE 99

Query: 63  RINFPPTLSVE-----YYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLK 117
           R       +VE       +Q+ Q GT HAV  A DA+     D++I+YGDVPLV + TL+
Sbjct: 100 R-------AVEGSGAVIAVQEQQLGTGHAVAQAHDALAGFAGDILILYGDVPLVRAETLR 152

Query: 118 KAMDKIAQG--YSIAVVGFNADNPKGYGRLLIKNNEII-AIREENDATDEERKIHYCNSG 174
             +D++  G      V+GF  ++   YGR++ ++  +I  + E  DA  EER +  CNSG
Sbjct: 153 SMLDRLNWGDEPRAVVLGFRPEDAAAYGRIIARDQGVIEKMVEYKDANAEERAVTLCNSG 212

Query: 175 LMAIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYEL 234
           LMA+    +   L QI  +  + EYYL DI+    L G   A I+ +  EV G N+R EL
Sbjct: 213 LMAVRSTDLFVLLDQIGNDNAAGEYYLPDIV---MLPGAQSAVIEAEAWEVAGVNSRAEL 269

Query: 235 SLIENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQI 294
           + +E +WQ R R + M  G T+IAPETVF +HDT++  D  IEP+V FG GVS+ +   I
Sbjct: 270 AGVEAVWQDRRRAEAMRDGATLIAPETVFFAHDTLLGRDVTIEPNVVFGPGVSVADDATI 329

Query: 295 RAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGD 354
            AFS+LEG  +GK   IGP+AR+R    I    ++GNF EVKKA + EG+K NHLSY+GD
Sbjct: 330 HAFSHLEGATVGKGADIGPYARLRPGAKIGAKAKVGNFVEVKKAELGEGAKANHLSYIGD 389

Query: 355 SVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQ 414
           + VG   NIGAGTITCNYDG  KY+T I   AFIGSNS+L+AP+ IG G  VA+GS++TQ
Sbjct: 390 ASVGAGANIGAGTITCNYDGFFKYRTEIGAGAFIGSNSALVAPVKIGDGAIVAAGSVVTQ 449

Query: 415 DTPENSLVFARSRQIVKEDGALSMRKK 441
               ++L   R +Q  K   A   R +
Sbjct: 450 AVEADALCLVRPKQEAKPGWAARFRAR 476


>gi|86137614|ref|ZP_01056191.1| UDP-N-acetylglucosamine pyrophosphorylase [Roseobacter sp. MED193]
 gi|85825949|gb|EAQ46147.1| UDP-N-acetylglucosamine pyrophosphorylase [Roseobacter sp. MED193]
          Length = 451

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 191/422 (45%), Positives = 275/422 (65%), Gaps = 3/422 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           +VLAAG+G RM S   KVL  IA   M+ H +    A   E V +V G+ A+ +      
Sbjct: 6   VVLAAGKGTRMNSDLPKVLHPIAQGSMLEHALIAGRALDPERVIVVAGHEADAVRAAVAE 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
              S E  +Q  Q GTAHAV  A+DA++    DV+++YGD P VS+ TL++ +   A+G 
Sbjct: 66  IDESAEVVLQMEQLGTAHAVDQARDALQGFKGDVVVLYGDTPFVSADTLERMV--AARGS 123

Query: 128 S-IAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
           + + V+GF+A++P  YGRL+++ + +  I E  DA+  ER I +CNSGLMA D   + D 
Sbjct: 124 ADLVVLGFHAEDPARYGRLVMQGDSLERIVEFKDASAAERSIDFCNSGLMACDAGLMFDL 183

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYR 246
           L +I     S EYYLTD++E AR     + +I   E E  G N+R +L+  + ++Q++ R
Sbjct: 184 LTKIGNENASGEYYLTDLVELARAADHRVTAIACDESETLGVNSRADLAAADAVFQAKAR 243

Query: 247 RQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIG 306
            +++  GVT++APETV+L+ DT+I  DTVIEP+V FG GV++E+ V IRAFS+LEG H+ 
Sbjct: 244 AELLDLGVTLMAPETVYLAFDTVIGRDTVIEPNVVFGPGVTVESGVLIRAFSHLEGCHVS 303

Query: 307 KKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAG 366
           +   +GP+AR+R    + +N  IGNF E+K A I EG+K+NHLSY+GD+ VGK  NIGAG
Sbjct: 304 RGAKVGPYARLRPGAELAENTHIGNFVEIKNAEIAEGAKVNHLSYIGDASVGKETNIGAG 363

Query: 367 TITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARS 426
           TITCNYDG  K++T I   AFIGSN+ L+AP+T+G  T  ASG+++T+D     L  +R+
Sbjct: 364 TITCNYDGVMKHRTKIGARAFIGSNTLLVAPVTLGHETMTASGTVVTKDVDHGDLAISRT 423

Query: 427 RQ 428
           RQ
Sbjct: 424 RQ 425


>gi|56697635|ref|YP_168005.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Ruegeria pomeroyi DSS-3]
 gi|81558395|sp|Q5LPQ1|GLMU_SILPO RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|56679372|gb|AAV96038.1| UDP-N-acetylglucosamine pyrophosphorylase [Ruegeria pomeroyi DSS-3]
          Length = 450

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 182/428 (42%), Positives = 275/428 (64%), Gaps = 1/428 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RMKS   KVL  IA  PM+ H M   A        +V G+GAE +      
Sbjct: 6   VILAAGKGTRMKSDLPKVLHPIAHAPMLVHAMRAGAVLEPARTVIVAGHGAEAVRAAALD 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
                   +Q+ Q GTAHAV  A+ A++    DV+++YGD P +   TL++ M    + +
Sbjct: 66  EDEGATVVLQEEQLGTAHAVDQARAALEGFEGDVVVLYGDTPFLQPDTLER-MLAARKTH 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            + ++GF A +P  YGRL+++ + +  I E  +AT++ER I +CNSGL+A +   +   +
Sbjct: 125 DLVILGFEAADPARYGRLVMQGDSLERIVEFKEATEQERAIRFCNSGLLACNAETLFALI 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
             +  N  S EYYLTD++E AR  G ++ ++   E +  G N+R +L+  + I+Q+R R 
Sbjct: 185 AAVGNNNASGEYYLTDVVEIARKQGLAVTAVACDEAQTLGVNSRADLAAADAIFQTRARA 244

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
           +++  GVT++APETV+L+ DT+I  DTVIEP+V FG GV++E+   IRAFS+LEG H+ +
Sbjct: 245 ELLDLGVTLMAPETVYLAADTVIGRDTVIEPNVVFGPGVTVESGATIRAFSHLEGCHVSR 304

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
             ++GP+AR+R    + +N RIGNF E+K A I EG+K+NHL+Y+GD+ +G   NIGAGT
Sbjct: 305 GAVVGPYARLRPGAELAENARIGNFVEIKNAEIGEGAKVNHLTYIGDASIGAGSNIGAGT 364

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           ITCNYDG  K++T I  N FIGSN+ L+AP+T+G G   A+G+++T+D   ++L  AR +
Sbjct: 365 ITCNYDGVMKHRTTIGANVFIGSNTMLVAPVTLGDGAMTATGTVVTRDVEPDALAKARVK 424

Query: 428 QIVKEDGA 435
           Q  K D A
Sbjct: 425 QENKPDRA 432


>gi|163746183|ref|ZP_02153542.1| UDP-N-acetylglucosamine pyrophosphorylase [Oceanibulbus indolifex
           HEL-45]
 gi|161380928|gb|EDQ05338.1| UDP-N-acetylglucosamine pyrophosphorylase [Oceanibulbus indolifex
           HEL-45]
          Length = 450

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 192/432 (44%), Positives = 271/432 (62%), Gaps = 3/432 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM S   KVL ++A  PM+ H M   A     +  +V G+GA+++      
Sbjct: 6   IILAAGKGTRMNSDLPKVLHRVASAPMLEHAMAAGAMLAPRHTVVVAGHGADQVRAAATL 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDV-IIMYGDVPLVSSHTLKKAMDKIAQG 126
                +   Q  Q GTAHAV  A+ A++ G+D + +++YGD P V   TL+K  + +A  
Sbjct: 66  FDEDAQVVEQTEQLGTAHAVAQARPALE-GFDGMALVLYGDTPFVQPETLEKMQEALAT- 123

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
           + + V+GF A +P  YGRL+++ + +  I E  DA+ EER I  CNSG++A     + D 
Sbjct: 124 HDVVVLGFEAADPARYGRLVMQGDALERIVEFKDASPEERAITLCNSGVVACKSDLLFDL 183

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYR 246
           + ++     S+EYYLTDII  AR +G+S   +   E E  G N+R +L+  E  +QSR R
Sbjct: 184 IDKVGNENASEEYYLTDIISLARAEGRSATVVTCAEAETMGVNSRADLARAEAAFQSRAR 243

Query: 247 RQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIG 306
             +M  GVT+IAPETVFL+ DT I  DTV+EP+V FG  V++E+   IRAFS+LEG H+ 
Sbjct: 244 ALLMEDGVTLIAPETVFLARDTYIGRDTVVEPNVVFGPNVTVESGTTIRAFSHLEGCHVS 303

Query: 307 KKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAG 366
           +  ++GP+AR+R    + ++VRIGNF EVK A I EG+K+NHLSY+GD+ +G   NIGAG
Sbjct: 304 RGGVVGPYARLRPGAELAEDVRIGNFVEVKNAQIAEGAKVNHLSYIGDATIGARSNIGAG 363

Query: 367 TITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARS 426
           TITCNYDG  K+ T I   AFIGSN+ L+AP+TIG G    SGS+IT D    +L  +R+
Sbjct: 364 TITCNYDGVMKHHTTIGAGAFIGSNTMLVAPVTIGDGAMTGSGSVITSDVEPEALALSRA 423

Query: 427 RQIVKEDGALSM 438
            Q+ K   A  M
Sbjct: 424 PQVEKPGMARKM 435


>gi|254510745|ref|ZP_05122812.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Rhodobacteraceae bacterium KLH11]
 gi|221534456|gb|EEE37444.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Rhodobacteraceae bacterium KLH11]
          Length = 450

 Score =  378 bits (971), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 189/422 (44%), Positives = 274/422 (64%), Gaps = 3/422 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  IA  PM+ H M   A    E   +V G+GAE + ++   
Sbjct: 6   VILAAGKGTRMNSDIPKVLHPIAQVPMLVHAMRAGAVLSPERTVIVTGHGAEAVAKVAKA 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYD-DVIIMYGDVPLVSSHTLKKAMDKIAQG 126
              S +  +Q+ Q GTAHAV  A+ A++ G+D DV+++YGD P +   TL++ +   A+ 
Sbjct: 66  EDDSTQIAVQEEQLGTAHAVAQARSALE-GFDGDVVVLYGDTPFLQPDTLERMIAARAEN 124

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
             + ++GF A +P  YGRL++  N +  I E  DATDEER I  CNSGL+A D   +   
Sbjct: 125 -DLVILGFEAADPARYGRLVMNGNALERIVEFKDATDEERAITLCNSGLLACDAKTLFAL 183

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYR 246
           +  +  +  S EYYL D++E A   G S+ ++   E +  G N+R +L+  + ++Q+R R
Sbjct: 184 IDAVGNDNASGEYYLPDVVEIAGDRGLSVTAVACDEAQTLGVNSRVDLAAADAVFQARAR 243

Query: 247 RQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIG 306
             ++  GVT++APETV+L+ DTII  DTVIEP+V FG GV++E+   IRAFS+LEG H+ 
Sbjct: 244 AALLELGVTLMAPETVYLAADTIIGRDTVIEPNVVFGPGVTVESGATIRAFSHLEGCHVS 303

Query: 307 KKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAG 366
           +  I+GP+AR+R    + +N RIGNF E+K A I EG+K+NHLSYVGD+ VG   NIGAG
Sbjct: 304 RGAIVGPYARLRPGAELSENTRIGNFVEIKNAAIAEGAKVNHLSYVGDASVGAASNIGAG 363

Query: 367 TITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARS 426
           TITCNYDG  K++T I EN FIGSN+ L+AP+T+G     A+G+++T+D    +L  AR+
Sbjct: 364 TITCNYDGVMKHRTTIGENVFIGSNTMLVAPVTVGDNAMTATGTVVTKDVEPEALAVARA 423

Query: 427 RQ 428
           +Q
Sbjct: 424 KQ 425


>gi|83942689|ref|ZP_00955150.1| UDP-N-acetylglucosamine pyrophosphorylase [Sulfitobacter sp. EE-36]
 gi|83846782|gb|EAP84658.1| UDP-N-acetylglucosamine pyrophosphorylase [Sulfitobacter sp. EE-36]
          Length = 450

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 197/439 (44%), Positives = 276/439 (62%), Gaps = 6/439 (1%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM+S   KVL  +A  P++ H M + AA       +V G+GA+++      
Sbjct: 6   ILLAAGKGTRMQSDLPKVLHAVAHAPLLEHAMASGAALSPARTVVVAGHGADQVRAAAQA 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD-VIIMYGDVPLVSSHTLKKAMDKIAQG 126
                +  +Q+ Q GTAHAV  A++A+  G+D   I++YGD P V + TL+  M    + 
Sbjct: 66  FDDEAQVVVQEEQLGTAHAVGQAREALA-GFDGTAIVLYGDTPFVQTETLEN-MCAALET 123

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
             + V+GF+A +P  YGRL+++ + +  I E  DATDEER I  CNSG++A     + D 
Sbjct: 124 NDVVVLGFDAADPARYGRLVMQGDSLDRIVEYKDATDEERAITLCNSGVVACKSDLLFDL 183

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYR 246
           +  +  +  S+EYYLTDII  AR  G    ++   E E  G N+R +L+  +  +QSR R
Sbjct: 184 IDAVGNDNASEEYYLTDIIGIARERGLKATAVTCDEAETMGVNSRADLAAADAAFQSRAR 243

Query: 247 RQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIG 306
             M+  G+T++APETV+ + DT I  DTVIEP+V FG GV+IE+   IRAFS+LEG H+ 
Sbjct: 244 AAMLEDGITLMAPETVYFARDTYIGRDTVIEPNVVFGPGVTIESGATIRAFSHLEGCHVA 303

Query: 307 KKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAG 366
           +  +IGP+AR+R    + ++VRIGNF EVK A I EG+K+NHLSY+GD+ +G   NIGAG
Sbjct: 304 RGGVIGPYARLRPGAELSEDVRIGNFVEVKNAQIAEGAKVNHLSYIGDATIGAKANIGAG 363

Query: 367 TITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARS 426
           TITCNYDG  K+ THI  NAFIGSN+ L+AP+ IG G    SGS+IT D   ++L  AR+
Sbjct: 364 TITCNYDGVMKHHTHIGANAFIGSNTMLVAPVHIGDGAMTGSGSVITSDVEADALALARA 423

Query: 427 RQIVKEDGA---LSMRKKK 442
            Q+ K   A   L M K K
Sbjct: 424 HQVEKPGMARKLLEMLKAK 442


>gi|254466653|ref|ZP_05080064.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Rhodobacterales bacterium Y4I]
 gi|206687561|gb|EDZ48043.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Rhodobacterales bacterium Y4I]
          Length = 451

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/424 (43%), Positives = 268/424 (63%), Gaps = 1/424 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  IA  PM+ H M    A   E   +V G+GAE +      
Sbjct: 6   VILAAGKGTRMNSDLPKVLHPIAQAPMLEHAMAAGRALAPERTIIVAGHGAEAVRAAVSE 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
                E  +Q+ Q GTAHAV  A+ A+     DV+++YGD P VS+ TL++ M +  Q  
Sbjct: 66  IDEEAEVVLQEEQLGTAHAVDQARAALDGFEGDVVVLYGDTPFVSAETLER-MVEARQRA 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            + ++GF A +P  YGRL+++ + +  I E  DA++ ER I +CNSGLMA     I D +
Sbjct: 125 DLVILGFEAADPGRYGRLVMEGDSLERIVEFKDASEAERAISFCNSGLMAGKASAIFDLI 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
            ++     S EYYLTD++E AR +G  + ++   E E  G N+R EL+  + ++Q+R R 
Sbjct: 185 AKVGNENASGEYYLTDLVELARREGLKVTAVSCDEAETLGVNSRAELAQADALFQARARA 244

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
           +++  GVT++APETV+L+ DT I  DTVIEP+V FG GV++E+   IRAFS+LEG H+ +
Sbjct: 245 ELLELGVTLMAPETVYLAFDTFIGRDTVIEPNVVFGPGVTVESGALIRAFSHLEGCHVSR 304

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
              +GP+AR+R    + +N  IGNF E+K A I EG+K+NHLSY+GD+ VG+  NIGAGT
Sbjct: 305 GAKVGPYARLRPGAELAENTHIGNFVEIKNAEIAEGAKVNHLSYIGDAFVGEAANIGAGT 364

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           ITCNYDG  K++T I   AFIGSN+ L+AP+ +G     A+G+++T++  +  L   R+ 
Sbjct: 365 ITCNYDGVMKHRTEIGARAFIGSNTMLVAPVRVGNEAMTATGAVVTRNVEDGDLAIGRAE 424

Query: 428 QIVK 431
           Q  K
Sbjct: 425 QTNK 428


>gi|163741506|ref|ZP_02148897.1| UDP-N-acetylglucosamine pyrophosphorylase [Phaeobacter
           gallaeciensis 2.10]
 gi|161385240|gb|EDQ09618.1| UDP-N-acetylglucosamine pyrophosphorylase [Phaeobacter
           gallaeciensis 2.10]
          Length = 451

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 183/421 (43%), Positives = 265/421 (62%), Gaps = 1/421 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  IA  PM+ H +    A   E   +V G+GA+ +  +   
Sbjct: 6   VILAAGKGTRMNSDLPKVLHPIAHAPMLEHALSAGRALTPERTIVVAGHGADYVRSMMAD 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
                E  +Q+ Q GTAHAV   +DA+     D++++YGD P VS+ TL++ M    Q  
Sbjct: 66  IDEDAEIVVQEEQLGTAHAVAQTRDALSDFDGDIVVLYGDTPFVSAETLQR-MLAARQSA 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            + V+GF A +P  YGRLL+  N +  I E  DAT+ ER+I +CNSGLMA +   +   +
Sbjct: 125 DLVVLGFTAADPARYGRLLMDGNSLERIVEYKDATEAEREIDFCNSGLMAGNAAQMFALI 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
            Q+     S EYYLTD++E AR DG  + ++   E E  G N+R +L+  + ++Q R R 
Sbjct: 185 DQVDSANASGEYYLTDLVELARADGLQVTAVSCDEAETLGINSRADLAEADRVFQQRKRA 244

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
            +M  GVT++ PETV+L+ DT+I  DT+IEP+V FG  V++E+ V IR+FS+ EG HI +
Sbjct: 245 DLMADGVTLMDPETVYLAFDTVIGRDTIIEPNVVFGPEVTVESGVFIRSFSHFEGCHISR 304

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
            + +GP+AR+R    + +N  IGNF E+K A I EG+K+NHLSY+GD+ VG   NIGAGT
Sbjct: 305 GSKVGPYARLRPGAELAENTHIGNFVEIKNAEIAEGAKVNHLSYIGDASVGAETNIGAGT 364

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           ITCNYDG  K++T I   AFIGSN+ L+AP+ IG     A+G+++T+   + +L  AR+ 
Sbjct: 365 ITCNYDGVMKHRTEIGARAFIGSNTMLVAPVRIGDEAMTATGAVVTKSVEDGALAIARAE 424

Query: 428 Q 428
           Q
Sbjct: 425 Q 425


>gi|260434195|ref|ZP_05788166.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260418023|gb|EEX11282.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 450

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 183/421 (43%), Positives = 272/421 (64%), Gaps = 1/421 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  IA  PM+ H M   +    E   +V G+G++ + ++   
Sbjct: 6   VILAAGKGTRMNSDIPKVLHPIAQVPMLVHAMRAGSVLAPERTVIVTGHGSQAVAKVAQA 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
                   +QD Q GTAHAV  A+ A+     DV+++YGD P +   TL++ +   A   
Sbjct: 66  EDEDARIVVQDQQLGTAHAVAQARAALDGFTGDVVVLYGDTPFLQPDTLERMIAARADN- 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            + ++GF A +P  YGRL++  + +  I E  DA+DEER I +CNSGL+A D   + D +
Sbjct: 125 DLVILGFEAADPARYGRLVMNGDALERIVEFKDASDEERAITFCNSGLLACDAGTLFDLI 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
             +  +  S EYYLTD++E AR  G  + ++   E +  G N+R +L+  + ++Q+R R 
Sbjct: 185 DAVGNDNASGEYYLTDVVEIARDRGLKVTAVSCDEAQTLGVNSRADLAAADAVFQARARA 244

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
           +++  GVT++APETVFL+ DT+I  DTVIEP+V FG GV++E+   IRAFS+LEG H+ +
Sbjct: 245 ELLDLGVTLMAPETVFLAADTVIGRDTVIEPNVVFGPGVTVESGATIRAFSHLEGCHVSR 304

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
             ++GP+AR+R    + +N RIGNF E+K A I EG+K+NHLSYVGD+ VG   NIGAGT
Sbjct: 305 GAVVGPYARLRPGAELAENTRIGNFVEIKNAEIAEGAKVNHLSYVGDASVGAGTNIGAGT 364

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           ITCNYDG  K++T I EN F+GSN+ L+AP+T+G G   A+G+I+T+D   ++L   R++
Sbjct: 365 ITCNYDGVMKHRTVIGENVFVGSNTMLVAPVTVGSGAMTATGTIVTRDVEPDALAVGRAK 424

Query: 428 Q 428
           Q
Sbjct: 425 Q 425


>gi|40063646|gb|AAR38435.1| UDP-N-acetylglucosamine pyrophosphorylase, putative [uncultured
           marine bacterium 582]
          Length = 451

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 188/439 (42%), Positives = 280/439 (63%), Gaps = 5/439 (1%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM+S   KVL  +AG PM+ HVM + A    E + ++ G+GA+ +  +   
Sbjct: 6   IILAAGKGTRMESDLPKVLHHLAGAPMLLHVMSSSATLEPERLVIIAGHGADAVGAVARD 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
            + + +  +Q  Q GT HAV  A+ A+     DVI++YGD P V   TL+ A+    +  
Sbjct: 66  YSETAQVVLQSEQLGTGHAVSQAKSALADCTGDVIVLYGDTPFVRPETLQ-ALLAARKTA 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I V+GF A N   YGRL+++ + +  I E  DA+++ER I +CNSG++      +   L
Sbjct: 125 DIVVLGFQAANAGRYGRLVMQGSAVSRIVEYKDASEQERAITFCNSGVICAKADVLFSLL 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
             +  +  S+EYYLTDI++ A     S+A++   E E  G N+R EL+  E  +QSR R 
Sbjct: 185 EAVGNDNASKEYYLTDIVQLANDRNLSVAAVHCDEAETMGINSRAELAQAEASFQSRTRM 244

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
           +MM  GV++ APETV+ ++DT++  D+ +EP+V FG GV++EN  +IRAFS+LEG HI  
Sbjct: 245 EMMALGVSLTAPETVYFAYDTVLGRDSQVEPNVVFGPGVTVENGARIRAFSHLEGCHISS 304

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
             ++GP+AR+R  T + +NVRIGNF E+K A I++G+K+NHLSY+GD+ +G+  NIGAGT
Sbjct: 305 GAVVGPYARLRPGTELAENVRIGNFVEIKNARIEDGAKVNHLSYIGDANIGEASNIGAGT 364

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           +TCNYDG  K+ T I  + FIGSN+ L+AP+T+G     ASGS+IT++    +L  ARS 
Sbjct: 365 VTCNYDGVGKHHTEIGASVFIGSNTMLVAPVTVGDAAMTASGSVITKNVEPGALAIARSE 424

Query: 428 QIVKEDGALS----MRKKK 442
           Q  K   A+     +R+KK
Sbjct: 425 QSNKPGLAVKLFAMLRRKK 443


>gi|188583826|ref|YP_001927271.1| UDP-N-acetylglucosamine pyrophosphorylase [Methylobacterium populi
           BJ001]
 gi|179347324|gb|ACB82736.1| UDP-N-acetylglucosamine pyrophosphorylase [Methylobacterium populi
           BJ001]
          Length = 478

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 192/436 (44%), Positives = 280/436 (64%), Gaps = 5/436 (1%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRI-- 64
           A+VLAAG+G RM+S   KVL  +A + M+ HV+  +  AG   +A+V+  G +E+ R   
Sbjct: 26  AVVLAAGKGTRMRSDRPKVLHALANRSMLGHVLVAVQEAGASRLAVVVEPGRDEVVREIE 85

Query: 65  NFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIA 124
              P  SV  + Q  + GTAHAVL A+ A++ G D V++ +GD PLV++ T  +    + 
Sbjct: 86  RLAPGASV--HPQAERLGTAHAVLAARAALEAGRD-VVVAFGDTPLVTAETFARLRAPLR 142

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
           +G ++AV+ F A +P GYGR+L ++  ++AIREE DA+ EER +   N+GLMA+ G + +
Sbjct: 143 EGAAVAVLAFEAVDPTGYGRVLTESGRVLAIREEKDASQEERAVRLSNAGLMALSGAHAL 202

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSR 244
             L +I  +  ++EYYLTD +  A  DG S+A + V E E  G N+R +L   E   Q+R
Sbjct: 203 SLLERIGNDNANREYYLTDAVALAVADGLSVAVVPVDEWEAQGVNDRVQLGHAEATIQAR 262

Query: 245 YRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVH 304
            RR   + G T+IAPETVFLS DT++  D V+EPH  FG GV + +   IRAFS+L    
Sbjct: 263 LRRAAQLGGATLIAPETVFLSVDTVLGRDVVVEPHCVFGPGVVVGDGCTIRAFSHLHDAR 322

Query: 305 IGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIG 364
           + +   IGP  R+R    +E  V +GNF E+K AT+  G+K +HL+Y+GD+ VG   NIG
Sbjct: 323 LMQGADIGPHVRLRGGAVLEAGVHLGNFVEIKNATLHAGAKASHLTYLGDAEVGAGANIG 382

Query: 365 AGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFA 424
           AGTITCNYDG  K++T I   AFIGSNS+L+AP+++G G  V +GS+IT+D P ++L  A
Sbjct: 383 AGTITCNYDGVSKHRTTIGAGAFIGSNSALVAPVSVGAGALVGAGSVITRDVPGDALAVA 442

Query: 425 RSRQIVKEDGALSMRK 440
           R RQ+ +E  A ++R+
Sbjct: 443 RGRQLTREGAAKALRE 458


>gi|163738783|ref|ZP_02146197.1| UDP-N-acetylglucosamine diphosphorylase [Phaeobacter gallaeciensis
           BS107]
 gi|161388111|gb|EDQ12466.1| UDP-N-acetylglucosamine diphosphorylase [Phaeobacter gallaeciensis
           BS107]
          Length = 451

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 182/421 (43%), Positives = 265/421 (62%), Gaps = 1/421 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  IA  PM+ H +    A   E   +V G+GA+ +  +   
Sbjct: 6   VILAAGKGTRMNSDLPKVLHPIAHAPMLEHALSAGRALTPERTIVVAGHGADYVRSMMAD 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
                E  +Q+ Q GTAHAV   +DA+     D++++YGD P VS+ TL++ M    Q  
Sbjct: 66  IDEDAEIVVQEEQLGTAHAVAQTRDALSDFDGDIVVLYGDTPFVSAETLQR-MLAARQSA 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            + V+GF A +P  YGRLL+  N +  I E  DAT+ ER+I +CNSGLMA +   +   +
Sbjct: 125 DLVVLGFTATDPARYGRLLMDGNSLERIVEYKDATEAEREIDFCNSGLMAGNAAQMFALI 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
            Q+     S EYYLTD++E AR DG  + ++   E E  G N+R +L+  + ++Q R R 
Sbjct: 185 DQVDSANASGEYYLTDLVELARADGLQVTAVSCDEAETLGINSRADLAEADRVFQQRKRA 244

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
            +M  GVT++ P+TV+L+ DT+I  DT+IEP+V FG  V++E+ V IR+FS+ EG HI +
Sbjct: 245 DLMADGVTLMDPKTVYLAFDTVIGRDTIIEPNVVFGPEVTVESGVFIRSFSHFEGCHISR 304

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
            + +GP+AR+R    + +N  IGNF E+K A I EG+K+NHLSY+GD+ VG   NIGAGT
Sbjct: 305 GSKVGPYARLRPGAELAENTHIGNFVEIKNAEIAEGAKVNHLSYIGDASVGAETNIGAGT 364

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           ITCNYDG  K++T I   AFIGSN+ L+AP+ IG     A+G+++T+   + +L  AR+ 
Sbjct: 365 ITCNYDGVMKHRTEIGARAFIGSNTMLVAPVRIGDEAMTATGAVVTKSVEDGALAIARAE 424

Query: 428 Q 428
           Q
Sbjct: 425 Q 425


>gi|83945636|ref|ZP_00957982.1| UDP-N-acetylglucosamine pyrophosphorylase [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851002|gb|EAP88861.1| UDP-N-acetylglucosamine pyrophosphorylase [Oceanicaulis alexandrii
           HTCC2633]
          Length = 452

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 191/440 (43%), Positives = 270/440 (61%), Gaps = 5/440 (1%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R R A++LAAG G RMKS  +K L  I G+ M+   +    A   E   +V G  A E+ 
Sbjct: 4   RPRAAVILAAGHGKRMKSDLAKPLHPIGGRSMLDWSLALADAVQAERKVVVWGAHAPEVK 63

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
             +          +QD  QGT HAV  AQDA+K    DVI++Y D PL+++ T+++    
Sbjct: 64  --DKAEAAGALTALQDPPQGTGHAVQQAQDALKDFDGDVIVLYADTPLITAETVEQVFAA 121

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNE--IIAIREENDATDEERKIHYCNSGLMAIDG 180
           +  G +++V+GF    P GYGRL I+N    + AI E  DA+ E+  +  CNSG++A+  
Sbjct: 122 LDAGAAVSVLGFEPREPGGYGRL-IENASGGLDAIVEAKDASPEQLMVGLCNSGVLAMPS 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
             + + L ++     S EYYLTD++  AR       ++     EV G N+R +L+  E+ 
Sbjct: 181 GLMFELLGEVTNENASGEYYLTDLVGLARGRDLPAKAVKASADEVLGVNSRVDLAAAEHA 240

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           +Q R R Q M+ GVT+IAPETV+ SHDT+I+ D V+EPHV FG GV I    +IRA S+L
Sbjct: 241 FQQRARHQAMVDGVTLIAPETVYFSHDTMIENDVVVEPHVVFGPGVVIRTGARIRAHSHL 300

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EG  +     +GP+AR+R    ++   ++GNF EVKKA + EG+K NHLSY+GD+ VG N
Sbjct: 301 EGADVAGGCEVGPYARLRPGAVLKTGAKVGNFVEVKKAVMGEGAKANHLSYIGDATVGAN 360

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
            NIGAGTITCNYDG  KY+T I E AFIGSNS+L+AP+TIG G    SGS+IT++ P ++
Sbjct: 361 ANIGAGTITCNYDGFLKYQTVIGEGAFIGSNSALVAPVTIGDGAMTGSGSVITENVPADA 420

Query: 421 LVFARSRQIVKEDGALSMRK 440
           L  +R++Q  K+  A   R+
Sbjct: 421 LAVSRAKQTNKDGWAARFRR 440


>gi|99080569|ref|YP_612723.1| UDP-N-acetylglucosamine pyrophosphorylase / glucosamine-1-phosphate
           N-acetyltransferase [Ruegeria sp. TM1040]
 gi|119370596|sp|Q1GIQ5|GLMU_SILST RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|99036849|gb|ABF63461.1| UDP-N-acetylglucosamine pyrophosphorylase / glucosamine-1-phosphate
           N-acetyltransferase [Ruegeria sp. TM1040]
          Length = 449

 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 182/424 (42%), Positives = 269/424 (63%), Gaps = 1/424 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL +IA  PM+ H M    A   E   +V G+ AE +      
Sbjct: 6   VILAAGKGTRMNSDLPKVLHQIAHAPMLEHAMRAGGALDPERTVVVAGHEAEMVRAATAE 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
                   +Q+ Q GT HAVL A+ A++    DV+++YGD P VS+ TL++ ++  ++  
Sbjct: 66  IAPEATVVLQEEQLGTGHAVLQARAALEGFRGDVVVLYGDTPFVSAETLERMIEARSRA- 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            + ++GF A +P  YGRL+++   +  I E  DA+D ER I +CNSGLMA +   +   L
Sbjct: 125 DLVILGFEAADPARYGRLIMQGESLEKIVEFKDASDAERAITFCNSGLMACNAEVMFGLL 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
            Q+  +  S EYYLTD++E AR +G S+ ++   E E  G N+R +L+  E ++Q+  R 
Sbjct: 185 DQVGNDNASGEYYLTDLVELARAEGLSVTAVSCPEAETLGINSRADLAAAEAVFQAHARA 244

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
           +++  GVT+ APETV L+ DTII  DTVIEP+V FG GV++E+   IRAFS+LEG H+ +
Sbjct: 245 ELLDIGVTLTAPETVHLAFDTIIGRDTVIEPNVVFGPGVTVESGALIRAFSHLEGCHVSR 304

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
              +GP+AR+R    + ++  +GNF E+K A I  G+K+NHL+Y+GD+ VG+  NIGAGT
Sbjct: 305 GAKVGPYARLRPGAELAEDTHVGNFVEIKNAEIAAGAKVNHLTYIGDASVGEATNIGAGT 364

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           ITCNYDG  K++T I   AFIGSN+ L+AP+T+G     A+G++IT+D  +  L  AR +
Sbjct: 365 ITCNYDGVMKHRTEIGARAFIGSNTCLVAPVTVGDEAMTATGAVITKDVADGDLAIARVQ 424

Query: 428 QIVK 431
           Q  K
Sbjct: 425 QTNK 428


>gi|83953928|ref|ZP_00962649.1| UDP-N-acetylglucosamine pyrophosphorylase [Sulfitobacter sp.
           NAS-14.1]
 gi|83841873|gb|EAP81042.1| UDP-N-acetylglucosamine pyrophosphorylase [Sulfitobacter sp.
           NAS-14.1]
          Length = 450

 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 194/438 (44%), Positives = 273/438 (62%), Gaps = 4/438 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM+S   KVL  +A  P++ H M + AA       +V G+GA+++      
Sbjct: 6   ILLAAGKGTRMQSDLPKVLHAVAHAPLLEHAMASGAALSPARTVVVAGHGADQVRAAAQA 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
                +  +Q+ Q GTAHAV  A++A+       I++YGD P V + TL+  M    +  
Sbjct: 66  FDDEAQVVVQEEQLGTAHAVGQAREALAGFGGTAIVLYGDTPFVQTETLEN-MCAALETN 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            + V+GF+A +P  YGRL+++ + +  I E  DATDEER I  CNSG++A     + D +
Sbjct: 125 DVVVLGFDAADPARYGRLVMQGDSLDRIVEYKDATDEERAITLCNSGVVACKSDLLFDLI 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
             +  +  S+EYYLTDII  AR  G    ++   E E  G N+R +L+  +  +QSR R 
Sbjct: 185 DAVGNDNASEEYYLTDIIGIARERGLKATAVTCDEAETMGVNSRADLAAADAAFQSRARA 244

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
            M+  G+T++AP+TV+ + DT I  DTVIEP+V FG GV+IE+   IRAFS+LEG H+ +
Sbjct: 245 AMLEDGITLMAPDTVYFARDTYIGRDTVIEPNVVFGPGVTIESGATIRAFSHLEGCHVAR 304

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
             +IGP+AR+R    + ++VRIGNF EVK A I EG+K+NHLSY+GD+ +G   NIGAGT
Sbjct: 305 GGVIGPYARLRPGAELSEDVRIGNFVEVKNAQIAEGAKVNHLSYIGDATIGAKANIGAGT 364

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           ITCNYDG  K+ THI  NAFIGSN+ L+AP+ IG G    SGS+IT D   ++L  AR+ 
Sbjct: 365 ITCNYDGVMKHHTHIGANAFIGSNTMLVAPVHIGDGAMTGSGSVITSDVEADALALARAH 424

Query: 428 QIVKEDGA---LSMRKKK 442
           Q+ K   A   L M K K
Sbjct: 425 QVEKPGMARKLLEMLKAK 442


>gi|94495579|ref|ZP_01302159.1| UDP-N-acetylglucosamine diphosphorylase [Sphingomonas sp. SKA58]
 gi|94424967|gb|EAT09988.1| UDP-N-acetylglucosamine diphosphorylase [Sphingomonas sp. SKA58]
          Length = 477

 Score =  375 bits (962), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 196/447 (43%), Positives = 272/447 (60%), Gaps = 18/447 (4%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R    I+LAAG+G RMKSS  KVL  +AG+PM+ H++ + A    +   +V+G G +++ 
Sbjct: 33  RPLAVIILAAGQGTRMKSSLHKVLHPVAGRPMLLHLLASAAQLSPQRQVVVVGAGRDQVE 92

Query: 63  RINFPPTLSVE-----YYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLK 117
           R       +VE       +QD Q GT HAV  A DA+     DV+I+YGDVPLV + T++
Sbjct: 93  R-------AVEGTGAIVAVQDQQLGTGHAVAQAHDALAGFAGDVLILYGDVPLVCADTMR 145

Query: 118 KAMDKIAQG--YSIAVVGFNADNPKGYGRLLIKNNEII-AIREENDATDEERKIHYCNSG 174
             +D++ +G      V+GF  DN   YGR++     II  + E  DA + ER +  CNSG
Sbjct: 146 AMLDRLNRGDEPRAVVLGFRPDNAAAYGRIIADGQGIIEKMVEYKDADEAERAVTLCNSG 205

Query: 175 LMAIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYEL 234
           LMA+    +   L  I  +  + EYYL DI+    L G   A I+    EV G N+R EL
Sbjct: 206 LMAVRSTDLFVLLDAIGNDNAAGEYYLPDIV---MLPGGQSAVIETDAWEVAGVNSRAEL 262

Query: 235 SLIENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQI 294
           + +E +WQ+R R   M  GVT++APETVF SHDT++  D V+EP+V FG GV+I + V I
Sbjct: 263 AGVEALWQARRRADAMRDGVTLVAPETVFFSHDTLLGRDVVVEPNVVFGPGVTIADNVII 322

Query: 295 RAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGD 354
            AFS+LEG  +     +GP+AR+R    I    ++GNF E+K+AT+ EG+K NHLSY+GD
Sbjct: 323 HAFSHLEGASVDSGAAVGPYARLRPGAQIGAKAKVGNFVEIKQATLGEGAKANHLSYIGD 382

Query: 355 SVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQ 414
           + VG   NIGAGTITCNYDG  KY+T I   AFIGSNS+L+AP +IG G  VA+GS++T+
Sbjct: 383 ASVGAGANIGAGTITCNYDGYFKYRTEIGAGAFIGSNSALVAPASIGAGAIVAAGSVVTR 442

Query: 415 DTPENSLVFARSRQIVKEDGALSMRKK 441
               +SL   R  Q+ K   A   R++
Sbjct: 443 PVEPDSLCLVRPEQVGKTGWAARFRER 469


>gi|329850319|ref|ZP_08265164.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Asticcacaulis biprosthecum C19]
 gi|328840634|gb|EGF90205.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Asticcacaulis biprosthecum C19]
          Length = 464

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 196/438 (44%), Positives = 264/438 (60%), Gaps = 1/438 (0%)

Query: 5   RLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRI 64
           R A++LAAG+G RMKS   KVL KI G+ M+   ++     G E V +V+G  +  +   
Sbjct: 9   RAAVILAAGQGTRMKSPVPKVLHKIGGRTMLDRAIDAAFEVGCERVIVVVGGHSPSVRAT 68

Query: 65  NFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIA 124
                 +    +QD  QGT HAV  A+DA+K     VI+ YGD PL+++  L+     +A
Sbjct: 69  AEKRVGAANIVVQDPPQGTGHAVNVARDALKDFDGTVIVTYGDSPLMAAKVLEPVF-TLA 127

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
               IAV+GF A +P  YGRL++  + +  I E  +A+ E+  I  CNSG++A D   + 
Sbjct: 128 AAADIAVLGFVAHDPGAYGRLVLDGDRLDEIVEAREASKEQFAIRACNSGVLACDRELLF 187

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSR 244
             L  +K      EYYLTDI+  AR  G        +E EV G N++ EL++IE +WQ  
Sbjct: 188 SLLSDVKNENSKGEYYLTDIVGLARGRGLQPWVTMAQEHEVLGANSQAELAVIEKVWQDG 247

Query: 245 YRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVH 304
            RR  M +GV M APETVF S DT ++   VIEP+V FG GV +     IRAFS+LEG  
Sbjct: 248 VRRGFMDNGVHMPAPETVFFSWDTQVEAGVVIEPNVVFGDGVHVALGAVIRAFSHLEGCK 307

Query: 305 IGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIG 364
           +G+  +IGP+AR+R    I K+  IGNF EVK  T+ EG+K NHLSY+GD  VG   NIG
Sbjct: 308 VGEGALIGPYARLRPGADIGKDAHIGNFVEVKNVTVGEGAKANHLSYLGDGSVGAGANIG 367

Query: 365 AGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFA 424
           AGTI CNYDG  K++T + E AFIGSNSSL+AP+TIG G    SGS+ITQD P ++L   
Sbjct: 368 AGTIFCNYDGFFKHRTVVGERAFIGSNSSLVAPVTIGHGAITGSGSVITQDVPPDALALT 427

Query: 425 RSRQIVKEDGALSMRKKK 442
           R+ Q+ KE  A   R++K
Sbjct: 428 RAPQVAKESWAAVFRERK 445


>gi|315498529|ref|YP_004087333.1| UDP-N-acetylglucosamine pyrophosphorylase [Asticcacaulis
           excentricus CB 48]
 gi|315416541|gb|ADU13182.1| UDP-N-acetylglucosamine pyrophosphorylase [Asticcacaulis
           excentricus CB 48]
          Length = 454

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 194/441 (43%), Positives = 274/441 (62%), Gaps = 2/441 (0%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           RKR AI+LAAG+G RMKS   KVL ++AG+ M+   ++       E + +V+G  + ++ 
Sbjct: 5   RKRAAIILAAGQGTRMKSPLPKVLHRVAGRAMMDLAIDAAEGLDCERIVVVVGAHSPQVG 64

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                   +    +QD   GT HAVL A+ A+      V++ Y D PL+ + TLK   D 
Sbjct: 65  DSARQRLGADNVVVQDPPLGTGHAVLAAKVALSDFEGQVVVSYADCPLIDTQTLKTVFD- 123

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKN-NEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
           +A    +AV+GF A +P  YGRL+I+  + + AI E  +AT ++  I  CNSG++A D  
Sbjct: 124 LADKADLAVLGFEAADPGAYGRLVIEGADNLSAIVEAKEATAQQLAIRACNSGVLAADRA 183

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIW 241
            +   L +++ +    EYYLTD++  A+  G       V E++V G N++ EL+  E IW
Sbjct: 184 TLFSLLDEVRNDNAKGEYYLTDVVGIAKARGLKPKVCFVGEEDVTGVNSQVELAAAEAIW 243

Query: 242 QSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLE 301
           QSR R+ +M++GVTM APETVFLS DT I P  V+EP+V F  GVS+ +   IRAFS+LE
Sbjct: 244 QSRCRKTLMLNGVTMPAPETVFLSWDTQIAPGVVVEPNVVFAEGVSVASGAVIRAFSHLE 303

Query: 302 GVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNV 361
           G  + +  +IGP+AR+R    I K+V IGNF EVK   I EG+K NHLSY+GD  VG   
Sbjct: 304 GACVAEGALIGPYARLRPGADIGKDVHIGNFVEVKNVRIGEGAKANHLSYLGDGEVGAKA 363

Query: 362 NIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSL 421
           NIGAGTI CNYDG  K++T I E AF+GSN+SL+AP+T+G G    SGS+IT+D P ++L
Sbjct: 364 NIGAGTIFCNYDGYFKHRTVIGEGAFVGSNASLVAPVTVGAGAITGSGSVITKDVPADAL 423

Query: 422 VFARSRQIVKEDGALSMRKKK 442
            F RS Q  K   A + R+++
Sbjct: 424 AFERSLQTEKAGWAKAFRERR 444


>gi|126740364|ref|ZP_01756052.1| UDP-N-acetylglucosamine pyrophosphorylase [Roseobacter sp.
           SK209-2-6]
 gi|126718500|gb|EBA15214.1| UDP-N-acetylglucosamine pyrophosphorylase [Roseobacter sp.
           SK209-2-6]
          Length = 451

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 180/421 (42%), Positives = 272/421 (64%), Gaps = 1/421 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  IA   ++ H +    A   E V +V G+GA+ +      
Sbjct: 6   VILAAGKGTRMNSDLPKVLHPIAHASLLEHALIAGRALDPERVIVVAGHGADAVRAAVSE 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
              + E  +Q+ Q GTAHAV  A++A++    DV+++YGD P VS+ TL++ M    +G 
Sbjct: 66  IDETAEVALQEEQLGTAHAVDQAREALQDFAGDVVVLYGDTPFVSAETLER-MVAAREGA 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            + ++GF A +P  YGRL++    +  I E  DA+ +ER+I +CNSGLMA D   + D +
Sbjct: 125 DLVILGFEAADPARYGRLVMDGTSLERIVEFKDASAQEREISFCNSGLMACDAGQMFDLI 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
            +I     S EYYLTD++E AR +G+S+ ++   E E  G N+R +L+  +  +Q++ R+
Sbjct: 185 SKIGNENASGEYYLTDLVELARAEGRSVTAVACDESETLGVNSRLDLAGADATFQAKARK 244

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
            +M  GVT++APETV+L+ DT+I  DTVIEP+V FG GV++E+   IRAFS+LEG H+ +
Sbjct: 245 SLMELGVTLMAPETVYLAFDTVIGRDTVIEPNVVFGPGVTVESGALIRAFSHLEGCHVSR 304

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
              IGP+AR+R    + ++  +GNF E+K A I  G+K+NHLSY+GD+ VG+  NIGAGT
Sbjct: 305 GAKIGPYARLRPGAELAEDTHVGNFVEIKNAEIAAGAKVNHLSYIGDASVGEKTNIGAGT 364

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           ITCNYDG  K++T I   +FIGSN+ L+API++G     A+G+++T+   +  L   R+R
Sbjct: 365 ITCNYDGVMKHRTEIGARSFIGSNTLLVAPISVGDEAMTATGTVVTRTVEDGDLAIGRTR 424

Query: 428 Q 428
           Q
Sbjct: 425 Q 425


>gi|89067778|ref|ZP_01155232.1| Glucosamine-1-phosphate N-acetyltransferase;
           UDP-N-acetylglucosamine pyrophosphorylase [Oceanicola
           granulosus HTCC2516]
 gi|89046748|gb|EAR52803.1| Glucosamine-1-phosphate N-acetyltransferase;
           UDP-N-acetylglucosamine pyrophosphorylase [Oceanicola
           granulosus HTCC2516]
          Length = 449

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 185/425 (43%), Positives = 267/425 (62%), Gaps = 1/425 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM S   KVL +IAG P++ H + + AA     V +V G+GA+ +      
Sbjct: 6   ILLAAGQGTRMNSDRPKVLHEIAGAPLLVHAIRSGAALEPARVVVVAGHGADAVRAATKA 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
                E  +Q  Q GT HAV  A++A+     D I++Y D P +   TL+ AM +  + +
Sbjct: 66  WAPEAEVVVQADQLGTGHAVAQAREALAGATGDAIVLYADTPFIRPETLE-AMREARRKH 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
           ++ V+GF A +P  YGRL+ +  E++ I E  DA+D ER I  CNSG++  D   + D +
Sbjct: 125 AVVVLGFEAADPGRYGRLVTEGEELLRIVEYKDASDAERAITLCNSGVVCADAGLLFDLV 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
            ++  +  S EYYLTDI+  AR  G S   +   E E  G N R +L+  E  +Q+R R 
Sbjct: 185 AEVGNDNASGEYYLTDIVAIARARGLSATVVRCDEAETLGVNTRAQLADAEAAFQARARA 244

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
            +   GVT++APETV+L HDT +  D VIEPHV FG GV++E+   IRAFS+LEG H+  
Sbjct: 245 ALAEDGVTLVAPETVYLGHDTAVGRDAVIEPHVVFGPGVTVESGATIRAFSHLEGCHVSA 304

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
             ++GP+AR+R    + + V++GNF E+K A++ EG+K+NHLSYVGD+ VG   N+GAGT
Sbjct: 305 GAVVGPYARLRPGAELAEGVKVGNFVEIKNASLAEGAKVNHLSYVGDAEVGARANLGAGT 364

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           ITCNYDG  K++T I   AFIGS++ L+AP+ +G G    SGS+IT+D P+ +L  AR R
Sbjct: 365 ITCNYDGVFKHRTEIGAEAFIGSSTMLVAPVRVGAGAMTGSGSVITRDVPDGALGVARGR 424

Query: 428 QIVKE 432
           Q+ K+
Sbjct: 425 QVNKD 429


>gi|254451984|ref|ZP_05065421.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Octadecabacter antarcticus 238]
 gi|198266390|gb|EDY90660.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Octadecabacter antarcticus 238]
          Length = 453

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 189/434 (43%), Positives = 272/434 (62%), Gaps = 1/434 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM S   KVL ++AG  ++ H M + +    E   +V G+GAE +      
Sbjct: 9   IILAAGKGTRMMSDVPKVLHEVAGGSLLVHAMRSGSNLEPERTVVVAGHGAEAVGAATLA 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
                   +Q  Q GTAHAV  A+DA+     DVII+YGD P + S TL   +   A   
Sbjct: 69  YDEDAIVVVQQDQLGTAHAVKQAKDALADFSGDVIILYGDTPFIQSETLDSMLTAGATA- 127

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            + V+GF A +P  YGRL++  + +  I E  DATDEER I+ CNSG+++     I D L
Sbjct: 128 DVVVLGFQAADPGRYGRLMMDGDALERIIEFKDATDEERMINLCNSGVISAKADVIFDLL 187

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
             +  +  + EYYLTDII  AR  G S   +  +E E  G N+R +L+  E  +Q R R+
Sbjct: 188 DAVSDDNAAGEYYLTDIIGIARAKGLSATVVRCEEAETMGINSRADLAAAEAAFQVRARK 247

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
             M +GV++ AP+TV+ SHDT I  DTV+EP+V F  GV++EN   IRAFS+LEG H+ +
Sbjct: 248 DAMANGVSLHAPDTVYFSHDTYIGSDTVVEPNVVFAVGVTVENNATIRAFSHLEGCHVSR 307

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
            +++GP+AR+R  T + +NV++GNF E+K A I+ G+K+NHLSY+GD+ VG+  NIGAGT
Sbjct: 308 GSVVGPYARLRPGTELAENVKVGNFVEIKNAVIEAGAKVNHLSYIGDAHVGERSNIGAGT 367

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           ITCNYDG  K++T I  + F+GSN+ L+AP+T+G  +  A+G+I+T++ PE  +   R+R
Sbjct: 368 ITCNYDGVSKHRTTIGADVFVGSNTMLVAPVTLGDESMTATGTIVTKNVPEGDMAVGRAR 427

Query: 428 QIVKEDGALSMRKK 441
           Q  K   A  M +K
Sbjct: 428 QENKPGFARRMLQK 441


>gi|84502587|ref|ZP_01000706.1| UDP-N-acetylglucosamine pyrophosphorylase [Oceanicola batsensis
           HTCC2597]
 gi|84388982|gb|EAQ01780.1| UDP-N-acetylglucosamine pyrophosphorylase [Oceanicola batsensis
           HTCC2597]
          Length = 451

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 182/424 (42%), Positives = 266/424 (62%), Gaps = 1/424 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL KI G PM+ H +      G   + +V G+G   +      
Sbjct: 6   VILAAGQGTRMNSDLPKVLHKIGGAPMLVHAIRAGETLGPGRIVVVTGHGGAAVGAAARA 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
              +VE  +QD Q GTAHAV  A++A+     DVI++YGD P +   TL++ M      +
Sbjct: 66  YQPAVEIAVQDQQLGTAHAVAQAREALAGFEGDVIVLYGDTPFIRPETLER-MQAARAAH 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            + V+GF A +P  YGRL++    +  I E  DAT++ER+I  CNSG++A D   + + +
Sbjct: 125 DVVVLGFEAADPGRYGRLVMDGQNLERIVEFKDATEDERRITLCNSGVVAADARVLFELI 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
             +  +  S EYYLTDII  AR  G S  ++   E E  G N+R EL+  E ++Q+R R 
Sbjct: 185 DGVGNDNASGEYYLTDIIGLARARGLSAGAVTCAEAETLGVNSRAELASAERLFQARMRD 244

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
           + M  GVT++APETVF ++DT++  DT IEP+V FG G S+E+   IRAFS+LEG H+ +
Sbjct: 245 EAMADGVTLVAPETVFFAYDTVVGRDTEIEPNVVFGPGASVESGATIRAFSHLEGCHVSR 304

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
             ++GP+AR+R    + ++VRIGNF E+K A +  G+KINHL+YVGD+ +G+  NIGAGT
Sbjct: 305 GAVVGPYARLRPGAELAEDVRIGNFVEIKAARVDRGAKINHLTYVGDAEIGEEANIGAGT 364

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           +TCNYDG  K+ T I   AFIGS++ L+AP+++G      SGS+IT++    +L   R+R
Sbjct: 365 VTCNYDGVMKHTTRIGARAFIGSSTMLVAPVSVGDDAMTGSGSVITENVEPGALAIGRAR 424

Query: 428 QIVK 431
           Q+ K
Sbjct: 425 QVTK 428


>gi|85706784|ref|ZP_01037876.1| UDP-N-acetylglucosamine pyrophosphorylase [Roseovarius sp. 217]
 gi|85668842|gb|EAQ23711.1| UDP-N-acetylglucosamine pyrophosphorylase [Roseovarius sp. 217]
          Length = 451

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 184/424 (43%), Positives = 264/424 (62%), Gaps = 1/424 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM S   KVL  I   PM+ H ++  A    ++V +V G+GAE +      
Sbjct: 6   IILAAGQGTRMNSELPKVLHPIGSAPMLGHAIQAGATLEPDHVIVVAGHGAEAVRAAALE 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
              + +  IQ  Q GTAHAV  A   +     D +++YGD P +   TL++ M      +
Sbjct: 66  FDETAQIVIQSEQLGTAHAVAQAAPLLANYPGDALVLYGDTPFIQPETLER-MQAARSTH 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I V+GF A +P  YGRL+   ++++ I E  DAT+ ER +  CNSG++      + D +
Sbjct: 125 DIVVLGFEAADPGRYGRLVTDGDDLLRIVEFKDATEAERALTLCNSGVVLAPAALLFDLI 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
            Q+     S EYYLTDI+  AR+ G S  ++  +E E  G N+R EL+  E  +Q+R R 
Sbjct: 185 AQVGNTNASGEYYLTDIVGLARVRGLSATAVTCEESETMGINSRAELARAEAGFQTRKRA 244

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
           + + +GVT++APETV  ++DT +  D VIEP+V FG GV+IE    IRAFS+LEG H+ +
Sbjct: 245 EALETGVTLVAPETVQFAYDTWLGRDCVIEPYVVFGPGVTIETGAHIRAFSHLEGCHVAR 304

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
             ++GP+AR+R  T + ++ RIGNF E+K A I EG+K+NHLSY+GD+ VG   NIGAGT
Sbjct: 305 GAVVGPYARLRPGTELSEHARIGNFVELKNALIGEGAKVNHLSYIGDTRVGDESNIGAGT 364

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           ITCNYDG  K++T I    FIGSN+ L+AP+T+G G    SGS+IT+D   ++L  AR+R
Sbjct: 365 ITCNYDGVSKHETVIGARVFIGSNTMLVAPVTVGDGAMTGSGSVITRDVAPDALAIARAR 424

Query: 428 QIVK 431
           Q+ K
Sbjct: 425 QVDK 428


>gi|84516751|ref|ZP_01004109.1| UDP-N-acetylglucosamine pyrophosphorylase [Loktanella vestfoldensis
           SKA53]
 gi|84509219|gb|EAQ05678.1| UDP-N-acetylglucosamine pyrophosphorylase [Loktanella vestfoldensis
           SKA53]
          Length = 452

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 191/440 (43%), Positives = 269/440 (61%), Gaps = 1/440 (0%)

Query: 2   KRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI 61
           K     I+L AG G RM S   KVL  IAG PM+ H M+           +V GY A ++
Sbjct: 5   KMANAVIILGAGLGTRMNSDLPKVLHPIAGAPMLVHAMQAAMVLDPARRVVVAGYEAAQV 64

Query: 62  TRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMD 121
            +        V   +Q  Q GT HAV  AQ A+     D +++YGD P +   TL+ AM 
Sbjct: 65  EKAALAHDPDVTVVVQAEQLGTGHAVAQAQAALADFVGDALVLYGDTPFIRPDTLE-AMM 123

Query: 122 KIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
           +  Q + I V+GF A++P  YGRL++K+ ++  I E  DAT+ ER +  CNSG++A D  
Sbjct: 124 EARQTHDIVVLGFEAEDPARYGRLILKDGQLDRIVEYKDATEAERAVTLCNSGVIAADAA 183

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIW 241
            + D +  I  +  + EYYLTDII+ AR  G +   ++  E E  G N+R+EL+  E ++
Sbjct: 184 TLFDLVAAIGNDNAAGEYYLTDIIDIARARGLTATVVECAEAETLGINSRFELAQAEALF 243

Query: 242 QSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLE 301
           Q+  R   +  GVT+IAPETV+ ++DT+I  D VIEP+V FG GV++E+   IRAFS+LE
Sbjct: 244 QNGARMTALDDGVTLIAPETVYFAYDTVIGRDAVIEPNVVFGPGVTVESGATIRAFSHLE 303

Query: 302 GVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNV 361
           G H+ +  I+GP+AR+R    + +N R+GNF EVK A I EG+K+NHLSY+GD+ +G   
Sbjct: 304 GCHVSRGAIVGPYARLRPGAELAENTRVGNFVEVKNAVIAEGAKVNHLSYIGDADIGPRS 363

Query: 362 NIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSL 421
           NIGAGTITCNYDG  K+ T I  + FIGSN+ L+AP+++G     ASGS+IT+D P   L
Sbjct: 364 NIGAGTITCNYDGVSKHHTTIGADVFIGSNTMLVAPVSVGDQGMTASGSVITRDVPAGDL 423

Query: 422 VFARSRQIVKEDGALSMRKK 441
             AR+RQ  K   A+ +  K
Sbjct: 424 AVARARQDNKAGFAVRLFDK 443


>gi|254486843|ref|ZP_05100048.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Roseobacter sp. GAI101]
 gi|214043712|gb|EEB84350.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Roseobacter sp. GAI101]
          Length = 450

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 192/424 (45%), Positives = 264/424 (62%), Gaps = 1/424 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM+S   KVL  IA  P++ H M + AA       +V G+GA+ +      
Sbjct: 6   ILLAAGKGTRMQSDLPKVLHPIAHAPLLEHAMASGAALEPARTVVVAGHGADLVRAAAQE 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
                   +QD Q GTAHAV  A+ A+       I++YGD P V S TL+ AM       
Sbjct: 66  FDEEAVVVVQDEQLGTAHAVAQARHALAGFEGTAIVLYGDTPFVQSETLE-AMCTALTNN 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            + V+GF A  P  YGRL++  + +  I E  DATDEER I  CNSG++A     + D +
Sbjct: 125 DVVVLGFEAAVPARYGRLVMDGDSLDRIVEFKDATDEERAITLCNSGVVACKSELLFDLI 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
             +  +  S+EYYLTDII  AR  G    ++   E E  G N+R +L+  +  +Q+R R 
Sbjct: 185 DAVGNDNASEEYYLTDIIGIARARGLKATAVTCIEAETMGVNSRADLAAADAAFQARTRA 244

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
           QM+ +GVT++AP+TV+ + DT I  DTVIEP+V FG GV++E+   IRAFS+LEG H+ +
Sbjct: 245 QMLETGVTLMAPDTVYFARDTYIGRDTVIEPNVVFGPGVTVESGATIRAFSHLEGCHVSR 304

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
             IIGP+AR+R    + ++VRIGNF E+K A I EG+K+NHLSY+GD+ +G   NIGAGT
Sbjct: 305 GGIIGPYARLRPGAELSEDVRIGNFVEIKNAQIAEGAKVNHLSYIGDAAIGARANIGAGT 364

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           ITCNYDG  K+ THI  NAFIGSN+ L+AP+ IG G    SGS+IT D   ++L  +R+ 
Sbjct: 365 ITCNYDGVMKHHTHIGANAFIGSNTMLVAPVHIGDGAMTGSGSVITSDVEADALALSRAP 424

Query: 428 QIVK 431
           Q+ K
Sbjct: 425 QVEK 428


>gi|260752994|ref|YP_003225887.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258552357|gb|ACV75303.1| UDP-N-acetylglucosamine pyrophosphorylase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 450

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 186/425 (43%), Positives = 279/425 (65%), Gaps = 3/425 (0%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG+G RM+S + K+L  +AG+P++  V++++A    ++  +V G G E++     
Sbjct: 9   AVILAAGKGTRMRSDTHKILHALAGRPLLGWVLDSLAPLSPDHTVVVTGSGREQVENYLK 68

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKI--A 124
              L V    Q+ Q GTAHAV  A+ A+K    D++++YGDVPLV   T+K  ++++   
Sbjct: 69  QVDLPVTSVTQEEQLGTAHAVAQAKSALKDFKGDIVVLYGDVPLVQPKTIKALLERLHHE 128

Query: 125 QGYSIAVVGFNADNPKGYGRLLI-KNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
              ++AV+ F  D+P+ YGR++  K   I  + E  DA++EER I  CNSGL+AI    +
Sbjct: 129 DKPTVAVLAFRPDDPRQYGRIVTDKTAHIQKMAEYKDASEEERAITLCNSGLLAIRAHDL 188

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQS 243
              L +++ N  S EYYL DI+  A  +G+   ++D +  EV G NNR EL+ +E++WQ+
Sbjct: 189 WPLLSRVQNNNASGEYYLPDIVMLALSEGRQAVTVDAEAWEVSGVNNRAELASLESLWQN 248

Query: 244 RYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGV 303
           R R+ +M  G ++IAPETV+ S+DT I  D +IEP VFFG  V + N V I +FS++EG 
Sbjct: 249 RKRQDVMKDGASLIAPETVWFSYDTEIGRDVIIEPQVFFGRDVKVANGVTIHSFSHIEGA 308

Query: 304 HIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNI 363
            I +   IGPFAR+R    I +  +IGNF E+KK+ +++G+K+NHL+Y+GD+ +G   NI
Sbjct: 309 DIKENVEIGPFARLRPGAEIAEKAKIGNFVEIKKSKVEKGAKVNHLTYIGDATIGAGSNI 368

Query: 364 GAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVF 423
           G GTITCNYDG +K +T I E AFIGSNS+L+AP+ IG G  +A+GS IT + P++SL  
Sbjct: 369 GGGTITCNYDGFNKSRTEIGEKAFIGSNSALVAPVRIGAGAIIAAGSTITHNVPDDSLAI 428

Query: 424 ARSRQ 428
           ARS Q
Sbjct: 429 ARSEQ 433


>gi|259418684|ref|ZP_05742601.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Silicibacter sp. TrichCH4B]
 gi|259344906|gb|EEW56760.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Silicibacter sp. TrichCH4B]
          Length = 449

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 178/424 (41%), Positives = 269/424 (63%), Gaps = 1/424 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  IA  PM+ H M    A   +   +V G+ A+ +      
Sbjct: 6   VILAAGKGTRMNSDLPKVLHPIAQAPMLEHAMRAGRALDPDRTVVVAGHEADLVRAATTE 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
                   +Q+ Q GT HAVL A+ A++    DV+++YGD P VS+ TL++ +   ++  
Sbjct: 66  IDPDAAVVLQEEQLGTGHAVLQARAALEGFQGDVVVLYGDTPFVSADTLERMIAARSRA- 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            + ++GF A +P  YGRL++    +  I E  DA++ ER I +CNSGLMA D   +   L
Sbjct: 125 DLVILGFEAADPARYGRLIMDGESLEKIVEFKDASEAERAITFCNSGLMACDADVMFRLL 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
            ++  +  S EYYLTD++E AR DG ++ ++   E E  G N+R +L+  + ++Q+R R 
Sbjct: 185 DKVGNDNASGEYYLTDLVELARADGLAVTAVACPEDETLGINSRADLATADAVFQARARA 244

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
           +++  GVT++APETV+L+ DTI+  D+VIEP+V FG GV++E+   IRAFS+LEG H+ +
Sbjct: 245 ELLDLGVTLMAPETVYLAFDTIVGRDSVIEPNVVFGPGVTVESGALIRAFSHLEGCHVSR 304

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
              IGP+AR+R    + ++  +GNF E+K A I  G+K+NHLSY+GD+ VG+  NIGAGT
Sbjct: 305 GAKIGPYARLRPGAELAEDTHVGNFVEIKNAEIAAGAKVNHLSYIGDASVGEATNIGAGT 364

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           ITCNYDG  K++T I   AFIGSN+ L+AP+ +G     A+G+I+T+D  +  L  AR++
Sbjct: 365 ITCNYDGVMKHRTEIGARAFIGSNTCLVAPVKVGDEAMTATGTIVTKDVDDGDLAIARAQ 424

Query: 428 QIVK 431
           Q  K
Sbjct: 425 QTNK 428


>gi|114797715|ref|YP_759433.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Hyphomonas neptunium ATCC 15444]
 gi|119370574|sp|Q0C4B0|GLMU_HYPNA RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|114737889|gb|ABI76014.1| UDP-N-acetylglucosamine pyrophosphorylase [Hyphomonas neptunium
           ATCC 15444]
          Length = 461

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 186/452 (41%), Positives = 276/452 (61%), Gaps = 27/452 (5%)

Query: 2   KRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI 61
           +++R A++LAAG+G RMKS   KV+  + G+PM+             ++AL    GAE I
Sbjct: 5   RKQRAAVILAAGKGTRMKSPLPKVMHAVGGRPMMDW-----------SIALARQVGAERI 53

Query: 62  TRINFP-------------PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDV 108
             +  P             P +++ Y  QD  QGT HAV  A++A++    D+ ++YGD 
Sbjct: 54  VAVVHPSQDVLIAHLGKHHPDVAIAY--QDPPQGTGHAVRCAEEALRGFEGDLAVLYGDS 111

Query: 109 PLVSSHTLKKAMDKIAQGYSIAVVGFNADNPKGYGRLLI-KNNEIIAIREENDATDEERK 167
           PLV + T++     ++    + V+GF A++P  YGRL+  ++  + AI E  +AT  + +
Sbjct: 112 PLVPAATIEDLFGTLSDKTGLGVLGFEAEDPGLYGRLITGEDGSLEAIVEAREATPFQLR 171

Query: 168 IHYCNSGLMAIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCG 227
           +  CNSG+MA     +   L ++  +    EYYLTD++  AR +G   A     E ++ G
Sbjct: 172 VRLCNSGVMAGRAADMFRLLAKVTNSNAKGEYYLTDLVGLARAEGIRCAVAVSGEDDLIG 231

Query: 228 CNNRYELSLIENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVS 287
           C+++ +L+  E I+Q + RR +M +GVTM+APETVFLSHDT I  D VIEP+V FG GV 
Sbjct: 232 CDSKADLAEAEAIFQQKRRRALMEAGVTMVAPETVFLSHDTQIGADAVIEPNVVFGPGVK 291

Query: 288 IENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKIN 347
           +    QIRAFS+LEG  +G+   +GP+AR+R  T +  NV IGNF E K   + EG+K N
Sbjct: 292 VAGGAQIRAFSHLEGAVVGEGCSVGPYARLRPGTVLAANVHIGNFVETKNTAMGEGAKAN 351

Query: 348 HLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVA 407
           HL+Y+GD  +G   NIGAGTI CNYDG  K++T + E AF+GSNS+L+AP+ IG G Y+ 
Sbjct: 352 HLAYLGDGTIGAGANIGAGTIFCNYDGFLKHQTDVGEGAFVGSNSALVAPVRIGDGAYIG 411

Query: 408 SGSIITQDTPENSLVFARSRQIVKEDGALSMR 439
           SGS+IT+D P+++L   R +QI +E  A + R
Sbjct: 412 SGSVITKDVPDDALAVGRGQQITREGWARNYR 443


>gi|163732080|ref|ZP_02139526.1| UDP-N-acetylglucosamine pyrophosphorylase, putative [Roseobacter
           litoralis Och 149]
 gi|161394378|gb|EDQ18701.1| UDP-N-acetylglucosamine pyrophosphorylase, putative [Roseobacter
           litoralis Och 149]
          Length = 450

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 186/429 (43%), Positives = 267/429 (62%), Gaps = 3/429 (0%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR 63
           K   ++LAAG+G RM S   KVL  +AG P++ H M++ A+ G  +  +V G+GAE + +
Sbjct: 2   KTALVILAAGKGTRMNSDLPKVLHPLAGAPLLVHAMQSGASLGPSHTVIVAGHGAELVRK 61

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYD-DVIIMYGDVPLVSSHTLKKAMDK 122
                  S     Q+ Q GT HA   AQ+ +K G+D  VI+++GD P VS  TL    D 
Sbjct: 62  AARSHDASAIIVEQNEQLGTGHAAKQAQEVLK-GFDGTVIVLFGDTPFVSPETLSAICDA 120

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
             +   + V+GF A++P  YGRL++   ++  I E  DA++ ER I  CNSG++A +G  
Sbjct: 121 -QRSSDVVVLGFEAEDPARYGRLVMDGTQLDRIVEFKDASEAERTITLCNSGVVACNGTL 179

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
           + D L  +  +  + E+YL DI+  AR  G   A +   E E  G N+R ELS  E  +Q
Sbjct: 180 LFDLLQAVDNDNAAGEFYLPDIVGIARARGLKAAVVTCDESETLGINSRAELSAAEAAFQ 239

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
           +R R     +GVT+ APETV  + DT++  DT+IEP+V FG GV++E+   IRAFS+LEG
Sbjct: 240 NRARADAFENGVTLPAPETVHFAFDTVVGRDTIIEPNVVFGVGVTVESGATIRAFSHLEG 299

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
            H+ + +I+GP+AR+R  T + +NVR+GNF EVK A I  G+KINHLSY+GD+ +G++ N
Sbjct: 300 CHVARGSIVGPYARLRPGTELSENVRVGNFVEVKNARIGTGTKINHLSYIGDATLGEHTN 359

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           +GAGTITCNYDG  K+ T I  + FIGSN+ L+AP+ IG      SGS+IT D    +L 
Sbjct: 360 VGAGTITCNYDGVLKHHTEIGNHVFIGSNTMLVAPVQIGDHAMTGSGSVITSDVEPEALA 419

Query: 423 FARSRQIVK 431
            +R+ QI K
Sbjct: 420 LSRAPQIEK 428


>gi|154253506|ref|YP_001414330.1| nucleotidyl transferase [Parvibaculum lavamentivorans DS-1]
 gi|171769670|sp|A7HXP0|GLMU_PARL1 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|154157456|gb|ABS64673.1| Nucleotidyl transferase [Parvibaculum lavamentivorans DS-1]
          Length = 452

 Score =  368 bits (945), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 185/425 (43%), Positives = 259/425 (60%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG+G RMKS   KVL  IAGKPM+ HV+  ++A G E   LV+G G +E+     
Sbjct: 8   AVILAAGKGTRMKSRLPKVLHPIAGKPMLGHVLSAVSALGSERPVLVVGPGMDEVATYAR 67

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQG 126
                +   +Q+ Q GT  AV  A   I      V++++GD PLV + TL     +  +G
Sbjct: 68  GLVSGLTIAVQEKQLGTGDAVRAAAPHIDKKESVVLVVFGDTPLVRAETLADMTRRCEEG 127

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
             I V+GF A +P GYGRL++  N+++ I E  DA++EERK   C  G MA+   ++   
Sbjct: 128 SDIVVLGFEAADPTGYGRLILDGNDVVRIVEHKDASEEERKNKLCFGGPMAVRAAHLPAL 187

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYR 246
           L ++       E+Y+TD +   R  G   +++   E ++ G N+R +L+  E   Q R R
Sbjct: 188 LAKLTNKNAQGEFYMTDFVAHGRAAGLVCSAVFCLEADMQGVNSRADLAAAEATMQQRLR 247

Query: 247 RQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIG 306
              M  GVTM+ P +V+LS DT    D  +  +V FG G  I N V I+AFS+LEG H+ 
Sbjct: 248 MAAMAGGVTMLDPSSVYLSMDTEFGEDVTVGQNVVFGPGCVIANGVTIKAFSHLEGAHVA 307

Query: 307 KKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAG 366
           +   IGPFARIR  + I +  RIGNF E KKA I++G+K+NHLSY+GD+ VG   NIGAG
Sbjct: 308 EGAEIGPFARIRPGSEIGRKARIGNFVETKKARIEDGAKVNHLSYIGDARVGAGANIGAG 367

Query: 367 TITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARS 426
           TITCNYDG +K+ T I   AFIGSNSSL+AP++IG G Y+ SGS++T+D   ++L  AR+
Sbjct: 368 TITCNYDGYNKFFTDIGAGAFIGSNSSLVAPVSIGDGAYLGSGSVVTKDVAADALGVARA 427

Query: 427 RQIVK 431
           RQ  K
Sbjct: 428 RQFEK 432


>gi|283856269|ref|YP_162233.2| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|94717588|sp|Q5NQ83|GLMU_ZYMMO RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|283775264|gb|AAV89122.2| UDP-N-acetylglucosamine pyrophosphorylase [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 450

 Score =  367 bits (943), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 186/425 (43%), Positives = 279/425 (65%), Gaps = 3/425 (0%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG+G RM+S + K+L  +AG+P++  V++++A    ++  +V G G E++     
Sbjct: 9   AVILAAGKGTRMRSDTHKILHALAGRPLLGWVLDSLAPLSPDHTVVVTGSGREQVENYLK 68

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKI--A 124
              L V    Q+ Q GTAHAV  A+ A+K    D++++YGDVPLV   T+K  ++++   
Sbjct: 69  QVDLPVTSVTQEEQLGTAHAVAQAKSALKDFKGDIVVLYGDVPLVQPKTIKALLERLHHE 128

Query: 125 QGYSIAVVGFNADNPKGYGRLLI-KNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
              ++AV+ F  D+P+ YGR++  K   I  + E  DA++EER I  CNSGL+AI    +
Sbjct: 129 DKPTVAVLAFRPDDPRQYGRIVTDKTAHIQKMVEYKDASEEERAITLCNSGLLAIRAHDL 188

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQS 243
              L +++ N  S EYYL DI+  A  +G+   ++D +  EV G NNR EL+ +E++WQ+
Sbjct: 189 WPLLSRVQNNNASGEYYLPDIVMLALSEGRQAVTVDAEAWEVSGVNNRAELASLESLWQN 248

Query: 244 RYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGV 303
           R R+ +M  G ++IAPETV+ S+DT I  D +IEP V+FG  V + N V I +FS++EG 
Sbjct: 249 RKRQDVMKDGASLIAPETVWFSYDTEIGRDVIIEPQVYFGRNVKVANGVTIHSFSHIEGA 308

Query: 304 HIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNI 363
            I +   IGPFAR+R    I +  +IGNF E+KK+ I++G+K+NHL+Y+GD+ +G   NI
Sbjct: 309 DIKENVEIGPFARLRPGAEIAEKAKIGNFVEIKKSKIEKGAKVNHLTYIGDATIGAGSNI 368

Query: 364 GAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVF 423
           G GTITCNYDG +K +T I E AFIGSNS+L+AP+ IG G  +A+GS IT + P++SL  
Sbjct: 369 GGGTITCNYDGFNKSRTEIGEKAFIGSNSALVAPVRIGAGAIIAAGSTITHNVPDDSLAI 428

Query: 424 ARSRQ 428
           ARS Q
Sbjct: 429 ARSEQ 433


>gi|149914564|ref|ZP_01903094.1| UDP-N-acetylglucosamine pyrophosphorylase [Roseobacter sp. AzwK-3b]
 gi|149811357|gb|EDM71192.1| UDP-N-acetylglucosamine pyrophosphorylase [Roseobacter sp. AzwK-3b]
          Length = 451

 Score =  367 bits (943), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 192/431 (44%), Positives = 269/431 (62%), Gaps = 1/431 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL ++AG P+I H M+  AA   +   +V G+GAE++ +    
Sbjct: 6   VILAAGQGTRMNSDLPKVLHEVAGAPLIVHAMKAGAALEPDRTVIVAGHGAEDVKKAALA 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
              SVE  IQ  Q+GTAHAV  A   +     D I++YGD P +S+ TL++ M K    +
Sbjct: 66  HDDSVEIAIQSEQKGTAHAVAQAAPLLAGHTGDTIVLYGDTPFISTETLER-MAKARARH 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            + V+GFNA +P  YGRL++    +  I E  DA +  R I  CNSG++A     +   +
Sbjct: 125 DVVVLGFNAADPARYGRLVMNGESLERIVEFKDADEAIRAITLCNSGVIAAQTATLFKLI 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
             +  +  S EYYLTDI+  A+  G S  +I   E E  G N+R EL+L E  +Q+R R 
Sbjct: 185 DAVGNDNASGEYYLTDIVGLAQAQGLSATAILCDEAETLGINSRSELALAEAAFQARARA 244

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
             +  GVT+IAP+TV  +HDT+I  DT+IE +V F  GV+IE+  +IRAFS+LEG H+ +
Sbjct: 245 AALEDGVTLIAPDTVHFAHDTVIGRDTLIEQNVVFRPGVTIESGARIRAFSHLEGCHVSR 304

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
             ++GP+AR+R    + ++ RIGNF E+K A I EG+K+NHLSY+GD+ +G   N+GAGT
Sbjct: 305 GAVVGPYARLRPGAELAEDTRIGNFVEIKNAIIDEGAKVNHLSYIGDAHLGAASNVGAGT 364

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           ITCNYDG  K+ T I  N FIGSN+ L+AP+TIG      SGS+IT+D PE +L  ARS 
Sbjct: 365 ITCNYDGVMKHHTEIGRNVFIGSNTMLVAPVTIGDDAMTGSGSVITRDVPEGALALARSA 424

Query: 428 QIVKEDGALSM 438
           Q+ K   A  M
Sbjct: 425 QVDKPGMARKM 435


>gi|114569521|ref|YP_756201.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase [Maricaulis
           maris MCS10]
 gi|119370578|sp|Q0AR24|GLMU_MARMM RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|114339983|gb|ABI65263.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase [Maricaulis
           maris MCS10]
          Length = 452

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 187/443 (42%), Positives = 272/443 (61%), Gaps = 3/443 (0%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M R R AI+LAAG+G RMKS + KVL K+AG+PM+   +      G  ++  V  +GA  
Sbjct: 1   MSRSRSAIILAAGQGTRMKSKTVKVLHKVAGRPMLDWAVALAGDCGASDIVTV--WGAHS 58

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
               +    L     +QD  +GT HAVL A+ A+     D I++Y D PL+++ T+ +  
Sbjct: 59  PAVRDAAEALGTRTALQDPPKGTGHAVLAARAALADLSGDAIVLYADTPLITAATVARVF 118

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLI-KNNEIIAIREENDATDEERKIHYCNSGLMAID 179
           + +  G S+AV+GF  D+P  YGRL+  +  ++  I E  DA++ ER +   NSG++A  
Sbjct: 119 EALEGGASVAVLGFEPDDPAAYGRLITNEAGDLDRIVEFKDASEAERAVGLVNSGVLAAP 178

Query: 180 GLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIEN 239
              + D L ++  +  + EYYLTD++  AR      A +     EV G N+R +L+  E 
Sbjct: 179 AELLFDLLGEVGNDNANGEYYLTDVVGLARARDLRAAVVVADADEVLGVNSRADLAEAEA 238

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSY 299
            +QSR R+ MM  GVT+IAPETVF +HDT I  D VIEP+V FG GV IE  V + A S+
Sbjct: 239 AFQSRMRQSMMADGVTLIAPETVFFAHDTQIARDVVIEPNVVFGPGVVIEEDVVVHAHSH 298

Query: 300 LEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGK 359
           + G H+ +    GPFAR+R    + +  ++GNF E+KK+ + EG+K++HL+Y+GD+ VG 
Sbjct: 299 IAGAHLKRGAHAGPFARLRPGAELGEGSKVGNFVEIKKSQLAEGAKVSHLTYIGDASVGA 358

Query: 360 NVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPEN 419
           N NIGAGTITCNYDG  K++T I +NAFIGSN+ L+AP+T+G G + A+G+I+TQD P +
Sbjct: 359 NANIGAGTITCNYDGYDKHRTVIGDNAFIGSNTCLVAPVTVGDGAFTATGTIVTQDVPAD 418

Query: 420 SLVFARSRQIVKEDGALSMRKKK 442
           +L  AR+ Q  K   A      K
Sbjct: 419 ALALARTPQTHKPGWAARFNAAK 441


>gi|254475697|ref|ZP_05089083.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Ruegeria sp. R11]
 gi|214029940|gb|EEB70775.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Ruegeria sp. R11]
          Length = 451

 Score =  366 bits (939), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 178/422 (42%), Positives = 273/422 (64%), Gaps = 3/422 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  IA  PM+ H M    +   E   +V G+GA+ +      
Sbjct: 6   VILAAGKGTRMNSDLPKVLHPIAQVPMLEHAMVAGRSLEPERTIVVAGHGADLVRAAVAE 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYD-DVIIMYGDVPLVSSHTLKKAMDKIAQG 126
              +    +Q+ Q GT HAV  A+DA+  G+D D++++YGD P +S+ T+++ +   A+ 
Sbjct: 66  IDETATVVLQEEQLGTGHAVAQAKDALS-GFDGDIVVLYGDTPFISADTIERMVAARARA 124

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
             + V+GF A +P  YGRL+++ + +  I E  DA++EER I +CNSGLMA D   ++  
Sbjct: 125 -DLVVLGFEAADPARYGRLVMRGDTLEKIVEYKDASEEERTITFCNSGLMAGDAKQMLGL 183

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYR 246
           L ++  +  + EYYLTD+   AR +G S+ ++   E E  G N+R EL+  + ++Q++ R
Sbjct: 184 LEKVGNDNAAGEYYLTDLPALARAEGLSVTAVSCDEAETLGINSRAELAKADAVFQAKAR 243

Query: 247 RQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIG 306
            +++  GVT++APETV+L+ DT+I  DTVIEP+V FG GV++E+   IRAFS+LEG H+ 
Sbjct: 244 AELLDLGVTLMAPETVYLAFDTMIGRDTVIEPNVVFGPGVTVESGALIRAFSHLEGCHVS 303

Query: 307 KKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAG 366
           +   +GP+AR+R    + ++  IGNF E+K A I EG+K+NHLSY+GD+ VG   NIGAG
Sbjct: 304 RGAKVGPYARLRPGAELAEDTHIGNFVEIKNAEIAEGAKVNHLSYIGDASVGAATNIGAG 363

Query: 367 TITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARS 426
           TITCNYDG  K++T I   AFIGSN+ LIAP+ +G     A+G+++T++  + +L   R+
Sbjct: 364 TITCNYDGVMKHRTEIGARAFIGSNTMLIAPVKVGHEAMTATGTVVTKNIEDGALALGRA 423

Query: 427 RQ 428
            Q
Sbjct: 424 EQ 425


>gi|241761040|ref|ZP_04759129.1| UDP-N-acetylglucosamine pyrophosphorylase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241374659|gb|EER64120.1| UDP-N-acetylglucosamine pyrophosphorylase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 450

 Score =  366 bits (939), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 186/425 (43%), Positives = 278/425 (65%), Gaps = 3/425 (0%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG+G RM+S + K+L  +AG+P++  V++++A    ++  +V G G E++     
Sbjct: 9   AVILAAGKGTRMRSDTHKILHALAGRPLLGWVLDSLAPLSPDHTVVVTGSGREQVENYLK 68

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKI--A 124
              L V    Q+ Q GTAHAV  A+ A+K    D++++YGDVPLV   T+K  ++++   
Sbjct: 69  QVDLPVTSVTQEEQLGTAHAVAQAKSALKDFKGDIVVLYGDVPLVQPKTIKALLERLHHE 128

Query: 125 QGYSIAVVGFNADNPKGYGRLLI-KNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
              ++AV+ F  D+P+ YGR++  K   I  + E  DA++EER I  CNSGL+AI    +
Sbjct: 129 DKPTVAVLAFRPDDPRQYGRIVTDKTAHIQKMVEYKDASEEERAITLCNSGLLAIRAHDL 188

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQS 243
              L +++ N  S EYYL DI+  A  +G    ++D +  EV G NNR EL+ +E++WQ+
Sbjct: 189 WPLLSRVQNNNASGEYYLPDIVMLALSEGCQAVTVDAEAWEVSGVNNRAELASLESLWQN 248

Query: 244 RYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGV 303
           R R+ +M  G ++IAPETV+ S+DT I  D +IEP VFFG  V + N V I +FS++EG 
Sbjct: 249 RKRQDVMKDGASLIAPETVWFSYDTEIGRDVIIEPQVFFGRDVKVANGVTIHSFSHIEGA 308

Query: 304 HIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNI 363
            I +   IGPFAR+R    I +  +IGNF E+KK+ +++G+K+NHL+Y+GD+ +G   NI
Sbjct: 309 DIKENVEIGPFARLRPGAEIAEKAKIGNFVEIKKSKVEKGAKVNHLTYIGDATIGAGSNI 368

Query: 364 GAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVF 423
           G GTITCNYDG +K +T I E AFIGSNS+L+AP+ IG G  +A+GS IT + P++SL  
Sbjct: 369 GGGTITCNYDGFNKSRTEIGEKAFIGSNSALVAPVRIGAGAIIAAGSTITHNVPDDSLAI 428

Query: 424 ARSRQ 428
           ARS Q
Sbjct: 429 ARSEQ 433


>gi|114765973|ref|ZP_01444987.1| UDP-N-acetylglucosamine pyrophosphorylase [Pelagibaca bermudensis
           HTCC2601]
 gi|114541787|gb|EAU44825.1| UDP-N-acetylglucosamine pyrophosphorylase [Roseovarius sp.
           HTCC2601]
          Length = 449

 Score =  364 bits (935), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 188/427 (44%), Positives = 264/427 (61%), Gaps = 7/427 (1%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI--TRIN 65
           I+LAAG+G RM+S   KVL +IA  PM+ H M    +       +V G+ AE +  +   
Sbjct: 6   IILAAGKGTRMESDLPKVLHRIAHAPMLWHAMRAGQSLEPARSIVVAGHEAEHVAASAQA 65

Query: 66  FPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYD-DVIIMYGDVPLVSSHTLKKAMDKIA 124
           F P   V   IQ  Q GTAHA L A   ++ G+D D I++YGD P +S  TL+  M +  
Sbjct: 66  FDPEARV--VIQSEQLGTAHAALQAGPELE-GFDGDAIVLYGDTPFISQDTLED-MARAR 121

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
             + + V+GF A +P  YGRL+ + + +I I E  DATDEER I  CNSG++A D   + 
Sbjct: 122 AEHDVVVLGFEAADPGRYGRLVTEGDALIRIVEYKDATDEERAISLCNSGVVAADAATLQ 181

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSR 244
             L ++K +  + EYYL DI+E AR  G S   +   E E  G N+R EL+  E  +Q  
Sbjct: 182 SLLAEVKNDNAAGEYYLPDIVEIARARGLSAGVVHCAEAETLGVNSRAELAGAEASFQQA 241

Query: 245 YRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVH 304
            R ++M  GVT+ APET + + DT+I  D  IEP+V FG G +IE+  +IRAFS+LEG H
Sbjct: 242 IRARLMADGVTLQAPETCWFAWDTVIGRDAEIEPNVIFGPGATIESGARIRAFSHLEGCH 301

Query: 305 IGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIG 364
           + +  I+GPFAR+R    + ++  +GNF E+K A + EG+K NHL+Y+GD+ +G+  NIG
Sbjct: 302 VSRGAIVGPFARLRPGAELAEHTHVGNFVEIKNAYLGEGAKANHLTYLGDADIGEGSNIG 361

Query: 365 AGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFA 424
           AGTITCNYDG  K++T I  NAFIGS++ L+AP+TIG G    SGS+IT D    +L   
Sbjct: 362 AGTITCNYDGVFKHRTTIGRNAFIGSDTMLVAPVTIGDGAMTGSGSVITDDVAPGALALG 421

Query: 425 RSRQIVK 431
           R++Q+ K
Sbjct: 422 RAKQVEK 428


>gi|260427641|ref|ZP_05781620.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Citreicella sp. SE45]
 gi|260422133|gb|EEX15384.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Citreicella sp. SE45]
          Length = 449

 Score =  364 bits (934), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 187/426 (43%), Positives = 263/426 (61%), Gaps = 5/426 (1%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRI--N 65
           I+LAAG+G RM+S   KVL +IA  PM+ H M    A     V +V G+ AE +T    +
Sbjct: 6   IILAAGKGTRMESDLPKVLHRIAHAPMLWHAMRAGQALEPARVVVVAGHEAEMVTASAQD 65

Query: 66  FPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQ 125
           + P   V   +Q  Q GTAHAV  A   +     D I++YGD P +S  TL+ AM +   
Sbjct: 66  YDPEARV--VLQGEQLGTAHAVAQAAPELAEFDGDAIVLYGDTPFISQDTLE-AMARARA 122

Query: 126 GYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMD 185
            + + V+GF A +P  YGRL+ + + ++ I E  DATDEER I  CNSG++A D   +  
Sbjct: 123 THDVVVLGFEAADPGRYGRLVTEGDALLRIVEFKDATDEERAITLCNSGVVAADARTLFS 182

Query: 186 WLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRY 245
            +  +  +  + EYYL DI+  AR  G S   +   E E  G N+R EL+  E  +Q   
Sbjct: 183 LIEAVGNDNAAGEYYLPDIVAIARERGLSAGVVHCAEAETLGVNSRAELAGAEASFQRAA 242

Query: 246 RRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHI 305
           R +MM  GVT  APETV+L+ DT+I  D  +EP+V FG GV+IE+  +IRAFS+LEG H+
Sbjct: 243 RARMMEDGVTFHAPETVYLAWDTVIGRDAEVEPNVIFGSGVTIESGARIRAFSHLEGCHV 302

Query: 306 GKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGA 365
            +  I+GPFAR+R    + ++  +GNF E+K A + EG+K NHL+Y+GD+ +G+  NIGA
Sbjct: 303 SRGAIVGPFARLRPGAELAEDTHVGNFVEIKNAYLGEGAKANHLTYLGDADIGEGTNIGA 362

Query: 366 GTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFAR 425
           GTITCNYDG  K++T I +NAFIGS++ L+AP+TIG G    SGS+IT D    +L   R
Sbjct: 363 GTITCNYDGVFKHRTTIGKNAFIGSDTMLVAPVTIGDGAMTGSGSVITSDVAPGALALGR 422

Query: 426 SRQIVK 431
           ++Q+ K
Sbjct: 423 AKQVDK 428


>gi|254294212|ref|YP_003060235.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Hirschia baltica ATCC 49814]
 gi|254042743|gb|ACT59538.1| UDP-N-acetylglucosamine pyrophosphorylase [Hirschia baltica ATCC
           49814]
          Length = 448

 Score =  364 bits (934), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 186/445 (41%), Positives = 275/445 (61%), Gaps = 7/445 (1%)

Query: 5   RLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRI 64
           R AI+LAAG+G RMKS++ KVL K+ G+ M++   +     G E   +V+G   E++ + 
Sbjct: 3   RAAIILAAGKGTRMKSATPKVLHKVGGRAMMAWTADLATKLGCEKTIIVVGPQFEDVHQA 62

Query: 65  NFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIA 124
                 +    +Q+ Q GTA AV  A  A+K    + I++Y D PL+    +  A   I 
Sbjct: 63  AVTLVGAENVCVQETQSGTATAVQAASSALKGFEGEAIVLYADTPLIPEEVVLGAFTSIE 122

Query: 125 QGYSIAVVGFNADNPKGYGRLLI-KNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
           +G SI+V+GF AD+P GYGRL++ ++  +  I E  DA+ EE  +  CNSG+MA     +
Sbjct: 123 EGASISVLGFEADDPGGYGRLILGEDGGLDRIVEAKDASPEEYAVRLCNSGVMAAPWPLM 182

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQS 243
            + L ++K +    EYYLTD++  AR      A++  +E +V G N+R +L+  E ++Q 
Sbjct: 183 EELLGEVKNDNAKGEYYLTDLVGLARKRSLKAAAVSCREDDVLGVNSRVQLAEAEAVFQQ 242

Query: 244 RYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGV 303
           R R + M  GV MI P TV+ S DT I  D  +EP+V FG GVSI + V I+AF + EG 
Sbjct: 243 RARIRFMEEGVGMIDPNTVYFSWDTQIGNDVFVEPNVVFGPGVSIASNVTIKAFCHFEGA 302

Query: 304 HIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNI 363
            + +  ++GP+AR+R   +I ++VR+GNF EVK  T+++GSK NHL+Y+GD VVG+N NI
Sbjct: 303 SVSEGAVLGPYARLRPGASIGEDVRVGNFVEVKNTTMEKGSKANHLAYLGDGVVGENANI 362

Query: 364 GAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVF 423
           GAGTI CNYDG  K++T + ++AF+GSNSSL+AP+ IG G  V SGS++T++     L  
Sbjct: 363 GAGTIFCNYDGYFKHRTEVGKDAFVGSNSSLVAPVKIGDGAMVGSGSVVTKNVNAGDLAL 422

Query: 424 ARSRQIVKEDGA------LSMRKKK 442
           AR +QI K   +      +S RKKK
Sbjct: 423 ARGQQITKTGWSAKFREVMSARKKK 447


>gi|103486856|ref|YP_616417.1| nucleotidyl transferase [Sphingopyxis alaskensis RB2256]
 gi|98976933|gb|ABF53084.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase [Sphingopyxis
           alaskensis RB2256]
          Length = 455

 Score =  363 bits (932), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 191/443 (43%), Positives = 270/443 (60%), Gaps = 11/443 (2%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           AIVLAAG+G RMKS   KVL  IAG+PM+ H+M ++         +V+G  A+++     
Sbjct: 11  AIVLAAGKGTRMKSDLHKVLHPIAGRPMLLHLMASVDELSPAKKVVVVGDKADQL---EA 67

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYD-DVIIMYGDVPLVSSHTLKKAMDKIAQ 125
             + + E  +Q+ Q GT HAV  A+ A+  G+D DV+I+YGDVP V + T++  +D++  
Sbjct: 68  ALSGTAELAVQEPQLGTGHAVRQAEAALS-GFDGDVLILYGDVPFVPAATMRAMLDRLGA 126

Query: 126 GYSIAVV--GFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
             + AVV   F   +P  YGR++   + ++ + E  DATD ER +  CNSGLMA     +
Sbjct: 127 SDAPAVVVLAFEPADPLQYGRVITDGDRVVKMVEHKDATDAERAVRLCNSGLMAARARDL 186

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQS 243
              L ++  +  ++E+YL DI+  A  DG+  A +     +V G N+R EL+  E  WQ+
Sbjct: 187 FALLARVTDDNAAKEFYLVDIVNIANADGRLCAVVKTDPADVGGINSRAELAAAEAQWQA 246

Query: 244 RYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGV 303
             R + M +G ++ APETV+ S DT +  D  IEP+V FG GV I +   IRAFS++EG 
Sbjct: 247 FRREEAMAAGASLRAPETVWFSWDTQLGRDVTIEPNVVFGPGVKIADGATIRAFSHIEGA 306

Query: 304 HIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNI 363
            IG    +GPFAR+R  T + +  +IGNF EVKKA +  G+K NHL+Y+GD+ VG   NI
Sbjct: 307 TIGAGCEVGPFARLRPGTVLGEKAKIGNFVEVKKAVLGAGAKANHLTYLGDATVGAGANI 366

Query: 364 GAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVF 423
           GAGTITCNYDG  K++T I E AFIGSNS+L+AP+ IG    VA+GS +T D  +  L  
Sbjct: 367 GAGTITCNYDGYFKHQTQIGERAFIGSNSALVAPVKIGADAIVAAGSTVTLDVGDGELRI 426

Query: 424 ARSRQIVKEDGA----LSMRKKK 442
            R  Q+VK   A     +MRKKK
Sbjct: 427 VRGEQLVKPGWADRFHDAMRKKK 449


>gi|119370597|sp|Q1GTD8|GLMU_SPHAL RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
          Length = 451

 Score =  363 bits (932), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 191/443 (43%), Positives = 270/443 (60%), Gaps = 11/443 (2%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           AIVLAAG+G RMKS   KVL  IAG+PM+ H+M ++         +V+G  A+++     
Sbjct: 7   AIVLAAGKGTRMKSDLHKVLHPIAGRPMLLHLMASVDELSPAKKVVVVGDKADQL---EA 63

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYD-DVIIMYGDVPLVSSHTLKKAMDKIAQ 125
             + + E  +Q+ Q GT HAV  A+ A+  G+D DV+I+YGDVP V + T++  +D++  
Sbjct: 64  ALSGTAELAVQEPQLGTGHAVRQAEAALS-GFDGDVLILYGDVPFVPAATMRAMLDRLGA 122

Query: 126 GYSIAVV--GFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
             + AVV   F   +P  YGR++   + ++ + E  DATD ER +  CNSGLMA     +
Sbjct: 123 SDAPAVVVLAFEPADPLQYGRVITDGDRVVKMVEHKDATDAERAVRLCNSGLMAARARDL 182

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQS 243
              L ++  +  ++E+YL DI+  A  DG+  A +     +V G N+R EL+  E  WQ+
Sbjct: 183 FALLARVTDDNAAKEFYLVDIVNIANADGRLCAVVKTDPADVGGINSRAELAAAEAQWQA 242

Query: 244 RYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGV 303
             R + M +G ++ APETV+ S DT +  D  IEP+V FG GV I +   IRAFS++EG 
Sbjct: 243 FRREEAMAAGASLRAPETVWFSWDTQLGRDVTIEPNVVFGPGVKIADGATIRAFSHIEGA 302

Query: 304 HIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNI 363
            IG    +GPFAR+R  T + +  +IGNF EVKKA +  G+K NHL+Y+GD+ VG   NI
Sbjct: 303 TIGAGCEVGPFARLRPGTVLGEKAKIGNFVEVKKAVLGAGAKANHLTYLGDATVGAGANI 362

Query: 364 GAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVF 423
           GAGTITCNYDG  K++T I E AFIGSNS+L+AP+ IG    VA+GS +T D  +  L  
Sbjct: 363 GAGTITCNYDGYFKHQTQIGERAFIGSNSALVAPVKIGADAIVAAGSTVTLDVGDGELRI 422

Query: 424 ARSRQIVKEDGA----LSMRKKK 442
            R  Q+VK   A     +MRKKK
Sbjct: 423 VRGEQLVKPGWADRFHDAMRKKK 445


>gi|110680484|ref|YP_683491.1| UDP-N-acetylglucosamine pyrophosphorylase, putative [Roseobacter
           denitrificans OCh 114]
 gi|119370590|sp|Q163N8|GLMU_ROSDO RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|109456600|gb|ABG32805.1| UDP-N-acetylglucosamine pyrophosphorylase, putative [Roseobacter
           denitrificans OCh 114]
          Length = 450

 Score =  363 bits (931), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 185/429 (43%), Positives = 262/429 (61%), Gaps = 3/429 (0%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR 63
           K   ++LAAG+G RM S   KVL  +AG P++ H M++ A+ G     +V G+GAE + +
Sbjct: 2   KTALVILAAGKGTRMNSDLPKVLHPLAGAPLLIHAMQSGASLGPSRTVIVAGHGAELVQK 61

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD-VIIMYGDVPLVSSHTLKKAMDK 122
                  S     Q  Q GT HA   AQDA+K G+D  V++++GD P VS  TL    D 
Sbjct: 62  AALSHDASAIIVQQTEQLGTGHAAKQAQDALK-GFDGTVVVLFGDTPFVSPDTLSAICDA 120

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
             +   + V+GF A +P  YGRL++   ++  I E  DAT+ ER I  CNSG++A +G  
Sbjct: 121 -QRSADVVVLGFEAADPARYGRLVMDGAQLDRIVEYKDATEAERAITLCNSGVVACNGTR 179

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
           + + L  +  +  + E+YL DI+  AR  G + A +   E E  G N+R ELS  E  +Q
Sbjct: 180 LFELLEAVDNDNAAGEFYLPDIVGVARARGLTAAVVTCDESETLGINSRTELSAAEAAFQ 239

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
            R R     +GVT+ AP TV  + DT++  DT+IEP+V FG GV+IE+   IRAFS+LEG
Sbjct: 240 ERARTNAFENGVTLPAPGTVHFAFDTVVGRDTLIEPNVVFGPGVTIESGATIRAFSHLEG 299

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
            H+ + +++GP+AR+R    + +NVR+GNF EVK A I  G+KINHLSY+GD+ +G+  N
Sbjct: 300 CHVARGSVVGPYARLRPGAELSENVRVGNFVEVKNARIGTGTKINHLSYIGDATLGEYTN 359

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           +GAGTITCNYDG  K+ T I  + FIGSN+ L+AP+ IG      SGS+IT D    +L 
Sbjct: 360 VGAGTITCNYDGVLKHHTEIGNHVFIGSNTMLVAPVQIGDHAMTGSGSVITSDVEPEALA 419

Query: 423 FARSRQIVK 431
            +R+ QI K
Sbjct: 420 LSRAPQIEK 428


>gi|254438657|ref|ZP_05052151.1| Nucleotidyl transferase family [Octadecabacter antarcticus 307]
 gi|198254103|gb|EDY78417.1| Nucleotidyl transferase family [Octadecabacter antarcticus 307]
          Length = 461

 Score =  362 bits (930), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 183/434 (42%), Positives = 269/434 (61%), Gaps = 1/434 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM S   KVL ++AG  ++ H M + +    E   +V GYGA+ +  +   
Sbjct: 17  IILAAGKGTRMMSDIPKVLHEVAGGSLLVHAMMSGSNLEPERTVVVAGYGADAVGAVAQA 76

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
                   IQ  Q GT HAVL A+ A+     DVII+YGD P +   TL  AM    +  
Sbjct: 77  FDEDAIVVIQQEQLGTGHAVLQARAALVDFDGDVIILYGDTPFIQPETLD-AMLAARKAS 135

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            + V+GF A +P  YGRL++  + +  I E  D+++EER I  CNSG++A     + D L
Sbjct: 136 DVVVLGFKAADPGRYGRLVMTGDTLERIVEFKDSSNEERAISLCNSGVIAARSDVLFDLL 195

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
             +  +  + EYYLTDII  AR    S   +   E E  G N+R EL+  E  +Q R R+
Sbjct: 196 DAVSNDNAAGEYYLTDIIGIARAKDLSATVVRCDEAETMGVNSRTELADAEAAFQGRARK 255

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
             M +GV++ AP+TV+ S DT I PD+++EP+V F  GV++EN   IRAFS+LEG H+ +
Sbjct: 256 DAMANGVSLRAPDTVYFSFDTYIGPDSMVEPNVVFAAGVTVENNATIRAFSHLEGCHVSR 315

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
            +++GP+AR+R  T + +NV++GNF E+K A I+ G+K+NHLSY+GD+ VG+  NIGAGT
Sbjct: 316 GSVVGPYARLRPGTELAENVKVGNFVEIKNAVIEAGAKVNHLSYIGDAHVGERSNIGAGT 375

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           ITCNYDG  K++T I  + F+GSN+ L+AP+T+G  +  A+G+I+T++ P   +   R+R
Sbjct: 376 ITCNYDGVSKHRTTIGADVFVGSNTMLVAPVTLGNESMTATGTIVTKNVPVGDMAVGRAR 435

Query: 428 QIVKEDGALSMRKK 441
           Q  K   A  M++K
Sbjct: 436 QENKTGFARRMQQK 449


>gi|89055676|ref|YP_511127.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Jannaschia sp. CCS1]
 gi|109892108|sp|Q28MG0|GLMU_JANSC RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|88865225|gb|ABD56102.1| UDP-N-acetylglucosamine pyrophosphorylase [Jannaschia sp. CCS1]
          Length = 454

 Score =  362 bits (930), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 191/442 (43%), Positives = 269/442 (60%), Gaps = 7/442 (1%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAA-AGIENVALVL--GYGAE 59
           R    IVLAAG G RM S   K L  +   P+++H   TIAA A +E   LV+  G+GA+
Sbjct: 6   RPLALIVLAAGAGTRMNSDLPKPLHTLGSAPLVAH---TIAAGASLEPARLVVITGHGAD 62

Query: 60  EITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKA 119
           E+  +            Q  Q GT HAVL A  A++    D +++YGD P  +S TL+ A
Sbjct: 63  EVEAVLQDIAPEAVTARQTPQLGTGHAVLQAAAALEGFEGDAMVLYGDSPFFTSETLQ-A 121

Query: 120 MDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAID 179
           M      + + ++GF   +P  YGRL++  + +  I E  DAT EER+I +CNSG++  D
Sbjct: 122 MRIARAAHDVVMLGFRPADPGRYGRLVMDGDTLRKIVEFKDATPEEREITFCNSGVLCAD 181

Query: 180 GLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIEN 239
              +M  L Q+  +  + EYYLTD+ E A   G +  +I   E E  G N+R EL   E 
Sbjct: 182 AATLMTLLAQLTNDNAAGEYYLTDVPELAGNAGLTATAIACDEAETIGINSRAELVRAEA 241

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSY 299
            +QS+ R  ++ +GVTM AP++V  + DT I  D VIEP+V FG  V++E+  QIRAFS+
Sbjct: 242 QFQSQRRAALIEAGVTMQAPDSVHFALDTHIGRDAVIEPYVVFGADVTVESGAQIRAFSH 301

Query: 300 LEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGK 359
           LEG HI    I+GP+AR+R    I  N ++GNF EVK A I EG+K+NHLSY+GD+ VG+
Sbjct: 302 LEGCHISAGAIVGPYARLRPGAEIGNNAKVGNFVEVKAADIAEGAKVNHLSYIGDATVGE 361

Query: 360 NVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPEN 419
             NIGAGT+TCNYDG  K++T I  +AFIGS++ L+AP+T+G G   ASGS IT+D P+ 
Sbjct: 362 RANIGAGTVTCNYDGVMKHRTDIGADAFIGSDTMLVAPVTVGAGAMTASGSTITEDVPDG 421

Query: 420 SLVFARSRQIVKEDGALSMRKK 441
           +L   R++Q+ K   A  +R +
Sbjct: 422 ALALGRAKQVNKPGLATKLRAR 443


>gi|329114700|ref|ZP_08243458.1| Bifunctional protein GlmU [Acetobacter pomorum DM001]
 gi|326695966|gb|EGE47649.1| Bifunctional protein GlmU [Acetobacter pomorum DM001]
          Length = 458

 Score =  361 bits (927), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 184/432 (42%), Positives = 276/432 (63%), Gaps = 8/432 (1%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R   A++LAAG G RMKSS  K +Q + G+PM++H++   AA   + + +V+G   EE+ 
Sbjct: 18  RPATAVLLAAGLGTRMKSSRPKAMQSLGGRPMLAHLLAN-AAEVFDRLVVVIGPDMEEVA 76

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMD- 121
            +  P        +Q  + GTAHA L A+     G  DV ++Y D PL+S+ TL + ++ 
Sbjct: 77  ELAAP----YPVVVQQERLGTAHAALQAEAWFGDG--DVAVLYADNPLISAETLNRLLEE 130

Query: 122 KIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
           +      +A++     +P  YGR++ +N  +  I E  DAT EER I  CN+G++  D +
Sbjct: 131 RRKPDVGLALLAMRPADPARYGRVVAQNGNVERIVEWADATPEERAIDLCNAGVLCADAV 190

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIW 241
               WL  ++ +    EYYLTD+++ A  D   + +++  E E+ G N+R EL+  E   
Sbjct: 191 DFRRWLHNVRNDNAKGEYYLTDVVDLAVADSVQVRAVEAAEDELRGVNSRAELAQAEAAL 250

Query: 242 QSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLE 301
           Q+R R + M +GVT++APETVFLS DT I+ D +IEP+VFFG GV++++   IRAFS+LE
Sbjct: 251 QTRLRNKAMENGVTLVAPETVFLSADTQIEADVLIEPNVFFGPGVTVQSGAVIRAFSHLE 310

Query: 302 GVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNV 361
           G  +    IIGP+ARIR+ +TI  + R+GNF E+K  T+ EGSK NHL+Y+G++ +G + 
Sbjct: 311 GCEVQANAIIGPYARIREGSTIGASARVGNFVELKATTLGEGSKANHLTYLGNTEIGSHT 370

Query: 362 NIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSL 421
           NIGAGTITCNYDG  K+ T I E AFIGS+S L+AP+TIG    VA+GS+IT++ P+ +L
Sbjct: 371 NIGAGTITCNYDGVFKHTTTIGEKAFIGSDSILVAPVTIGDNALVAAGSVITKNVPDEAL 430

Query: 422 VFARSRQIVKED 433
            F R++Q+ K +
Sbjct: 431 AFGRAQQVNKAE 442


>gi|146278053|ref|YP_001168212.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Rhodobacter sphaeroides ATCC 17025]
 gi|166226121|sp|A4WU43|GLMU_RHOS5 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|145556294|gb|ABP70907.1| UDP-N-acetylglucosamine pyrophosphorylase / glucosamine-1-phosphate
           N-acetyltransferase [Rhodobacter sphaeroides ATCC 17025]
          Length = 454

 Score =  361 bits (926), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 173/424 (40%), Positives = 262/424 (61%), Gaps = 1/424 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           IVLAAG+G RM S   KVL ++   PM+ H +    +   E V +V G+GAE++ R    
Sbjct: 9   IVLAAGQGTRMNSDLPKVLHRVGAAPMLHHALRAGQSLEPERVVVVAGHGAEQVARAARA 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
              +VE  +Q  Q GTAHAV  A   +     +V+++YGD P +   TL++ ++  A+ +
Sbjct: 69  FDETVEVVVQAEQLGTAHAVAQAAPLLADAPGEVVVLYGDTPFIRPETLERMIEMRAR-H 127

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
           ++ V+GF A +P  YGRL+ +  ++  I E  DATDEER I  CNSG++  +   +   +
Sbjct: 128 AVVVLGFEAADPGRYGRLVTRGEDLDRIVEWKDATDEERAITLCNSGVICAETHLLFSLV 187

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
            ++     + EYYLTD++  AR  G S       E E  G N R +L+  E  +Q R R 
Sbjct: 188 SEVGNANAAGEYYLTDVVALARAKGLSAGVAICDEAETLGVNTRAQLAAAEAEFQRRARA 247

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
             +  GVT+ AP+TVF + DT +  D ++ P+V FG GV++E+  +IRAF +LEG HI +
Sbjct: 248 AALEDGVTLTAPDTVFFALDTFLGRDAIVGPNVVFGPGVTVESGAEIRAFCHLEGCHISR 307

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
              +GPFAR+R    + ++V +GNF E+K A + EG K+ HL+Y+GD+ VG++ NIGAGT
Sbjct: 308 GATVGPFARLRPGAELAEDVHVGNFVEIKNAVLDEGVKVGHLTYLGDAHVGEHTNIGAGT 367

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           +TCNYDG +K++T I  +AFIGS++ L+AP+++G     ASGS+IT+D P  +L   R+R
Sbjct: 368 VTCNYDGVNKHRTEIGAHAFIGSDTMLVAPVSVGARAMTASGSVITEDVPAEALAVGRAR 427

Query: 428 QIVK 431
           Q+ K
Sbjct: 428 QVTK 431


>gi|288960461|ref|YP_003450801.1| glucosamine-1-phosphate N-acetyltransferase [Azospirillum sp. B510]
 gi|288912769|dbj|BAI74257.1| glucosamine-1-phosphate N-acetyltransferase [Azospirillum sp. B510]
          Length = 450

 Score =  359 bits (922), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 190/447 (42%), Positives = 271/447 (60%), Gaps = 10/447 (2%)

Query: 1   MKRKRLA-IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAE 59
           M  + LA ++LAAG+G RMKS   KVL ++AG+PM+ HV+  + A   ++V +V+G G +
Sbjct: 1   MAHRPLACVILAAGKGTRMKSDLPKVLHRVAGRPMVGHVLAAVKALDPDHVVVVVGPGMD 60

Query: 60  EITRINFP-PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKK 118
            +     P PT      +Q  Q+GTA AV  A   ++    DVII+YGD PLV+  TL+ 
Sbjct: 61  SVAAAVAPYPTA-----VQHEQRGTADAVRAAFGLLEGFTGDVIILYGDTPLVTPDTLRA 115

Query: 119 AMDKIAQGYSIAVV--GFNADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNSGL 175
            +    Q    AVV  G   D+P  YGRL++     +  I E  DA+++ER +  CN+GL
Sbjct: 116 LVQARRQAADPAVVVLGMRPDDPGAYGRLILNARGGLEKIVEYLDASEQERAVTLCNAGL 175

Query: 176 MAIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELS 235
           MA DG  + D +  +  +    EYYLTD+++ AR  G + A ++    EV G N+R EL+
Sbjct: 176 MAFDGARMFDLIGSVGNDNAKSEYYLTDVVQIARRAGMACAVVEAAPAEVVGVNSRAELA 235

Query: 236 LIENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIR 295
            +E + Q R R+  M +G T+I P++VFLS DT +  D V+ P  FFG GV+I + V+I+
Sbjct: 236 EVEKLLQRRLRKAAMDNGATLIDPDSVFLSVDTRLGRDVVVGPGCFFGAGVTIGDRVEIK 295

Query: 296 AFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDS 355
            + +LEGV I    +IGP+AR+R    I  +  IGNF EVK A I+ G+K NHL+Y+GD+
Sbjct: 296 PYCHLEGVRIDSGAVIGPYARLRPGAEIGADAHIGNFVEVKNAVIEPGAKANHLTYIGDA 355

Query: 356 VVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQD 415
            VG   NIGAGTITCNYDG  K++T I   AFIGSNS+L+AP+ IG G  V +GS++T  
Sbjct: 356 HVGAKANIGAGTITCNYDGFGKFRTEIGAGAFIGSNSALVAPVVIGDGAIVGAGSVVTSA 415

Query: 416 TPENSLVFARSRQIVKEDGALSMRKKK 442
              ++LV AR  Q      A   R++K
Sbjct: 416 VEADALVVARGNQKAYAGWAKRFRERK 442


>gi|294084272|ref|YP_003551030.1| UDP-N-acetylglucosamine pyrophosphorylase [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663845|gb|ADE38946.1| UDP-N-acetylglucosamine pyrophosphorylase [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 449

 Score =  358 bits (920), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 185/437 (42%), Positives = 264/437 (60%), Gaps = 5/437 (1%)

Query: 6   LAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRIN 65
           +AI+LAAG+G RMKS+  K L ++ G PM++  +    A G   +  VL   +E      
Sbjct: 4   VAIILAAGQGTRMKSALPKPLHEVGGMPMLAWSLNAAQAVGASRIVTVLPPHSETTQSW- 62

Query: 66  FPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQ 125
                 +E+ IQ+  +GT HAVL A+D +       ++M+GD PL+++ TL +    I  
Sbjct: 63  ---LGDIEFAIQENARGTGHAVLAAKDKLAGFLGVALVMFGDTPLITAATLSQLTQCIKD 119

Query: 126 GYSIAVVGFNADNPKGYGRLLI-KNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
           G  +AV+GF+A +P GYGR +  +N ++ AI E  DA D ER+I + N G+MA+    + 
Sbjct: 120 GADLAVLGFHAADPTGYGRFICAENGQLNAIIEHKDANDAERQIDFVNGGVMAVACPLLF 179

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSR 244
           D L  +  +  S E YLTDI+  A      + +    E E+ G NNR +L+ +E I QSR
Sbjct: 180 DLLDAVSDDNASGEIYLTDIVHIANARDHKVVTCKTDEAEITGVNNRADLAKVEGIIQSR 239

Query: 245 YRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVH 304
            R   +  GVTM APETVFLS D II+ D +IEPHV  G G  I     I++FS+LEG  
Sbjct: 240 LRSAALDQGVTMRAPETVFLSADAIIERDVIIEPHVVIGTGTHIGEGSIIKSFSHLEGAS 299

Query: 305 IGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIG 364
           +G   IIGP+AR+R  T     V+IGNF E K   +  G+K NHL+Y+GD+++G+  NIG
Sbjct: 300 LGPCCIIGPYARLRPGTIAGDGVKIGNFVETKNTNLAAGAKANHLTYLGDAMIGEQANIG 359

Query: 365 AGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFA 424
           AGTITCNYDGT+K+KT I + AFIGSNS+L+AP+ IG    V +GS IT D  ++++  A
Sbjct: 360 AGTITCNYDGTNKFKTLIGDGAFIGSNSALVAPVRIGANAIVGAGSTITSDVSDDAIAIA 419

Query: 425 RSRQIVKEDGALSMRKK 441
           R +Q   ++ A S R +
Sbjct: 420 RGKQKNIDNAATSFRAR 436


>gi|84686411|ref|ZP_01014305.1| UDP-N-acetylglucosamine pyrophosphorylase [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84665594|gb|EAQ12070.1| UDP-N-acetylglucosamine pyrophosphorylase [Rhodobacterales
           bacterium HTCC2654]
          Length = 450

 Score =  358 bits (918), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 181/435 (41%), Positives = 271/435 (62%), Gaps = 2/435 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM S   KVL ++ G P+ +H +   +A   + + LV G GAE ++     
Sbjct: 6   IILAAGQGKRMNSDLPKVLHELGGAPLFAHALSAGSALAPDRIVLVAGNGAEAVSAAATK 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYD-DVIIMYGDVPLVSSHTLKKAMDKIAQG 126
               +E  +Q+ + GT HAV  A+ A+  G+D D I++YGD P ++  TL+  +     G
Sbjct: 66  LDDEIEVVLQEDRLGTGHAVDQARAALA-GFDGDAIVLYGDTPFITPETLEAMIAARRGG 124

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
             + ++GF A +PK YGRL++   E+  I E NDA+DEER I  CNSG++A D   + D 
Sbjct: 125 ADVVILGFEAADPKRYGRLVMDGQELRRIVEYNDASDEERAITLCNSGVVAADCGTLFDL 184

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYR 246
           +  +     + EYYLTDI+E AR  G    ++   E E  G N+R EL+  E   Q+  R
Sbjct: 185 ISGLSNENAAGEYYLTDIVEVAREKGLRAEAVTCPEAETLGINSREELAAAEAQLQAIKR 244

Query: 247 RQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIG 306
            +   +GVT++AP+TVF +HDT I  D VIEP+V FG  V+IE+  +I+AFS+LEG H+ 
Sbjct: 245 AEAFENGVTLVAPDTVFFAHDTFIGRDAVIEPNVVFGPDVTIESGARIKAFSHLEGCHVS 304

Query: 307 KKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAG 366
              ++GPFAR+R    + +  ++GNF E+K A I EG+K+NHLSY+GD+ VG+  NIGAG
Sbjct: 305 AGAVVGPFARLRPGAELAEKAKVGNFVEIKNAQIAEGAKVNHLSYIGDATVGEAANIGAG 364

Query: 367 TITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARS 426
           TITCNYDG  K++T I   AFIGS++ L+AP+ +G     A+G+++T+D  + ++   R+
Sbjct: 365 TITCNYDGVFKHRTEIGPRAFIGSDTMLVAPVRVGADAMTATGTVVTRDIEDGAMGVGRA 424

Query: 427 RQIVKEDGALSMRKK 441
           R  VK   A+ + +K
Sbjct: 425 RMEVKPGFAVKLFEK 439


>gi|87199221|ref|YP_496478.1| UDP-N-acetylglucosamine pyrophosphorylase / glucosamine-1-phosphate
           N-acetyltransferase [Novosphingobium aromaticivorans DSM
           12444]
 gi|87134902|gb|ABD25644.1| UDP-N-acetylglucosamine pyrophosphorylase / glucosamine-1-phosphate
           N-acetyltransferase [Novosphingobium aromaticivorans DSM
           12444]
          Length = 457

 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 183/427 (42%), Positives = 265/427 (62%), Gaps = 6/427 (1%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           IVLAAG+G RMKS   KVL  IAG+PM+ H+M + A        +V G+G E++ +    
Sbjct: 14  IVLAAGKGTRMKSDLHKVLHPIAGRPMLMHLMASAAELSPARQVVVAGHGREQLEK---A 70

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKI--AQ 125
              S +  +QD Q GTAHAV  AQ A+     DV+I+YGDVP V + T++  ++++  A 
Sbjct: 71  LGGSADIAVQDPQLGTAHAVQQAQGALSGFEGDVLILYGDVPFVRASTMRAMIERLHGAD 130

Query: 126 GYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMD 185
             +  V+GF   +   YGR++  +  I+ + E  DA++ ER    CNSGLMA+    +  
Sbjct: 131 EPAAVVLGFAPADTLQYGRVIADDGRIVKMVEHKDASEAERACRVCNSGLMAVRSADLFG 190

Query: 186 WLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSR 244
            L ++  +    EYYL D++  A  DG++ A +   +  EV G N+R EL+  E  WQ R
Sbjct: 191 LLARVGNDNAQGEYYLPDVVNIAIADGRTCAVVVTDDADEVAGINSRGELAEAEGRWQQR 250

Query: 245 YRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVH 304
            R   M  G ++IAPETV+ + DT++  D  IEP+VFFG GV++ + V I AFS+LEG  
Sbjct: 251 RRAAAMADGASLIAPETVWFAWDTVLGRDVTIEPNVFFGPGVTVGDNVTIHAFSHLEGAS 310

Query: 305 IGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIG 364
           + +   +GP+AR+R    +E+ V++GNF EVK A + +G+K NHL+Y+GD+ VG   NIG
Sbjct: 311 LAQGVEVGPYARLRPGARLEEKVKVGNFVEVKNAVLHKGAKANHLTYLGDADVGAGANIG 370

Query: 365 AGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFA 424
           AGTITCNYDG  K++T I E AFIGSNS+LIAP+ IG    VA+GS +++D  +  L   
Sbjct: 371 AGTITCNYDGYFKHRTVIGERAFIGSNSALIAPVRIGADAIVAAGSAVSRDVADGELRMV 430

Query: 425 RSRQIVK 431
           R+ Q+VK
Sbjct: 431 RAEQLVK 437


>gi|119370502|sp|Q2G929|GLMU_NOVAD RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
          Length = 451

 Score =  357 bits (917), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 183/427 (42%), Positives = 265/427 (62%), Gaps = 6/427 (1%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           IVLAAG+G RMKS   KVL  IAG+PM+ H+M + A        +V G+G E++ +    
Sbjct: 8   IVLAAGKGTRMKSDLHKVLHPIAGRPMLMHLMASAAELSPARQVVVAGHGREQLEK---A 64

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKI--AQ 125
              S +  +QD Q GTAHAV  AQ A+     DV+I+YGDVP V + T++  ++++  A 
Sbjct: 65  LGGSADIAVQDPQLGTAHAVQQAQGALSGFEGDVLILYGDVPFVRASTMRAMIERLHGAD 124

Query: 126 GYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMD 185
             +  V+GF   +   YGR++  +  I+ + E  DA++ ER    CNSGLMA+    +  
Sbjct: 125 EPAAVVLGFAPADTLQYGRVIADDGRIVKMVEHKDASEAERACRVCNSGLMAVRSADLFG 184

Query: 186 WLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSR 244
            L ++  +    EYYL D++  A  DG++ A +   +  EV G N+R EL+  E  WQ R
Sbjct: 185 LLARVGNDNAQGEYYLPDVVNIAIADGRTCAVVVTDDADEVAGINSRGELAEAEGRWQQR 244

Query: 245 YRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVH 304
            R   M  G ++IAPETV+ + DT++  D  IEP+VFFG GV++ + V I AFS+LEG  
Sbjct: 245 RRAAAMADGASLIAPETVWFAWDTVLGRDVTIEPNVFFGPGVTVGDNVTIHAFSHLEGAS 304

Query: 305 IGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIG 364
           + +   +GP+AR+R    +E+ V++GNF EVK A + +G+K NHL+Y+GD+ VG   NIG
Sbjct: 305 LAQGVEVGPYARLRPGARLEEKVKVGNFVEVKNAVLHKGAKANHLTYLGDADVGAGANIG 364

Query: 365 AGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFA 424
           AGTITCNYDG  K++T I E AFIGSNS+LIAP+ IG    VA+GS +++D  +  L   
Sbjct: 365 AGTITCNYDGYFKHRTVIGERAFIGSNSALIAPVRIGADAIVAAGSAVSRDVADGELRMV 424

Query: 425 RSRQIVK 431
           R+ Q+VK
Sbjct: 425 RAEQLVK 431


>gi|295690322|ref|YP_003594015.1| UDP-N-acetylglucosamine pyrophosphorylase [Caulobacter segnis ATCC
           21756]
 gi|295432225|gb|ADG11397.1| UDP-N-acetylglucosamine pyrophosphorylase [Caulobacter segnis ATCC
           21756]
          Length = 459

 Score =  357 bits (917), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 188/445 (42%), Positives = 269/445 (60%), Gaps = 9/445 (2%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R R A++LAAG+G RMKS + KVL ++AG+ ++ H ++     G E + +V+G  + ++ 
Sbjct: 10  RPRAAVILAAGQGTRMKSPTPKVLHRLAGRTLLDHAIDAAEGLGCERIIVVVGAHSPQVG 69

Query: 63  RI---NFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYD-DVIIMYGDVPLVSSHTLKK 118
                   P  +V   +QD   GT HAVL A+DA+  G+D DV++ Y D PL ++  +  
Sbjct: 70  DAAGKRLGPNATV---VQDPPLGTGHAVLAAKDALA-GFDGDVVVTYADCPLTTAGVIAP 125

Query: 119 AMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIA-IREENDATDEERKIHYCNSGLMA 177
             D+I  G  +AV+GF A NP GYGRL++    ++  I EE +A    R++ +CNSG++A
Sbjct: 126 LFDQITGGAHVAVLGFEAHNPTGYGRLILAPGHVLLRIVEEKEADLATRQVKHCNSGVLA 185

Query: 178 IDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLI 237
            D   + D L  ++ +    EYYLTD++  A        +    E  V G N++ EL+  
Sbjct: 186 ADRAILFDLLANVRNDNAKGEYYLTDVVGLAHDRKLVTRAAFAPEASVQGVNSQAELAAA 245

Query: 238 ENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAF 297
           E +WQ   R  +MI GVTM APETV LS DT I    V+E  V FG GVS+E+   I+AF
Sbjct: 246 EAVWQKARRNALMIEGVTMPAPETVHLSWDTKIAGGAVVEQFVVFGPGVSVESNAVIKAF 305

Query: 298 SYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVV 357
           S+LEG H+G+  +IGP+AR+R    I     IGNF EVKK  + +G+K NHLSY+GD  +
Sbjct: 306 SHLEGAHVGEGALIGPYARLRPGAEIGPEAHIGNFVEVKKVKVGKGAKANHLSYLGDGSI 365

Query: 358 GKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTP 417
           G+  NIGAGTI CNYDG  K++TH+ + AFIGSNS+L+AP+ +G G    SGS+IT+D  
Sbjct: 366 GEKANIGAGTIFCNYDGFEKFETHVGKGAFIGSNSALVAPVRVGDGAMTGSGSVITKDVE 425

Query: 418 ENSLVFARSRQIVKEDGALSMRKKK 442
           + +L  AR  Q +K   A   R  K
Sbjct: 426 DGALALARPEQTIKAGWATKFRALK 450


>gi|144899335|emb|CAM76199.1| UDP-N-acetylglucosamine pyrophosphorylase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 476

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 179/425 (42%), Positives = 263/425 (61%), Gaps = 7/425 (1%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           IVLAAG G RMKS   KV+  +AG+PMI H+MET++    + V +V+G G + + +   P
Sbjct: 33  IVLAAGMGTRMKSDLPKVMHPLAGRPMIQHLMETVSGLAPDKVVVVVGPGMDVVAQAVAP 92

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK---IA 124
                +  +Q  + GT HAV+ A+D +K  + DV+++YGD PL++  TL++ + +     
Sbjct: 93  ----AQTVVQTERLGTGHAVMQARDLLKDFHGDVLVLYGDTPLITKDTLQRMLAERRNAD 148

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
           +  ++ V+GF   +P  YGRL++    + AI E  DA D++R+I  CNSG+MA DG  + 
Sbjct: 149 KNPAVVVLGFKPVDPGHYGRLVVGAEGLKAIVEFKDANDDQREIPLCNSGVMAFDGACLW 208

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSR 244
           D L +I  +    EYYLTD++  AR DG + + +   EQE+ G N+R EL+  E I Q  
Sbjct: 209 DRLARIGNDNAKGEYYLTDVVGLARGDGANCSFVLGDEQELLGVNSRAELAGAEAIIQGE 268

Query: 245 YRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVH 304
            RR  M  G T++ P +V+ S DT +  D ++ PHV FG GV+I ++V I+ F + EG  
Sbjct: 269 LRRAAMDDGATLVDPASVWFSWDTSLGRDVMVWPHVVFGPGVTIGDHVVIKGFCHFEGCT 328

Query: 305 IGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIG 364
           I     +GP+AR+R    I     IGNF EVKK+ I+ G+K+NHLSY+GD+ VG + N+G
Sbjct: 329 IADGADVGPYARLRPGAEIGAAAHIGNFVEVKKSVIEAGAKVNHLSYIGDAQVGADANVG 388

Query: 365 AGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFA 424
           AGTITCNYDG  K  T I   AFIGSNSSL+AP+ +G    + +GS+IT+D  + +L   
Sbjct: 389 AGTITCNYDGFTKSCTEIGAGAFIGSNSSLVAPVKVGARAMIGAGSVITKDVSDGALAVG 448

Query: 425 RSRQI 429
           R  Q+
Sbjct: 449 RGAQM 453


>gi|260574756|ref|ZP_05842759.1| UDP-N-acetylglucosamine pyrophosphorylase [Rhodobacter sp. SW2]
 gi|259023173|gb|EEW26466.1| UDP-N-acetylglucosamine pyrophosphorylase [Rhodobacter sp. SW2]
          Length = 454

 Score =  357 bits (915), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 179/431 (41%), Positives = 261/431 (60%), Gaps = 1/431 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           IVLAAG+G RM S   KVL ++ G P++ H +    A     V +V G+GAE +T+    
Sbjct: 10  IVLAAGQGTRMNSDLPKVLHRLGGAPLLHHALAAGRALDPARVVVVAGHGAEAVTKAART 69

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
                E  +Q  Q GTAHAV  A   +     D +++YGD P ++  TL+  ++  A+ +
Sbjct: 70  FDADAEVVVQAEQLGTAHAVAQAAKVLDGEDGDAVVLYGDTPFITGETLEALLEARAR-H 128

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            + V+GF A +P  YGRL+    ++ +I E  DATDEER I  CNSG++  D   + D +
Sbjct: 129 DVVVLGFQAADPGRYGRLIADGEDLHSIVEFKDATDEERAISLCNSGVVCADTHLLFDLV 188

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
             ++    ++EYYLTDI+  AR  G S   +   E E  G N R EL+  E  +Q+R R 
Sbjct: 189 AMVENQNAAKEYYLTDIVGLARSRGLSAGVVVCDEAETLGINTRAELAAAEAAFQTRARA 248

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
             +  GVT+ AP+TVF + DT I  D +I P+V FG GV+IE+  ++  F +LEG HI +
Sbjct: 249 TALQDGVTLTAPDTVFFALDTFIGRDAIIGPNVIFGPGVTIESGAEVLGFCHLEGCHISR 308

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
              IGPFAR+R    + ++V +GNF E+K + + EG K+ HL+Y+GD+ VG+  NIGAGT
Sbjct: 309 GATIGPFARLRPGAELAEDVHVGNFVEIKNSVLDEGVKVGHLTYLGDAHVGEFTNIGAGT 368

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           +TCNYDG  K++T I  +AFIGS++ L+AP+T+G G   ASGS+IT+D P  +L   R++
Sbjct: 369 VTCNYDGVAKHRTEIGAHAFIGSDTMLVAPVTVGAGAMTASGSVITEDVPAEALALGRAK 428

Query: 428 QIVKEDGALSM 438
           Q+ K   A  M
Sbjct: 429 QVNKPGLATRM 439


>gi|258542694|ref|YP_003188127.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Acetobacter pasteurianus IFO 3283-01]
 gi|256633772|dbj|BAH99747.1| glucosamine-1-phosphate acetyltransferase [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256636831|dbj|BAI02800.1| glucosamine-1-phosphate acetyltransferase [Acetobacter pasteurianus
           IFO 3283-03]
 gi|256639884|dbj|BAI05846.1| glucosamine-1-phosphate acetyltransferase [Acetobacter pasteurianus
           IFO 3283-07]
 gi|256642940|dbj|BAI08895.1| glucosamine-1-phosphate acetyltransferase [Acetobacter pasteurianus
           IFO 3283-22]
 gi|256645995|dbj|BAI11943.1| glucosamine-1-phosphate acetyltransferase [Acetobacter pasteurianus
           IFO 3283-26]
 gi|256649048|dbj|BAI14989.1| glucosamine-1-phosphate acetyltransferase [Acetobacter pasteurianus
           IFO 3283-32]
 gi|256652035|dbj|BAI17969.1| glucosamine-1-phosphate acetyltransferase [Acetobacter pasteurianus
           IFO 3283-01-42C]
 gi|256655092|dbj|BAI21019.1| glucosamine-1-phosphate acetyltransferase [Acetobacter pasteurianus
           IFO 3283-12]
          Length = 458

 Score =  356 bits (913), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 181/432 (41%), Positives = 274/432 (63%), Gaps = 8/432 (1%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R   A++LAAG G RMKSS  K +Q + G+PM++H++   AA   + + +V+G   EE+ 
Sbjct: 18  RPATAVLLAAGLGTRMKSSRPKAMQSLGGRPMLAHLLAN-AAEVFDRLVVVIGPDMEEVA 76

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMD- 121
            +  P        +Q  + GTAHA L A+     G  DV ++Y D PL+S+ TL + ++ 
Sbjct: 77  ELAAP----YPVVVQQERLGTAHAALQAESWFGDG--DVAVLYADNPLISAETLNRLLEE 130

Query: 122 KIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
           +      +A++     +P  YGR++ ++  +  I E  DAT EE  I  CN+G++  D +
Sbjct: 131 RRKPDVGLALLAMRPADPARYGRVVAQDGNVERIVEWADATPEEHAIDLCNAGVLCADAV 190

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIW 241
               WL  ++ +    EYYLTD+++ A  D   + +++  E E+ G N+R EL+  E   
Sbjct: 191 DFRRWLHNVRNDNAKGEYYLTDVVDLAVADNVQVRAVEAAEDELRGVNSRAELAQAEAAL 250

Query: 242 QSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLE 301
           Q+R R + M +GVT++APETVFLS DT I+ D +IEP+VFFG GV++++   IRAFS+LE
Sbjct: 251 QTRLRNKAMENGVTLVAPETVFLSADTQIEADVLIEPNVFFGPGVTVQSGAVIRAFSHLE 310

Query: 302 GVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNV 361
           G  +    IIGP+ARIR+ TTI  + R+GNF E+K  T+ EGSK NHL+Y+G++ +G   
Sbjct: 311 GCEVQANAIIGPYARIREGTTIGASARVGNFVELKATTLGEGSKANHLTYLGNAEIGSRT 370

Query: 362 NIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSL 421
           NIGAGTITCNYDG  K+ T I + AFIGS+S ++AP++IG    VA+GS+ITQ+ P+ +L
Sbjct: 371 NIGAGTITCNYDGVFKHTTTIGDKAFIGSDSIIVAPVSIGDNALVAAGSVITQNVPDEAL 430

Query: 422 VFARSRQIVKED 433
            F R++Q+ K +
Sbjct: 431 AFGRAQQVNKAE 442


>gi|46201517|ref|ZP_00208137.1| COG1207: N-acetylglucosamine-1-phosphate uridyltransferase
           (contains nucleotidyltransferase and I-patch
           acetyltransferase domains) [Magnetospirillum
           magnetotacticum MS-1]
          Length = 449

 Score =  356 bits (913), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 185/433 (42%), Positives = 271/433 (62%), Gaps = 9/433 (2%)

Query: 1   MKRKRLA-IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAE 59
           M   +LA IVLAAG G RMKSS  KV+  +AG+PM+SH+++T++    + + +V+G   E
Sbjct: 1   MASAKLAVIVLAAGMGTRMKSSLPKVMHPLAGRPMVSHLLDTVSGLAPDRMVVVVGPDME 60

Query: 60  EITRINFP-PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKK 118
            +++   P PT+     IQ  + GT HAVL A+ A+     DV+++YGD PL++  TL++
Sbjct: 61  VVSKTVAPHPTV-----IQADRLGTGHAVLQAKSALGEFDGDVLVLYGDTPLITQATLER 115

Query: 119 --AMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLM 176
             A  +  +  ++ V+GF  D+P  YGRL++    + AI E  DAT ++R+   CNSG+M
Sbjct: 116 MLAERRGPRDPAVVVLGFKPDDPGHYGRLVVGAEGLKAIVEYRDATPDQRENPLCNSGVM 175

Query: 177 AIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSL 236
           AIDG  +   + ++       EYYLTDI+  AR DG +   ++ +  E+ G N R EL++
Sbjct: 176 AIDGNRLWSLIERVDNKNSKGEYYLTDIVALARADGATCTHVEGEPSELLGVNARSELAV 235

Query: 237 IENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRA 296
            E++ Q+R R   M +G T+I P TV+ S DT I  D  I PHV FG GV++ + V+I+ 
Sbjct: 236 AESLVQARLRLAAMDNGATLIDPSTVWFSWDTRIGRDVTIWPHVVFGPGVTVGDNVEIKG 295

Query: 297 FSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSV 356
           F + EG  +      GPF+R+R    I +   IGNF EVKKAT++ G+KINHL+YVGD+ 
Sbjct: 296 FCHFEGCTVEAGVAAGPFSRLRPGAEIGEGAHIGNFVEVKKATVEAGAKINHLAYVGDAR 355

Query: 357 VGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDT 416
           VG   N+GAGTITCNYDG +K  T I   AFIGSN+SL+AP+ +G G  V +GS+IT++ 
Sbjct: 356 VGAGANVGAGTITCNYDGFNKSFTDIGAGAFIGSNTSLVAPVKVGDGAVVGAGSVITKEV 415

Query: 417 PENSLVFARSRQI 429
              +L  AR  Q+
Sbjct: 416 TPGALAVARGSQM 428


>gi|209964895|ref|YP_002297810.1| UDP-N-acetylglucosamine pyrophosphorylase [Rhodospirillum centenum
           SW]
 gi|209958361|gb|ACI98997.1| UDP-N-acetylglucosamine pyrophosphorylase [Rhodospirillum centenum
           SW]
          Length = 459

 Score =  355 bits (912), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 194/453 (42%), Positives = 280/453 (61%), Gaps = 17/453 (3%)

Query: 1   MKRKRLA-IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAE 59
           M  +RLA +VLAAG+G RMKS   KVL  +AG PM+ HV++  A+ G E + +V+G G +
Sbjct: 1   MTDRRLACVVLAAGKGTRMKSDLPKVLHPLAGVPMVRHVVDAAASLGPERIVVVVGPGMD 60

Query: 60  EITRINFP-PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYD-DVIIMYGDVPLVSSHTLK 117
            +     P PT+     +Q  QQGTA A+  A   ++ G+D DV+++YGD PL+ + TL 
Sbjct: 61  SVAAAVAPHPTV-----VQQRQQGTADALAAALPLLE-GFDGDVLVLYGDTPLIRAETLA 114

Query: 118 KAMDKI-----AQGYSIAVV--GFNADNPKGYGRLLIKNNEIIA-IREENDATDEERKIH 169
           +  +       A G   AVV  G   D+P  YGRL++  +  +A I E  DAT EER + 
Sbjct: 115 RLAEARRTPVGAAGTDPAVVVLGMRPDDPGAYGRLVLDADGGLARIVEYLDATPEERALD 174

Query: 170 YCNSGLMAIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCN 229
            CN+GLMA+DG  +   + +I       EYYLTD +  AR  G + A ++   +E  G N
Sbjct: 175 LCNAGLMALDGGRLRAIMERIGNENAKGEYYLTDAVAVARAFGWTCAVVEGATEEALGVN 234

Query: 230 NRYELSLIENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIE 289
           +R EL+ +E + Q R RR  M +G T++ P TV+ + DT +  D  +  +V FG GV++E
Sbjct: 235 SRAELAALEGLMQDRLRRAAMAAGATLVDPATVWFAADTRLGRDVTVGQNVVFGPGVTVE 294

Query: 290 NYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
           + V+I  F +L GV I +  I+GPFAR+R  + I +   IGNF EVK + +  G+K NHL
Sbjct: 295 DGVEILPFCHLTGVTIRRGAIVGPFARMRPGSEIGEGAHIGNFVEVKGSRVGPGAKANHL 354

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ VG   NIGAGTITCNYDG  K++T I    F+GSNS+L+AP+ IG G ++A G
Sbjct: 355 AYLGDTDVGAKSNIGAGTITCNYDGFLKHRTAIGAGVFVGSNSTLVAPLRIGDGAFIAGG 414

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           S+IT + P ++L F R+RQ+VKE  A+S R +K
Sbjct: 415 SVITTEVPADALAFGRTRQVVKEAWAVSYRARK 447


>gi|114771813|ref|ZP_01449206.1| UDP-N-acetylglucosamine pyrophosphorylase [alpha proteobacterium
           HTCC2255]
 gi|114547629|gb|EAU50520.1| UDP-N-acetylglucosamine pyrophosphorylase [alpha proteobacterium
           HTCC2255]
          Length = 452

 Score =  355 bits (910), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 184/441 (41%), Positives = 279/441 (63%), Gaps = 5/441 (1%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR 63
           + + I+L+AG G RM+S   KVL  +A +P++ H M T +        +V G+GA+++ +
Sbjct: 2   QSVVIILSAGMGTRMQSDLPKVLHNVACEPLLIHSMRTASQIDAHKTIVVTGHGAKDVAK 61

Query: 64  I--NFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMD 121
           +   F P  S E   Q  Q GTAHAV   ++A+     +V I+YGD P +   TL +   
Sbjct: 62  VATTFDP--SAEIVNQYEQFGTAHAVDQTRNALLNFDGEVFILYGDTPFIEPSTLLRMSK 119

Query: 122 KIAQGYSIAVVGFNADNPKGYGRLLIKNN-EIIAIREENDATDEERKIHYCNSGLMAIDG 180
           +   G  + V+GFN      YGRL+I ++  +  I E  DA  ++RKI +CNSG++  D 
Sbjct: 120 ERNDGAKVVVLGFNTKRKNSYGRLIISSDGSLEEIVEYKDANTDQRKISFCNSGVICTDS 179

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
             + + + +++ N  + EYYLTDI++ A+      A+++  E E  G N++ EL+  E  
Sbjct: 180 KLLFNLIGEVENNNANNEYYLTDIVKLAKNKNLKCAAVECAENEAMGINSKVELANAETY 239

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           +Q+R R +MM++GVT+IAPETV+ + DT++  DT+IE +V FG   ++E++  I++FS++
Sbjct: 240 FQTRKRIEMMLNGVTLIAPETVWFAADTVVGRDTIIEQNVIFGPEATVESHALIKSFSHI 299

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EG HI K  I+GPFAR+R    +  N ++GNFCEVKK+ + EG+KINHLSY+GD+ +G N
Sbjct: 300 EGAHISKGAIVGPFARLRPGAELANNSKVGNFCEVKKSQVGEGAKINHLSYIGDTKIGDN 359

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
            NIGAGTITCNYDG  K+ T I E+AFIGSN+SL+AP+ +G     ASGS+IT+D P   
Sbjct: 360 ANIGAGTITCNYDGVSKHFTEIGESAFIGSNNSLVAPVRVGDKAMTASGSVITKDVPNGD 419

Query: 421 LVFARSRQIVKEDGALSMRKK 441
           L  AR+ Q  K+  A+   K+
Sbjct: 420 LGIARAPQDNKKGFAVKFFKR 440


>gi|149201392|ref|ZP_01878367.1| UDP-N-acetylglucosamine pyrophosphorylase [Roseovarius sp. TM1035]
 gi|149145725|gb|EDM33751.1| UDP-N-acetylglucosamine pyrophosphorylase [Roseovarius sp. TM1035]
          Length = 451

 Score =  355 bits (910), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 180/422 (42%), Positives = 262/422 (62%), Gaps = 1/422 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM S   KVL  I G PM+ H M+  A    + V +V G+GAE +      
Sbjct: 6   IILAAGQGTRMNSDLPKVLHPIGGAPMLGHAMQAGATLEPDQVIVVAGHGAEAVRAAAHD 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
              + E  IQ  Q GTA+AV  A   +     D +++YGD P V   TL++ M      +
Sbjct: 66  FDETAEIVIQSEQLGTANAVAQAAPRLVDYPGDALVLYGDTPFVQPETLER-MQAARAAH 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I V+GF A +P  YGRL+++  +++ I E  DAT+ ER I  CNSG++      + D +
Sbjct: 125 DIVVLGFEAADPGRYGRLVMQGQDLVKIVEFKDATEAERAITLCNSGVVLAPAALLFDLI 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
            ++     + EYYLTDI+  AR  G S  ++   E E  G N+R EL+  E  +Q+R R 
Sbjct: 185 SEVGNANAAGEYYLTDIVGLARARGLSATAVTCDEAETMGINSRAELARAEAAFQTRKRA 244

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
           + + +GVT++AP+TV  ++DT +  D+++EP+V FG GV++E    IRAFS+LEG H+ +
Sbjct: 245 EALETGVTLVAPDTVQFAYDTWLGRDSLVEPYVVFGPGVTVETGAHIRAFSHLEGCHVAR 304

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
             ++GP+AR+R  T + ++ RIGNF EVK A I EG+K+NHLSY+GD+ VG   NIGAGT
Sbjct: 305 GAVVGPYARLRPGTELAEHSRIGNFVEVKNALIGEGAKVNHLSYIGDARVGDESNIGAGT 364

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           ITCNYDG  K++T I    F+GSN+ L+AP+T+G G    SGS+IT+D   ++L  AR+ 
Sbjct: 365 ITCNYDGVSKHETVIGARVFVGSNTMLVAPVTLGDGAMTGSGSVITRDVAPDALAIARAP 424

Query: 428 QI 429
           Q+
Sbjct: 425 QV 426


>gi|58038497|ref|YP_190461.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Gluconobacter oxydans 621H]
 gi|81557250|sp|Q5FUY6|GLMU_GLUOX RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|58000911|gb|AAW59805.1| GlmU [Gluconobacter oxydans 621H]
          Length = 444

 Score =  354 bits (909), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 177/434 (40%), Positives = 263/434 (60%), Gaps = 8/434 (1%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           AI+LAAG G RMKS   K L ++  +PMI+H++ T A    ++V +V G    E+ +   
Sbjct: 10  AIILAAGLGTRMKSRLPKALHRLGNQPMINHLI-TTARQVFDDVVVVTGPDMPELEKAVR 68

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQG 126
           P     +   Q  + GTAHA  TA+D    G  DV I+Y D PL+++ T+++ +    +G
Sbjct: 69  P----FKTVTQVERLGTAHAANTARDLF--GTGDVAILYADNPLITAETMRRLLAARREG 122

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
            S+A++G     P  YGR++  +  ++ I E  DAT++ER+I  CN+G+M         W
Sbjct: 123 ASLALLGMRPAEPGRYGRIVEDHGRVVKIVEFKDATEDERRITLCNAGVMCAGVDDFRTW 182

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYR 246
           L  +  +    EYYLTD++E A   G  +  ++  E E+ G N+R EL+  E   Q+R R
Sbjct: 183 LANVGNDNAQGEYYLTDVVEMAAKAGP-VVCVEAPEAELAGVNSRSELARAEATLQTRLR 241

Query: 247 RQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIG 306
              M +GVT++APETVF S DT+I+ D  IEP+VFFG GV + +   IRAFS+LEG  +G
Sbjct: 242 NAAMDAGVTLVAPETVFFSTDTVIEADVTIEPNVFFGPGVKVRSGALIRAFSHLEGCEVG 301

Query: 307 KKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAG 366
           +  +IGP+AR+R  T       +GNF E+K   + EG+K NHL+Y+GD+ +G   N+GAG
Sbjct: 302 ENAMIGPYARLRPGTLCAAQTHVGNFVELKNVELGEGAKANHLTYLGDASIGSGTNVGAG 361

Query: 367 TITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARS 426
           TITCNYDG  K++T I E  F+GS+S L+AP+T+G    +A+GS+IT D P   L   R+
Sbjct: 362 TITCNYDGVFKHRTTIGERVFVGSDSILVAPVTVGDDALIAAGSVITSDVPPGDLALGRA 421

Query: 427 RQIVKEDGALSMRK 440
           RQ +K    L +++
Sbjct: 422 RQTLKSGQGLQIKQ 435


>gi|167647508|ref|YP_001685171.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Caulobacter sp. K31]
 gi|167349938|gb|ABZ72673.1| UDP-N-acetylglucosamine pyrophosphorylase [Caulobacter sp. K31]
          Length = 469

 Score =  354 bits (909), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 176/441 (39%), Positives = 261/441 (59%), Gaps = 1/441 (0%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           + R A++LAAG+G RM+S + KVL +I G+ ++ H ++T  A   E + +V+G  + ++ 
Sbjct: 19  KARAAVILAAGQGTRMRSPTPKVLHRIGGRTLLDHAIDTAEALNCERIVVVVGAHSPQVG 78

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                        +QD  QGT HAVL A++A+     DV++ + D PL+S+  +    D 
Sbjct: 79  EHARKRLGEGATVLQDPPQGTGHAVLAAREALADFDGDVVVTFADCPLLSASVIAPLFDL 138

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIA-IREENDATDEERKIHYCNSGLMAIDGL 181
            A+G  +AV+GF A NP  YGRL++    ++  I E  DA D  +++ +CNSG++A D  
Sbjct: 139 RAKGADVAVLGFEAANPGAYGRLILAPGHVLLRIVEAKDADDTVKQVKHCNSGVLAADRA 198

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIW 241
            + D L  +  +  + EYYLTD++  A     S  +    E  V G N++ EL+  E +W
Sbjct: 199 LLFDLLANVGNDNANGEYYLTDVVGLAHDRTLSTRAAFAPEASVQGVNSQAELAAAEAVW 258

Query: 242 QSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLE 301
           Q+  R   +++GVTM APETV L  DT +     +E  V FG GVS+ +   I+AFS+LE
Sbjct: 259 QAGRRSAFLVAGVTMPAPETVHLCWDTTLAAGVTVEQFVVFGPGVSVASGAVIKAFSHLE 318

Query: 302 GVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNV 361
           G  +G+  +IGP+AR+R    I  + RIGNF EVKK  +  G+K NHLSY+GD  +G   
Sbjct: 319 GAVVGEGALIGPYARLRPGADIGPDARIGNFVEVKKVKVGAGAKANHLSYLGDGSIGAKA 378

Query: 362 NIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSL 421
           NIGAGTI CNYDG  K++TH+  NAFIGSN++L+AP+ +G+G    SGS+IT+D  + +L
Sbjct: 379 NIGAGTIFCNYDGFDKFETHVGANAFIGSNTALVAPVRVGEGAMTGSGSVITKDVEDGAL 438

Query: 422 VFARSRQIVKEDGALSMRKKK 442
              R  Q  K   A   R  K
Sbjct: 439 ALGRGIQSDKPGWATKFRALK 459


>gi|114327903|ref|YP_745060.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Granulibacter bethesdensis CGDNIH1]
 gi|119370571|sp|Q0BSR5|GLMU_GRABC RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|114316077|gb|ABI62137.1| glucosamine-1-phosphate acetyltransferase [Granulibacter
           bethesdensis CGDNIH1]
          Length = 451

 Score =  353 bits (907), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 180/441 (40%), Positives = 275/441 (62%), Gaps = 14/441 (3%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG G RMKS+  KVL  IAG+ M+ H++         ++ +V+G   + + R   
Sbjct: 14  AVILAAGLGTRMKSTRPKVLHPIAGRSMLRHLIAACQPV-FSHIVVVIGPDMDSVAREAA 72

Query: 67  P-PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQ 125
           P PT+     +Q  + GTAHA L A   ++ G  +V I+YGD PL+S+ TL   + +  Q
Sbjct: 73  PHPTV-----VQQERLGTAHAALQAMALVQQG--EVAILYGDNPLISTATLHTLVQRRRQ 125

Query: 126 GYSI-AVVGFNADNPKGYGRLLIKNNE----IIAIREENDATDEERKIHYCNSGLMAIDG 180
           G ++ A++      P  YGR++ +  +    +  I E  +A ++ER +  CN+G+   D 
Sbjct: 126 GDAVLAMLAMRPPEPGRYGRVITEKYQTGDYVSRIVEYAEANEQERAVTLCNAGVFCADA 185

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
             +  WL  ++      EYYL DII  A   G  +A+++   +E+ G N++ EL+  E  
Sbjct: 186 ASMAAWLGGVENANSKGEYYLGDIIPLAIAGGGHVAAVEAPYEELRGINSKVELAEAEAT 245

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
            Q   RR+ + +GVTM APETVFLS DT++ PD ++ PHV FG GV++E   +IRAFS+L
Sbjct: 246 VQIVLRRKALENGVTMTAPETVFLSADTLLAPDVLVGPHVVFGPGVTVEEGAEIRAFSHL 305

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EG H+G+ T+IGP+AR+R  + +     +GNF E+K+AT+ EG+K NHL+Y+GD  VG  
Sbjct: 306 EGCHVGRHTLIGPYARLRPGSVLGAGAHVGNFVELKQATLGEGAKANHLTYLGDVEVGAR 365

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
            NIGAGTITCNYDG HK++T I ++AFIGS+++L+AP+ IG+G    +GS+I  D P ++
Sbjct: 366 ANIGAGTITCNYDGVHKHRTEIGDDAFIGSDTALVAPVRIGRGAITGAGSVIVDDVPADA 425

Query: 421 LVFARSRQIVKEDGALSMRKK 441
           L  AR RQ+ K + A  +R++
Sbjct: 426 LALARGRQVNKPERAAEIRRQ 446


>gi|304321634|ref|YP_003855277.1| UDP-N-acetylglucosamine pyrophosphorylase [Parvularcula bermudensis
           HTCC2503]
 gi|303300536|gb|ADM10135.1| UDP-N-acetylglucosamine pyrophosphorylase [Parvularcula bermudensis
           HTCC2503]
          Length = 467

 Score =  353 bits (907), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 180/435 (41%), Positives = 263/435 (60%), Gaps = 1/435 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG G RMKS+  KVL  I  +PM+ HVM    A G +   +V+G GAE +      
Sbjct: 25  IILAAGHGTRMKSARPKVLHTIGHRPMLHHVMALGQALGADRQTVVVGSGAEAVADAARA 84

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
                   +QD  QGT HAV  A  +++     V+++Y D PL++  TL + + +I  G 
Sbjct: 85  FDSEAAIAVQDPPQGTGHAVQMALPSLEGFEGTVLVLYADTPLLTPQTLSRLIAEIEGGA 144

Query: 128 SIAVVGFNADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
           +++V+GF   +P  YGRL+ + N ++  I E  DAT+ ER    CN+GLMA++ + +   
Sbjct: 145 AVSVLGFEPADPGAYGRLIRRPNGDLDRIVEYKDATETERASRLCNAGLMAVNAVSLRHH 204

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYR 246
           L  +  +   +EYYLTD+ + A   G   A +    +E  G NNR EL+  E  +Q R R
Sbjct: 205 LPSLSNDNAQKEYYLTDLPQMAVAAGGRAAIVLAASEETQGVNNRAELAAAEATFQRRLR 264

Query: 247 RQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIG 306
            +MM++GVT+  P++ + + DT I  D  + PHV FG GV I   V+I AFS++EG  I 
Sbjct: 265 LEMMLAGVTLEDPDSTYFAFDTQIAEDVTVAPHVVFGPGVRIAANVRIEAFSHIEGAVIE 324

Query: 307 KKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAG 366
           +  ++GPFAR+R  T++    R+GNF E K  ++  G+K +HL+Y+GD+ +G   NIGAG
Sbjct: 325 EGAVVGPFARLRPGTSVGAAARVGNFVETKNTSLGRGAKASHLTYLGDAEIGAGSNIGAG 384

Query: 367 TITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARS 426
           TITCNYDG  K++T I EN F+GSNSSL+AP+TIG G Y+ SGS+IT+    +SL  AR 
Sbjct: 385 TITCNYDGYEKHRTLIGENCFVGSNSSLVAPVTIGAGAYIGSGSVITKTVEPDSLAVARG 444

Query: 427 RQIVKEDGALSMRKK 441
           RQ+ K   A S + +
Sbjct: 445 RQLSKAGWAASYKGR 459


>gi|254419678|ref|ZP_05033402.1| Nucleotidyl transferase family [Brevundimonas sp. BAL3]
 gi|196185855|gb|EDX80831.1| Nucleotidyl transferase family [Brevundimonas sp. BAL3]
          Length = 454

 Score =  353 bits (906), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 177/438 (40%), Positives = 258/438 (58%), Gaps = 6/438 (1%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R R AI+LAAG+G RMKS   KVL  + G+ M+ H ++   A G + + +V+G  + E+ 
Sbjct: 6   RPRAAIILAAGQGTRMKSPLPKVLHPVGGRAMLDHAIDAAQALGCQKIVVVVGAHSPEVR 65

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYD-DVIIMYGDVPLVSSHTLKKAMD 121
                        +QD   GT HAV  A+  +  G+D DV++ YGDVPL+ +  ++   +
Sbjct: 66  AHVVKRLGEAAIAVQDPPLGTGHAVRAAEQTLA-GFDGDVVVTYGDVPLLKAADIEPVFN 124

Query: 122 KIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
                  + V+GF A +P  YGRL++  + + AI E  +A+ E   I  CNSG+MA    
Sbjct: 125 P----EGLTVIGFEARDPGAYGRLILDGDALAAITEAKEASPEVLAITACNSGVMAAPAD 180

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIW 241
            +   L  ++ +    EYYLTD++E AR  G+   ++   E  V G N++ EL+  E ++
Sbjct: 181 LLFALLADVRNDNAKGEYYLTDVVELARKAGRPTRAVFAAEDSVMGVNSQAELAQAEALF 240

Query: 242 QSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLE 301
           QS  R   + +GVTM AP+TV  + DT +   TVIEP V FG G  IE   +IR+FS++E
Sbjct: 241 QSVQRDAFLAAGVTMAAPDTVHFAWDTQVGGGTVIEPFVVFGPGAVIEGGARIRSFSHIE 300

Query: 302 GVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNV 361
           G  +     +GP+AR+R    + + V+IGNF EVK   +  G+K NHL+Y+GD  +G   
Sbjct: 301 GARVASGAEVGPYARLRPGADLAEGVKIGNFVEVKNVKMAAGAKANHLAYLGDGSIGAAA 360

Query: 362 NIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSL 421
           NIGAGTI CNYDG +K +T +   AF+GSNSSL+AP+ IG G  VASGS+IT+D P ++L
Sbjct: 361 NIGAGTIFCNYDGFNKAQTEVGAGAFVGSNSSLVAPVVIGDGAIVASGSVITEDVPADAL 420

Query: 422 VFARSRQIVKEDGALSMR 439
            F R+RQ  K D   + R
Sbjct: 421 AFGRARQTHKPDAGAAFR 438


>gi|109892109|sp|Q2W7U1|GLMU_MAGMM RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
          Length = 449

 Score =  352 bits (903), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 185/433 (42%), Positives = 267/433 (61%), Gaps = 9/433 (2%)

Query: 1   MKRKRLA-IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAE 59
           M   +LA IVLAAG G RMKSS  KV+  +AG+PM+SH+++T++    + + +V+G   E
Sbjct: 1   MASSKLAVIVLAAGMGTRMKSSLPKVMHPLAGRPMVSHLLDTVSGLSPDRMVVVVGPDME 60

Query: 60  EITRINFP-PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKK 118
            + +   P PT+     IQ  + GT HAVL A+ A+     DV+++YGD PL++  TL++
Sbjct: 61  LVGKTVAPFPTV-----IQADRLGTGHAVLQAKAALGQFDGDVLVLYGDTPLITRATLER 115

Query: 119 --AMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLM 176
             A  +  +  ++ V+GF   +P  YGRL++    + AI E  DAT ++R+   CNSG+M
Sbjct: 116 MLAERRGPRDPAVVVLGFKPQDPGHYGRLVVGAEGLKAIVEYRDATPDQRENPLCNSGVM 175

Query: 177 AIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSL 236
           AIDG  +   + ++       EYYLTDI+  AR DG +   ++  E E+ G N R EL++
Sbjct: 176 AIDGNRLWSLIERVDNKNSKGEYYLTDIVALARADGATCTHVEGDEAELLGVNARSELAV 235

Query: 237 IENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRA 296
            E + Q+R R   M +G T+I P TV+ S DT I  D  I PHV FG GV++ + V+I+ 
Sbjct: 236 AEALVQARLREAAMDNGATLIDPATVWFSWDTKIGRDVTIWPHVVFGPGVTVGDNVEIKG 295

Query: 297 FSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSV 356
           F + EG  +      GPF R+R    I +   IGNF EVKKAT++ G+KINHL+YVGD+ 
Sbjct: 296 FCHFEGCMVEAGVAAGPFTRLRPGAEIGEGAHIGNFVEVKKATVEAGAKINHLAYVGDAR 355

Query: 357 VGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDT 416
           VG   N+GAGTITCNYDG +K  T I   AFIGSN+SL+AP+ +G G  V +GS+IT++ 
Sbjct: 356 VGAGANVGAGTITCNYDGFNKSFTDIGAGAFIGSNTSLVAPVKVGDGAVVGAGSVITKEV 415

Query: 417 PENSLVFARSRQI 429
              +L  AR  Q+
Sbjct: 416 TPGALAVARGSQM 428


>gi|326388953|ref|ZP_08210535.1| UDP-N-acetylglucosamine pyrophosphorylase / glucosamine-1-phosphate
           N-acetyltransferase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326206553|gb|EGD57388.1| UDP-N-acetylglucosamine pyrophosphorylase / glucosamine-1-phosphate
           N-acetyltransferase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 473

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 183/443 (41%), Positives = 271/443 (61%), Gaps = 12/443 (2%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR-INF 66
           +VLAAG+G RMKS   KVL  IAG+PM+ H++ + A    ++  +V+G G E++ + +  
Sbjct: 30  VVLAAGKGTRMKSDLHKVLHPIAGRPMLKHLLASAAELAPQHQVVVVGSGREQLEKALGE 89

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKI--A 124
             T++V    Q+ Q GT HAV  AQ A+     DV+++YGDVP V + T++  ++++  A
Sbjct: 90  TATIAV----QEPQHGTGHAVQQAQGALAGFSGDVLVLYGDVPFVRASTMQAMLERLHAA 145

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
              ++ V+GF  D+   YGR++ ++  +  + E  DA  +ER    CNSGL+A     + 
Sbjct: 146 DEPAVVVLGFEPDDALAYGRVIAQDGLVAKMVEFKDADAQERACTLCNSGLLAARAEDLF 205

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQS 243
             L ++  N    EYYL DI+  A  DG++ A +   +  EV G N+R EL+  E  WQ 
Sbjct: 206 ALLERVGNNNAQGEYYLPDIVNIAIADGRTAAVVTTDDPDEVAGINSRSELAAAEARWQG 265

Query: 244 RYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGV 303
           R R + M  G T++APETV+ + DT++  D  IE +V FG GV + + V I AFS++EG 
Sbjct: 266 RRRERAMADGATLVAPETVWFAWDTVVGRDVTIEQNVVFGPGVVVADKVVIHAFSHIEGA 325

Query: 304 HIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNI 363
            I     +GPFAR+R    + +  R+GNF EVK A + EG+K NHL+Y+GD+ +G + NI
Sbjct: 326 RIASGVSVGPFARLRPGADLAEGSRVGNFVEVKNARLGEGAKANHLTYLGDAEIGAHANI 385

Query: 364 GAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVF 423
           GAGTITCNYDG  KY+T I E AFIGSNSSLIAP+ IG    VA+GS +++D  +  L  
Sbjct: 386 GAGTITCNYDGYFKYRTVIGERAFIGSNSSLIAPVRIGADAIVAAGSAVSRDVSDGELRL 445

Query: 424 ARSRQIVKEDGA----LSMRKKK 442
            R+ Q++K   A     +M++KK
Sbjct: 446 VRAEQLIKPGWADRFHDAMKRKK 468


>gi|77463061|ref|YP_352565.1| UDP-N-acetylglucosamine pyrophosphorylase / glucosamine-1-phosphate
           N-acetyltransferase [Rhodobacter sphaeroides 2.4.1]
 gi|94716952|sp|Q3J3H0|GLMU_RHOS4 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|77387479|gb|ABA78664.1| UDP-N-acetylglucosamine pyrophosphorylase / glucosamine-1-phosphate
           N-acetyltransferase [Rhodobacter sphaeroides 2.4.1]
          Length = 454

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 172/424 (40%), Positives = 260/424 (61%), Gaps = 1/424 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           IVLAAG+G RM S   KVL  +   PM+ H +    +   E V +V G+GAE + +    
Sbjct: 9   IVLAAGQGTRMNSDLPKVLHPLGAAPMLHHALRAGQSLEPERVVVVAGHGAEAVAKAARA 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
              S+E  +Q  Q GTAHAV  A   +     + +++YGD P +   TL++ +D  ++ +
Sbjct: 69  FDESIEVVVQAEQLGTAHAVAQAAPLLADAPGEAVVLYGDTPFIRPETLERMLDLRSR-H 127

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
           ++ V+GF A +P  YGRL+ +  E+  I E  DATDEER I  CNSG++  +   ++  +
Sbjct: 128 AVVVLGFEATDPGRYGRLVTRGEELDRIVEWKDATDEERTISLCNSGVICAEAGLLLALV 187

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
            ++     + EYYLTD++  AR+ G S       E E  G N R +L+  E  +Q R R 
Sbjct: 188 SEVGNANAAGEYYLTDVVALARVRGLSAGVAICDEAETLGVNTRAQLAEAEAEFQKRARA 247

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
             +  GVT+ AP+TVF + DT +  D ++ P+V FG GV++E+  +IRAF +LEG HI +
Sbjct: 248 AALEDGVTLTAPDTVFFALDTFLGRDAIVGPNVVFGPGVTVESGAEIRAFCHLEGCHISR 307

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
              +GPFAR+R    + ++V +GNF E+K A + EG K+ HL+Y+GD+ VG++ NIGAGT
Sbjct: 308 GATVGPFARLRPGAELAEDVHVGNFVEIKNAVLDEGVKVGHLTYLGDAHVGEHTNIGAGT 367

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           +TCNYDG  K++T I  +AFIGS++ L+AP+T+G     ASGS+IT++ P  +L   R+R
Sbjct: 368 VTCNYDGVMKHRTEIGAHAFIGSDTMLVAPVTVGARAMTASGSVITENVPAEALALGRAR 427

Query: 428 QIVK 431
           Q+ K
Sbjct: 428 QVTK 431


>gi|83951721|ref|ZP_00960453.1| UDP-N-acetylglucosamine pyrophosphorylase [Roseovarius nubinhibens
           ISM]
 gi|83836727|gb|EAP76024.1| UDP-N-acetylglucosamine pyrophosphorylase [Roseovarius nubinhibens
           ISM]
          Length = 420

 Score =  351 bits (900), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 169/398 (42%), Positives = 252/398 (63%), Gaps = 1/398 (0%)

Query: 34  MISHVMETIAAAGIENVALVLGYGAEEITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDA 93
           M+ H +        +   +V G+GAE +T          +  +Q  Q GTAHAV  A   
Sbjct: 1   MLHHALRAGQLLEPDRTVVVAGHGAEAVTAATQDYDDEAQVALQTEQLGTAHAVAQAAPL 60

Query: 94  IKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEII 153
           +     D +++YGD P +   TL + M +    + + ++GF A +P  YGRL++    + 
Sbjct: 61  LGDHPGDAVVLYGDTPFILPETLSR-MAEARAAHDVVILGFEAADPGRYGRLVMSGERLD 119

Query: 154 AIREENDATDEERKIHYCNSGLMAIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGK 213
            I E  DA+D ER I +CNSG++      +   +  +  +  S EYYLTDI+E AR  G 
Sbjct: 120 RIVEFKDASDTERAITFCNSGVVMAKTETLFSLIEAVGNDNASGEYYLTDIVEVARARGL 179

Query: 214 SIASIDVKEQEVCGCNNRYELSLIENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPD 273
           S  +I   E E  G N+R +L+  E ++Q+R R+  M  GVT+ APETV+ ++DT+I  D
Sbjct: 180 SATAIACDEAETLGVNSRADLAAAEAVFQARMRQIAMEDGVTLAAPETVYFAYDTVIGRD 239

Query: 274 TVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFC 333
           TV+EP+V FG GV++E+  +IRAFS+LEG H+ +  IIGP+AR+R  T + ++VRIGNF 
Sbjct: 240 TVVEPNVVFGPGVTVESGARIRAFSHLEGCHVSRGGIIGPYARLRPGTELAEDVRIGNFV 299

Query: 334 EVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSS 393
           E+K AT+ EG+K+NHLSY+GD+ VG++ NIGAGT+TCNYDG  K++T I + AFIGS++ 
Sbjct: 300 EIKNATLDEGAKVNHLSYIGDASVGEHANIGAGTVTCNYDGVMKHRTEIGKRAFIGSDTM 359

Query: 394 LIAPITIGQGTYVASGSIITQDTPENSLVFARSRQIVK 431
           L+AP+ +G G   ASGS+IT+D  +++L  AR+ Q+VK
Sbjct: 360 LVAPVRVGDGAMTASGSVITRDVEDDALALARADQVVK 397


>gi|16126543|ref|NP_421107.1| UDP-N-acetylglucosamine pyrophosphorylase [Caulobacter crescentus
           CB15]
 gi|221235325|ref|YP_002517762.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Caulobacter crescentus NA1000]
 gi|81621047|sp|Q9A5Z3|GLMU_CAUCR RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|254798733|sp|B8GYT1|GLMU_CAUCN RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|13423823|gb|AAK24275.1| UDP-N-acetylglucosamine pyrophosphorylase [Caulobacter crescentus
           CB15]
 gi|220964498|gb|ACL95854.1| glucosamine-1-phosphate acetyltransferase/UDP-N-acetylglucosamine
           pyrophosphorylase [Caulobacter crescentus NA1000]
          Length = 462

 Score =  351 bits (900), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 181/441 (41%), Positives = 264/441 (59%), Gaps = 7/441 (1%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI- 61
           R R A++LAAG+G RMKS + KVL ++AG+ ++ H ++     G E + +V+G  + ++ 
Sbjct: 10  RPRAAVILAAGQGTRMKSPTPKVLHRLAGRTLLDHAIDAAEGLGCERIIVVVGAHSPQVG 69

Query: 62  --TRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKA 119
              R    P  +V   IQD   GT HAVL A+DA+   + DV++ Y D PL ++  +   
Sbjct: 70  ESARKRLGPDATV---IQDPPLGTGHAVLAAKDALADFHGDVVVTYADCPLTTAPVIAPL 126

Query: 120 MDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIA-IREENDATDEERKIHYCNSGLMAI 178
            D I     +AV+GF A NP GYGRL++    ++  I EE +A    +++ +CNSG++A 
Sbjct: 127 FDLITHVAHVAVLGFEAQNPTGYGRLILAPGHVLLRIVEEKEADLATKQVKHCNSGVLAA 186

Query: 179 DGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIE 238
           D   + D L  ++ +    EYYLTD++  A     S  +    E  V G N + EL+  E
Sbjct: 187 DRAVLFDLLANVRNDNAKGEYYLTDVVGLAHERHLSTRTAFAPEASVQGVNAQAELAAAE 246

Query: 239 NIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFS 298
            +WQ   R+ +M+ GVTM AP+TV L+ DT I    V+E  V FG GVS+ +   I+AFS
Sbjct: 247 AVWQQNRRKALMVDGVTMPAPDTVHLAWDTQIAGGAVVEQFVVFGPGVSVASGAVIKAFS 306

Query: 299 YLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVG 358
           +LEG  +G+  +IGP+AR+R    I  +  IGNF EVKK  +  G+K NHLSY+GD  VG
Sbjct: 307 HLEGAVVGEGALIGPYARLRPGAEIGPDAHIGNFVEVKKVKVGAGAKANHLSYLGDGSVG 366

Query: 359 KNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPE 418
           +  NIGAGTI CNYDG  K++TH+ + AFIGSNS+L+AP+ +G G    SGS+IT+D  +
Sbjct: 367 EKANIGAGTIFCNYDGFEKFETHVGKGAFIGSNSALVAPVRVGDGAMTGSGSVITKDVED 426

Query: 419 NSLVFARSRQIVKEDGALSMR 439
            +L  +R+ Q  K   A   R
Sbjct: 427 GALALSRADQTSKAGWATKFR 447


>gi|332185290|ref|ZP_08387039.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Sphingomonas sp. S17]
 gi|332015014|gb|EGI57070.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Sphingomonas sp. S17]
          Length = 437

 Score =  351 bits (900), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 187/426 (43%), Positives = 265/426 (62%), Gaps = 5/426 (1%)

Query: 18  MKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFPPTLSVEYYIQ 77
           MKS   KVL  IAG+PM+ H+++++     E V +V G G E++     P  L V   +Q
Sbjct: 1   MKSDLHKVLHPIAGRPMLLHLIDSVGQLSPERVVVVTGAGREQVEAAVAP--LGVGTALQ 58

Query: 78  DCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGYSIA--VVGFN 135
             Q GT HAV  A++A+     DV+I+YGDVPLV + T+++ +D++ QG   A  V+GF 
Sbjct: 59  AEQLGTGHAVAQAREALAGFEGDVLILYGDVPLVETATMRRMIDRLGQGDCPAAVVLGFR 118

Query: 136 ADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWLLQIKKNK 194
             +P  YGR++   +  I  + E  DA+ EER +  CNSGLMA+    +   L ++  + 
Sbjct: 119 PSDPAAYGRVIADADGRIDRMVEFKDASIEERAVTLCNSGLMAVRSEDLFGLLDRVGNDN 178

Query: 195 VSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRRQMMISGV 254
            + EYYL DI+  A  DG+  A I+ +  EV G N+R EL+++E  WQ R R + M+ G 
Sbjct: 179 AAGEYYLPDIVMLAASDGRHSAVIETEAGEVAGVNSRGELAVVEGDWQQRRRTRAMVEGA 238

Query: 255 TMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGKKTIIGPF 314
           T+IAP+TV+ SHDT I  D VIEPHV FG GV + + V I AFS+LEG  +     IGP+
Sbjct: 239 TLIAPDTVWFSHDTKIGRDVVIEPHVVFGPGVQVADGVTIHAFSHLEGAKVSSGADIGPY 298

Query: 315 ARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDG 374
           AR+R    + +  R+GNF E+KKA +  G+K NHL+Y+GD+ VG   NIGAGTITCNYDG
Sbjct: 299 ARLRPGADVREGARVGNFVEMKKAVLGPGAKANHLTYLGDAEVGAGANIGAGTITCNYDG 358

Query: 375 THKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSRQIVKEDG 434
             KY+T I E AFIGSNS+L+AP+TIG G  V +G+++T D   ++L   R+ +  K   
Sbjct: 359 FLKYRTVIGEGAFIGSNSALVAPVTIGAGAIVGAGAVVTSDVEADALALVRAERQTKAGW 418

Query: 435 ALSMRK 440
           A   R+
Sbjct: 419 AKRFRE 424


>gi|126461933|ref|YP_001043047.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Rhodobacter sphaeroides ATCC 17029]
 gi|126103597|gb|ABN76275.1| UDP-N-acetylglucosamine pyrophosphorylase / glucosamine-1-phosphate
           N-acetyltransferase [Rhodobacter sphaeroides ATCC 17029]
          Length = 454

 Score =  349 bits (896), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 172/424 (40%), Positives = 259/424 (61%), Gaps = 1/424 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           IVLAAG+G RM S   KVL  +   PM+ H +    +   E V +V G+GAE + +    
Sbjct: 9   IVLAAGQGTRMNSDLPKVLHPLGAAPMLHHALRAGQSLEPERVVVVAGHGAEAVAKAARA 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
              S+E  +Q  Q GTAHAV  A   +     + +++YGD P +   TL++ +D  ++ +
Sbjct: 69  FDESIEVVVQAEQLGTAHAVAQAAPLLADAPGEAVVLYGDTPFIRPETLERMLDLRSR-H 127

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
           ++ V+GF+A +P  YGRL+ +  E+  I E  DATDEER I  CNSG++  +   +   +
Sbjct: 128 AVVVLGFDAADPGRYGRLVTQGEELDRIVEWKDATDEERAISLCNSGVICAEAGLLFALV 187

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
            ++     + EYYLTD++  AR  G S       E E  G N R +L+  E  +Q R R 
Sbjct: 188 SEVGNANAAGEYYLTDVVALARARGLSAGVAICDEAETLGVNTRAQLAEAEAEFQKRARA 247

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
             +  GVT+ AP+TVF + DT +  D ++ P+V FG GV++E+  +IRAF +LEG HI +
Sbjct: 248 AALEDGVTLTAPDTVFFALDTFLGRDAIVGPNVVFGPGVTVESGAEIRAFCHLEGCHISR 307

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
              +GPFAR+R    + ++V +GNF E+K A + EG K+ HL+Y+GD+ VG++ NIGAGT
Sbjct: 308 GATVGPFARLRPGAELAEDVHVGNFVEIKNAVLDEGVKVGHLTYLGDAHVGEHTNIGAGT 367

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           +TCNYDG  K++T I  +AFIGS++ L+AP+T+G     ASGS+IT++ P  +L   R+R
Sbjct: 368 VTCNYDGVMKHRTEIGAHAFIGSDTMLVAPVTVGARAMTASGSVITENVPAEALALGRAR 427

Query: 428 QIVK 431
           Q+ K
Sbjct: 428 QVTK 431


>gi|221638917|ref|YP_002525179.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Rhodobacter sphaeroides KD131]
 gi|221159698|gb|ACM00678.1| glucosamine-1-phosphate N-acetyltransferase [Rhodobacter
           sphaeroides KD131]
          Length = 456

 Score =  349 bits (896), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 173/424 (40%), Positives = 258/424 (60%), Gaps = 1/424 (0%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           IVLAAG+G RM S   KVL  +   PM+ H +    +   E V +V G+GAE + +    
Sbjct: 11  IVLAAGQGTRMNSDLPKVLHPLGAAPMLHHALRAGQSLEPERVVVVAGHGAEAVAKAARA 70

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
              S+E  +Q  Q GTAHAV  A   +     + +++YGD P +   TL++ +D  ++ +
Sbjct: 71  FDESIEVVVQAEQLGTAHAVAQAAPLLADAPGEAVVLYGDTPFIRPETLERMLDLRSR-H 129

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
           ++ V+GF A +P  YGRL+ +  E+  I E  DATDEER I  CNSG++  +   +   +
Sbjct: 130 AVVVLGFEAADPGRYGRLVTQGEELDRIVEWKDATDEERAISLCNSGVICAEAGLLFALV 189

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRR 247
            ++     + EYYLTD++  AR  G S       E E  G N R +L+  E  +Q R R 
Sbjct: 190 SEVGNANAAGEYYLTDVVALARARGLSAGVAICDEAETLGVNTRAQLAEAEAEFQKRARA 249

Query: 248 QMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGK 307
             +  GVT+ AP+TVF + DT +  D ++ P+V FG GV+IE+  +IRAF +LEG HI +
Sbjct: 250 AALEDGVTLTAPDTVFFALDTFLGRDAIVGPNVVFGPGVTIESGAEIRAFCHLEGCHISR 309

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGT 367
              +GPFAR+R    + ++V +GNF E+K A + EG K+ HL+Y+GD+ VG++ NIGAGT
Sbjct: 310 GATVGPFARLRPGAELAEDVHVGNFVEIKNAVLDEGVKVGHLTYLGDAHVGEHTNIGAGT 369

Query: 368 ITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSR 427
           +TCNYDG  K++T I  +AFIGS++ L+AP+T+G     ASGS+IT++ P  +L   R+R
Sbjct: 370 VTCNYDGVMKHRTEIGAHAFIGSDTMLVAPVTVGARAMTASGSVITENVPAEALALGRAR 429

Query: 428 QIVK 431
           Q+ K
Sbjct: 430 QVTK 433


>gi|85374590|ref|YP_458652.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Erythrobacter litoralis HTCC2594]
 gi|84787673|gb|ABC63855.1| N-acetylglucosamine-1-phosphate uridyltransferase [Erythrobacter
           litoralis HTCC2594]
          Length = 467

 Score =  348 bits (894), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 186/439 (42%), Positives = 269/439 (61%), Gaps = 17/439 (3%)

Query: 2   KRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI 61
           +R   A++LAAG+G RMKS   KVL  IAG+ M+ H+M ++ A       +V+G G E++
Sbjct: 16  QRDFAAVILAAGKGTRMKSDLHKVLHPIAGRAMLDHLMASVDALAPSEKVVVVGAGREQL 75

Query: 62  TRINFPPTLSVEYYIQDC----QQGTAHAVLTAQDAIKPGYD-DVIIMYGDVPLVSSHTL 116
                    +VE   + C    Q GT HAV  A+  +  GY+ DV+I+YGDVP V S T+
Sbjct: 76  E-------AAVEGRAKTCLQEPQHGTGHAVQQAESDLA-GYEGDVLILYGDVPFVRSSTM 127

Query: 117 KKAMDKIAQ--GYSIAVVGFNADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNS 173
           +  +D++ +    ++ V+GF  D+   YGR++   +  I  + E  DA+++ER    CNS
Sbjct: 128 EMMLDRLHEQDAPAVVVLGFEPDDALQYGRVIANADGHIEKMVEFKDASEQERACTLCNS 187

Query: 174 GLMAIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRY 232
           GLMA+ G  + D L ++  +    EYYL DI+  AR DG+  A +   +  EV G N+R 
Sbjct: 188 GLMAVKGADLFDLLRRVGNDNAQGEYYLVDIVNIARGDGRHSAVVVTDDPGEVAGINSRA 247

Query: 233 ELSLIENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV 292
           EL+  E  WQ   R + M +GV++ APETVF S DT +  D  +EP+V FG GV + +  
Sbjct: 248 ELAAAEAQWQELKREEAMAAGVSLKAPETVFFSWDTELGRDVTVEPNVVFGPGVKVADGA 307

Query: 293 QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYV 352
            I++FS+LEG  +G    +GP+AR+R    +E++  IGNF E+KK T+  G+K +HL+Y+
Sbjct: 308 HIKSFSHLEGATVGPNCQVGPYARLRPGAVMEEDSFIGNFVEMKKTTLGPGAKASHLTYL 367

Query: 353 GDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSII 412
           GD+ VG   NIGAGTITCNYDG  KY+T I E AFIGSNS+L+AP+TIG    VA+GS +
Sbjct: 368 GDATVGAKANIGAGTITCNYDGYFKYQTVIGERAFIGSNSALVAPVTIGADAIVAAGSTV 427

Query: 413 TQDTPENSLVFARSRQIVK 431
           T+D  +  L   R+ Q VK
Sbjct: 428 TRDVADGELRMERAEQSVK 446


>gi|163794284|ref|ZP_02188256.1| hypothetical protein BAL199_21494 [alpha proteobacterium BAL199]
 gi|159180452|gb|EDP64973.1| hypothetical protein BAL199_21494 [alpha proteobacterium BAL199]
          Length = 451

 Score =  348 bits (892), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 185/448 (41%), Positives = 261/448 (58%), Gaps = 9/448 (2%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M  +  A+VLAAG+G RMKS   KVL ++AGKPMI  V++     G + V +V    A +
Sbjct: 1   MTDRLAAVVLAAGKGTRMKSDLPKVLHRVAGKPMIEWVLDAAGTLGADPVVVVT---APD 57

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDA---IKPGYDDVIIMYGDVPLVSSHTLK 117
              +    +      IQ+   GTA AV  A+DA   I      V+++YGD P+++  TL 
Sbjct: 58  QDAVRAAISGRATTAIQEQALGTADAVKPARDALASIAATGGTVLVLYGDTPMMTPATLA 117

Query: 118 KAMDKI--AQGYSIAVVGFNADNPKGYGRLLI-KNNEIIAIREENDATDEERKIHYCNSG 174
           + ++     +  ++ V+GF  D+P  YGRL++  ++ +  I E  DA   ER I  CN G
Sbjct: 118 RMVEARNGKENPAVVVLGFEPDDPALYGRLVLGADHSLERIVETRDAGPVERDIGLCNGG 177

Query: 175 LMAIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYEL 234
           +MAID   + + L  I    V  E+YLTDI+  AR  G+  A +     E  G ++R  L
Sbjct: 178 VMAIDASVLFEMLDAIGNTNVKSEFYLTDIVGIARAAGRRCAVVICDTIETMGVDSRAGL 237

Query: 235 SLIENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQI 294
           +  E   Q+R R   M +G T+ APETVFL HDT +  D  + PHV FG GVS+E+  +I
Sbjct: 238 ATAEAAMQARLRATAMDNGTTLTAPETVFLCHDTKLGRDVTVHPHVVFGAGVSVEDGAEI 297

Query: 295 RAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGD 354
           R+FS+LEG  +    I+GP+AR+R    I     IGNF E+K A I+ G+K NHLSYVGD
Sbjct: 298 RSFSHLEGARVAAGAIVGPYARLRPGADIGAGAHIGNFVEIKNAVIEPGAKANHLSYVGD 357

Query: 355 SVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQ 414
           + VG   NIGAGTITCNYDG  K+ T I   AFIGSN++L+AP+T+G G  V +GS++T+
Sbjct: 358 ARVGAKANIGAGTITCNYDGFAKHHTDIGAGAFIGSNTALVAPVTVGDGAIVGAGSVVTK 417

Query: 415 DTPENSLVFARSRQIVKEDGALSMRKKK 442
           D P ++L   R  + V   GA+  R  +
Sbjct: 418 DVPADALAVVRGAEKVIPGGAVRFRASR 445


>gi|83594360|ref|YP_428112.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase
           [Rhodospirillum rubrum ATCC 11170]
 gi|83577274|gb|ABC23825.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase
           [Rhodospirillum rubrum ATCC 11170]
          Length = 476

 Score =  347 bits (891), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 183/440 (41%), Positives = 269/440 (61%), Gaps = 10/440 (2%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT- 62
           K  A++LAAG+G RMKS+  KVL  +AG+PM++H++  + A       +V+G G E +  
Sbjct: 33  KTAAVILAAGQGTRMKSALPKVLHPLAGRPMVAHLIHALGAVAPSRTVVVIGPGMESVAD 92

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD-VIIMYGDVPLVSSHTLKKAMD 121
           R+   PT+     +Q  + GTAHAV  A +A+  G+D  V+I+YGD PL++  TL + ++
Sbjct: 93  RVAPLPTV-----LQAERLGTAHAVAQAGEALA-GFDGTVLILYGDTPLITPETLTRMVE 146

Query: 122 K--IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAID 179
               A+  ++ V+GF   +P  YGRL+     + AI E  DAT E+R I  CNSG+MA+D
Sbjct: 147 ARLAAEDPAVVVLGFRPADPLQYGRLITSPAGLEAIVEYKDATAEQRAIGLCNSGVMAVD 206

Query: 180 GLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIEN 239
           G  +   L  +  +    EYYLTDI+  AR  G++ A ++   +E+ G N+R EL+  E 
Sbjct: 207 GRVLFALLAAVGNDNAKGEYYLTDIVALARGMGRACAVVEGAAEELLGVNSRSELAAAEA 266

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSY 299
           + Q R R + M  G T+ APETVF S DT +  D  I P V FG GV I + V+I+ F +
Sbjct: 267 VIQGRLREKAMEGGATLTAPETVFFSADTRLGRDVSIGPFVTFGPGVEIGDGVEIKGFCH 326

Query: 300 LEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGK 359
           +EG  +  K  +GP+AR+R   TI +   +GNF E+K + +++G+K+NHL+Y+GD+ VG 
Sbjct: 327 IEGARVAAKATLGPYARLRPGATIAEGAHVGNFVEIKNSAVEQGAKVNHLTYIGDARVGA 386

Query: 360 NVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPEN 419
             NIGAGTITCNYDG  KY T I E AFIGSN++L+AP++IG G  + +GS I +D   +
Sbjct: 387 RANIGAGTITCNYDGFGKYHTDIGEGAFIGSNTALVAPVSIGAGAIIGAGSTIARDVEAD 446

Query: 420 SLVFARSRQIVKEDGALSMR 439
           +L   R    V+   A   R
Sbjct: 447 ALALTRGPHEVRPGWAAKFR 466


>gi|109892119|sp|Q2RPX0|GLMU_RHORT RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
          Length = 446

 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 183/440 (41%), Positives = 269/440 (61%), Gaps = 10/440 (2%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT- 62
           K  A++LAAG+G RMKS+  KVL  +AG+PM++H++  + A       +V+G G E +  
Sbjct: 3   KTAAVILAAGQGTRMKSALPKVLHPLAGRPMVAHLIHALGAVAPSRTVVVIGPGMESVAD 62

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD-VIIMYGDVPLVSSHTLKKAMD 121
           R+   PT+     +Q  + GTAHAV  A +A+  G+D  V+I+YGD PL++  TL + ++
Sbjct: 63  RVAPLPTV-----LQAERLGTAHAVAQAGEALA-GFDGTVLILYGDTPLITPETLTRMVE 116

Query: 122 K--IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAID 179
               A+  ++ V+GF   +P  YGRL+     + AI E  DAT E+R I  CNSG+MA+D
Sbjct: 117 ARLAAEDPAVVVLGFRPADPLQYGRLITSPAGLEAIVEYKDATAEQRAIGLCNSGVMAVD 176

Query: 180 GLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIEN 239
           G  +   L  +  +    EYYLTDI+  AR  G++ A ++   +E+ G N+R EL+  E 
Sbjct: 177 GRVLFALLAAVGNDNAKGEYYLTDIVALARGMGRACAVVEGAAEELLGVNSRSELAAAEA 236

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSY 299
           + Q R R + M  G T+ APETVF S DT +  D  I P V FG GV I + V+I+ F +
Sbjct: 237 VIQGRLREKAMEGGATLTAPETVFFSADTRLGRDVSIGPFVTFGPGVEIGDGVEIKGFCH 296

Query: 300 LEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGK 359
           +EG  +  K  +GP+AR+R   TI +   +GNF E+K + +++G+K+NHL+Y+GD+ VG 
Sbjct: 297 IEGARVAAKATLGPYARLRPGATIAEGAHVGNFVEIKNSAVEQGAKVNHLTYIGDARVGA 356

Query: 360 NVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPEN 419
             NIGAGTITCNYDG  KY T I E AFIGSN++L+AP++IG G  + +GS I +D   +
Sbjct: 357 RANIGAGTITCNYDGFGKYHTDIGEGAFIGSNTALVAPVSIGAGAIIGAGSTIARDVEAD 416

Query: 420 SLVFARSRQIVKEDGALSMR 439
           +L   R    V+   A   R
Sbjct: 417 ALALTRGPHEVRPGWAAKFR 436


>gi|149186101|ref|ZP_01864415.1| N-acetylglucosamine-1-phosphate uridyltransferase [Erythrobacter
           sp. SD-21]
 gi|148830132|gb|EDL48569.1| N-acetylglucosamine-1-phosphate uridyltransferase [Erythrobacter
           sp. SD-21]
          Length = 454

 Score =  346 bits (888), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 179/434 (41%), Positives = 268/434 (61%), Gaps = 7/434 (1%)

Query: 2   KRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI 61
           +R    ++LAAG+G R+KS   KVL  IAG+P+I H+M  +A        +++G   +E 
Sbjct: 4   RRDFAVVILAAGKGSRLKSGVHKVLHNIAGRPIIEHLMAQVAIIEPARTIVIVG---DER 60

Query: 62  TRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMD 121
            ++    +      +Q+ Q GT HAV  A+D +     DVI++ GD P +++ T+ + ++
Sbjct: 61  EQVEDQVSDRATCVVQEPQLGTGHAVAQAKDVLADFDGDVIMLLGDAPFITAATMVEMLE 120

Query: 122 KIAQGYSIAVV--GFNADNPKGYGRLLIKNNEIIA-IREENDATDEERKIHYCNSGLMAI 178
           ++  G   AVV  GF  ++   YGR++   +  I  + E  DA + ER    CNSGLMA 
Sbjct: 121 RLRAGDEPAVVVLGFEPEDALQYGRVITHADMTIEKMVEFKDANEAERATRLCNSGLMAA 180

Query: 179 DGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDV-KEQEVCGCNNRYELSLI 237
               + D L ++  +    EYYL DI+  A  +G++ A++   + +EV G N+R EL+  
Sbjct: 181 KSGDLFDLLERVDNDNAQGEYYLPDIVNVAVKEGRTCAAVVADRPEEVLGINSRKELAAA 240

Query: 238 ENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAF 297
           E  WQ   R + + +GVT+ APETVF S+DT ++ D VIEP+V FG G +++   +IRAF
Sbjct: 241 ERQWQDLRREEALENGVTLKAPETVFFSYDTELEADVVIEPNVVFGPGTTVKRGTRIRAF 300

Query: 298 SYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVV 357
           S+LEG H+G+   +GP+AR+R    +EK  ++GNF E+KKAT+ EG+K NHL+Y+GD+ V
Sbjct: 301 SHLEGAHVGEDCEVGPYARLRPGAVMEKGSKVGNFVEMKKATLGEGAKANHLTYLGDATV 360

Query: 358 GKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTP 417
           G   NIGAGTITCNYDG  K++T I E AFIGSNS+LIAP+ IG    VA+GS +++D  
Sbjct: 361 GAGANIGAGTITCNYDGYFKHQTKIGERAFIGSNSALIAPVEIGADAIVAAGSAVSRDVA 420

Query: 418 ENSLVFARSRQIVK 431
              L   R+ Q+VK
Sbjct: 421 AGELRMVRAEQMVK 434


>gi|162147561|ref|YP_001602022.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Gluconacetobacter diazotrophicus PAl
           5]
 gi|189041274|sp|A9HI46|GLMU_GLUDA RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|161786138|emb|CAP55720.1| putative Bifunctional protein glmU [Includes:
           UDP-N-acetylglucosamin pyrophosphorylase (EC 2.7.7.23)
           (N-acetylglucosamine-1-phosphat uridyltransferase);
           Glucosamine-1-phosphate N-acetyltransferas (EC
           2.3.1.157)] [Gluconacetobacter diazotrophicus PAl 5]
          Length = 461

 Score =  346 bits (887), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 174/449 (38%), Positives = 277/449 (61%), Gaps = 16/449 (3%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R   A++LAAG G RMKS   KV+  +AG+PM+ ++++  AA+  + + +V+G G E++ 
Sbjct: 17  RPATAVILAAGMGTRMKSDRPKVMHPLAGQPMLRYLLDN-AASVFDRIVVVVGPGMEQVA 75

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKK---- 118
            +  P  + V+   QD + GTAHA   A D    G  DV ++YGD PL+++ ++++    
Sbjct: 76  ALAAPHAVVVQ---QD-RLGTAHAAAQAADLF--GTGDVAVLYGDNPLITADSMRRMLAC 129

Query: 119 -AMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMA 177
            A +  ++G  +A++     +P  YGR++ ++  +  I E  DA+DEER I  CN+G++ 
Sbjct: 130 RAGEGNSEGAGLALMAMRPRDPGRYGRVVTQDGLVRRIVEWADASDEERAITLCNAGVLC 189

Query: 178 IDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLI 237
                   WL  ++ +    EYYL D++  A  +G+ + +++  E E+ G N+R EL+  
Sbjct: 190 AGAEDFRRWLGAVRNDNAQGEYYLGDVVAMAVAEGRQVRAVEAPEDELRGINSRAELAEA 249

Query: 238 ENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAF 297
           E   Q R R   +  G T++APETVFL+ DT+++PD +++PHV FG GV++    +IRAF
Sbjct: 250 EACVQRRLRAAALDGGATLVAPETVFLAADTVLEPDVLVQPHVVFGPGVTVRRGAEIRAF 309

Query: 298 SYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVV 357
           S+LEG  +G   +IGP+AR+R  + +     +GNF E+K  T+  G+K NHLSY+GD+ +
Sbjct: 310 SHLEGCVVGPGALIGPYARLRPGSDVGAAAHVGNFVELKATTLGAGAKANHLSYLGDATI 369

Query: 358 GKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTP 417
           G   NIGAGTITCNYDG  K++T I    F+GSN+ L+AP++IG G  VA+GS+ITQD  
Sbjct: 370 GPATNIGAGTITCNYDGVFKHRTDIGAGCFVGSNAILVAPVSIGDGALVAAGSVITQDVL 429

Query: 418 ENSLVFARSRQIVKEDGALS----MRKKK 442
            +++   R+RQ  K+    S    +R+KK
Sbjct: 430 PDAMALGRARQTNKDGRGASLQAALRRKK 458


>gi|296115235|ref|ZP_06833876.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978336|gb|EFG85073.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Gluconacetobacter hansenii ATCC
           23769]
          Length = 426

 Score =  345 bits (886), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 168/425 (39%), Positives = 262/425 (61%), Gaps = 8/425 (1%)

Query: 18  MKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFPPTLSVEYYIQ 77
           M+S   KV+  +AG+PM+ H+++  A    + + +V+G G EE+  +  P        +Q
Sbjct: 1   MRSEHPKVMHPLAGRPMLRHLLDN-AEQVFDRIVVVIGPGMEEVAALAAPHV----AVVQ 55

Query: 78  DCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMD-KIAQGYSIAVVGFNA 136
             + GTAHA L AQ     G  DV ++YGD PL+++ T++  +  +   G  +A++    
Sbjct: 56  ADRLGTAHAALQAQAYF--GTGDVAVLYGDNPLITAQTMRDLLACRRLPGVGLALLAMRP 113

Query: 137 DNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWLLQIKKNKVS 196
            NP  YGR++ + +E++ I E  DAT +ER I  CN+G++  D      WL  ++ +   
Sbjct: 114 ANPGRYGRVVTQGDEVVRIVEWADATPDERAIDLCNAGVLCADAHDFRRWLDAVRNDNAQ 173

Query: 197 QEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRRQMMISGVTM 256
            EYYL D++ +A  DG  + ++   E E+ G N+R EL++ E   Q R R   M  GVT+
Sbjct: 174 GEYYLGDVVTQAVADGVGVRAVVAAEDELRGINSRAELAVAEASVQQRLRHAAMEKGVTL 233

Query: 257 IAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGKKTIIGPFAR 316
           +AP+TVFL  DT++ PD VI PHV FG GV++E  V++R+FS+LEG  +    +IGP+AR
Sbjct: 234 VAPDTVFLCADTVLAPDVVIHPHVVFGPGVTVERDVEVRSFSHLEGCVVRHGALIGPYAR 293

Query: 317 IRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTH 376
           +R  + +  +  +GNF E+K  T+ EG+K NHL+Y+G++ VG   NIGAGTITCNYDG  
Sbjct: 294 LRPGSDVGAHAHVGNFVELKATTLGEGAKANHLTYLGNAQVGARSNIGAGTITCNYDGVF 353

Query: 377 KYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSRQIVKEDGAL 436
           K+ T I E +F+GS+S L+AP+T+G GT  A+GS+IT D P++++ F R +Q  +   A 
Sbjct: 354 KHTTIIGEGSFVGSDSILVAPVTLGAGTLTAAGSVITDDVPDDAMAFGRVKQENRAGYAR 413

Query: 437 SMRKK 441
           + R +
Sbjct: 414 TFRDR 418


>gi|330994269|ref|ZP_08318197.1| protein glmU [Gluconacetobacter sp. SXCC-1]
 gi|329758736|gb|EGG75252.1| protein glmU [Gluconacetobacter sp. SXCC-1]
          Length = 477

 Score =  345 bits (885), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 166/440 (37%), Positives = 263/440 (59%), Gaps = 8/440 (1%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R   A++LAAGRG RMKS   KV+  +AG+PM+ ++++  AA   + + +V+G G +++ 
Sbjct: 37  RLSTAVILAAGRGTRMKSERPKVMHPLAGRPMLRYLLDN-AAQVFDRIVVVIGPGMDDVA 95

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM-D 121
            +  P  + V++     + GT HA   A+     G  DV ++YGD PL++  T++  +  
Sbjct: 96  ALAAPHAVVVQHD----RLGTGHAARQAESVFGDG--DVAVLYGDNPLITPGTMRALLAQ 149

Query: 122 KIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
           +      +A++     +P  YGR++  + +++ I E  DAT  ER I  CN+G++  D  
Sbjct: 150 RRCDDTGLALLAMEPADPAKYGRVVTHDGQVVRIVEWADATPAERAIGLCNAGVLCADAA 209

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIW 241
               WL  I  +    EYYL D++ +A  DG+ + ++   E E+ G N+R EL+  E   
Sbjct: 210 DFRRWLDGISNDNAQGEYYLGDVVARAVADGRHVRAVVAPEDELRGINSRAELAQAEACV 269

Query: 242 QSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLE 301
           Q+R R+  M  G T++AP+TVFL  DT+++PDTV+ PHV FG GV +    +I AFS++E
Sbjct: 270 QARLRQAAMAGGTTLVAPDTVFLCADTVLEPDTVVHPHVVFGPGVHVRRGTEIHAFSHVE 329

Query: 302 GVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNV 361
           G  +G    IGP+AR+R  T +    R+GNF E+K  T+  G+K +HL+Y+G++ VG   
Sbjct: 330 GAVVGPDAQIGPYARLRPGTDVGAQARVGNFVELKATTLGAGAKASHLTYLGNATVGARA 389

Query: 362 NIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSL 421
           NIGAGTITCNYDG  K+ T I  ++FIGS+S L+AP+ +G     A+GS+IT D P+ ++
Sbjct: 390 NIGAGTITCNYDGVFKHATEIGADSFIGSDSVLVAPVRVGARALTAAGSVITHDVPDGAM 449

Query: 422 VFARSRQIVKEDGALSMRKK 441
              R+RQ  +   A + R +
Sbjct: 450 ALGRARQANRAGHADTFRDR 469


>gi|126729526|ref|ZP_01745339.1| Glucosamine-1-phosphate N-acetyltransferase;
           UDP-N-acetylglucosamine pyrophosphorylase [Sagittula
           stellata E-37]
 gi|126709645|gb|EBA08698.1| Glucosamine-1-phosphate N-acetyltransferase;
           UDP-N-acetylglucosamine pyrophosphorylase [Sagittula
           stellata E-37]
          Length = 433

 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 172/417 (41%), Positives = 256/417 (61%), Gaps = 5/417 (1%)

Query: 18  MKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAE--EITRINFPPTLSVEYY 75
           M S   KVL +IA  PM+ H +        ++  +V G+GA+  E    ++ P   +   
Sbjct: 1   MDSDLPKVLHRIAQAPMLWHALRAGYRLAPDHTIIVAGHGADAVEAAAKDYDPDAHI--V 58

Query: 76  IQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGYSIAVVGFN 135
           +Q  Q GTAHAV  A   ++    DV+++YGD P +S  TL  AM +  + + + V+GF 
Sbjct: 59  LQTEQLGTAHAVGQALPLLEVFDGDVLVLYGDTPFISEETLH-AMTEARRTHDVVVLGFE 117

Query: 136 ADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWLLQIKKNKV 195
           A +P  YGRL+ + ++++ I E  DATD+ER I  CNSG+++ D   +   + ++     
Sbjct: 118 AADPARYGRLVTEGDDLLKIVEYKDATDDERAITLCNSGVVSADRATLAALVAEVGNGNA 177

Query: 196 SQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRRQMMISGVT 255
           S E+YLTDI+  AR  G +   +   E E  G N+R +L+  E  +Q+  R Q M  GVT
Sbjct: 178 SGEFYLTDIVGLARARGLTATVVRCPEAETLGVNSRMDLAQAEAAFQAYMRAQAMAEGVT 237

Query: 256 MIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGKKTIIGPFA 315
           + APETVF + DT+I  D  +E +V FG GV++E   +IRAFS+LEG H+ +  I+GP+A
Sbjct: 238 LAAPETVFFAWDTVIGRDAEVEQNVVFGPGVTVETGARIRAFSHLEGAHVSRGAIVGPYA 297

Query: 316 RIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGT 375
           R+R    + ++V +GNF EVK A + EG K NHL+Y+GD+ +G+  NIGAGTITCNYDG 
Sbjct: 298 RLRPGAELAEDVHVGNFVEVKNAVLHEGVKANHLTYIGDAEIGEKTNIGAGTITCNYDGV 357

Query: 376 HKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSRQIVKE 432
            K++T I +NAFIGS++ L+AP+T+G G   ASGS IT+D P  ++   R+   +KE
Sbjct: 358 FKHRTVIGKNAFIGSDTMLVAPVTVGDGAMTASGSTITKDVPAGAMAIERAEMTIKE 414


>gi|296282400|ref|ZP_06860398.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Citromicrobium bathyomarinum JL354]
          Length = 451

 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 183/444 (41%), Positives = 266/444 (59%), Gaps = 11/444 (2%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           AI+LAAG+G RMKS   KVL  IAG+ M+ H+M +I   G +   +V+G G +++     
Sbjct: 6   AIILAAGKGTRMKSDLHKVLHPIAGRAMLHHLMASIDTLGPKRKVVVVGAGRDQL---EA 62

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKI--A 124
                 E  +Q+ Q GT HAV  A++ +     DV+++YGDVP V   T++  +D++   
Sbjct: 63  ALGDDAETRVQEPQLGTGHAVQQAEEPLGDFTGDVLVLYGDVPFVRGETMRAMLDRLHAE 122

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNN-EIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
               + V+GF  ++   YGR++  +   I  + E  DA++ ER    CNSGLMA     +
Sbjct: 123 DAPKVVVLGFEPEDALAYGRVIADDGGRISKMVEFKDASEAERACTLCNSGLMAARAQDM 182

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQ 242
              L ++  +    EYYL DI+  A  DG + A++   +  EV G N+R EL+  E  WQ
Sbjct: 183 FALLRRVGNDNAQGEYYLPDIVNIAIADGDTCAAVTASDPGEVAGINSRAELARAEAQWQ 242

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEG 302
              R + M +G T+ APETVF S+DT I  D  I+P+V FG GV + +   I+AFS+LEG
Sbjct: 243 ELKREEAMANGATLRAPETVFFSYDTQIGRDVTIDPNVVFGPGVRVADGAHIKAFSHLEG 302

Query: 303 VHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVN 362
             +G+   +GP+AR+R    +EK+  +GNF E+KK+T+ +G+K +HL+Y+GD+ +G   N
Sbjct: 303 ATVGEGAQVGPYARLRPGAVLEKDAFVGNFVEMKKSTLGQGAKASHLTYLGDAEIGAGAN 362

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           IGAGTITCNYDG  KYKT I E AFIGSNS+L+AP+TIG    VA+GS +T D     L 
Sbjct: 363 IGAGTITCNYDGYFKYKTVIGERAFIGSNSALVAPVTIGADAIVAAGSTVTHDVAPGELR 422

Query: 423 FARSRQIVKEDGA----LSMRKKK 442
             R+ Q +K   A     +M+KKK
Sbjct: 423 MERAEQSIKPGWADRFHDTMKKKK 446


>gi|209542195|ref|YP_002274424.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209529872|gb|ACI49809.1| UDP-N-acetylglucosamine pyrophosphorylase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 461

 Score =  343 bits (881), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 174/449 (38%), Positives = 275/449 (61%), Gaps = 16/449 (3%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           R   A++LAAG G RMKS   KV+  +AG+PM+ ++++  AA+  + + +V+G G E++ 
Sbjct: 17  RPATAVILAAGMGTRMKSDRPKVMHPLAGQPMLRYLLDN-AASVFDRIVVVVGPGMEQVA 75

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM-- 120
            +  P  + V+   QD + GTAHA   A D    G  DV ++YGD PL++  ++++ +  
Sbjct: 76  ALAAPHAVVVQ---QD-RLGTAHAAAQAADLF--GSGDVAVLYGDNPLITVASMRRMLAC 129

Query: 121 ---DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMA 177
              +   +G  +A++     +P  YGR++ ++  +  I E  DA+DEER I  CN+G++ 
Sbjct: 130 RAGEGGNEGAGLALMAMRPRDPGRYGRVVTQDGLVRRIVEWADASDEERAITLCNAGVLC 189

Query: 178 IDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLI 237
                   WL  ++ +    EYYL D++  A  +G+ + +++  E E+ G N+R EL+  
Sbjct: 190 AGAEDFRRWLGAVRNDNAQGEYYLGDVVAMAVAEGRQVRAVEAPEDELRGINSRAELAEA 249

Query: 238 ENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAF 297
           E   Q R R   +  G T++APETVFL+ DT+++PD +++PHV FG GV++    +IRAF
Sbjct: 250 EACVQRRLRAAALDGGATLVAPETVFLAADTVLEPDVLVQPHVVFGPGVTVRRGAEIRAF 309

Query: 298 SYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVV 357
           S+LEG  +G   +IGP+AR+R  + +     +GNF E+K  T+  G+K NHLSY+GD+ +
Sbjct: 310 SHLEGCVVGPGALIGPYARLRPGSDVGAAAHVGNFVELKATTLGAGAKANHLSYLGDATI 369

Query: 358 GKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTP 417
           G   NIGAGTITCNYDG  K++T I    F+GSN+ L+AP+ IG G  VA+GS+ITQD P
Sbjct: 370 GPATNIGAGTITCNYDGVFKHRTEIGAGCFVGSNAILVAPVRIGDGALVAAGSVITQDVP 429

Query: 418 ENSLVFARSRQIVKEDGALS----MRKKK 442
            +++   R+RQ  K+    S    +R+KK
Sbjct: 430 PDAMALGRARQTNKDGRGASLQAALRRKK 458


>gi|310816718|ref|YP_003964682.1| UDP-N-acetylglucosamine pyrophosphorylase [Ketogulonicigenium
           vulgare Y25]
 gi|308755453|gb|ADO43382.1| UDP-N-acetylglucosamine pyrophosphorylase [Ketogulonicigenium
           vulgare Y25]
          Length = 447

 Score =  343 bits (879), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 176/428 (41%), Positives = 256/428 (59%), Gaps = 8/428 (1%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF- 66
           ++LAAG+G RM+S   KVL ++ G P+I+H +    +   + V +V GY    + +    
Sbjct: 6   VILAAGKGTRMESDLPKVLHEVGGAPLIAHALRLADSLLPDRVIVVTGYEGAAVAKSAAH 65

Query: 67  --PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIA 124
             P  + VE   Q  Q GT HA   A  A+     DV + +GD P + + TL+ AM    
Sbjct: 66  WNPEAIIVE---QAEQLGTGHAAQMAMPALTGTSGDVFVTFGDTPFIRTATLE-AMQDAR 121

Query: 125 QGYSIAVVGFNADNPKG-YGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
           +   + V+GF A +P   YGRL++   ++ AI E  DA    R I  CNSG++      +
Sbjct: 122 KTRDLVVLGFEAADPDARYGRLVMDGEDLQAIVEYKDADAATRAIRLCNSGVICTSAQRL 181

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQS 243
              L Q+K    + EYYLTDI+  AR  G S   +   E+E  G N R EL+  E I+Q+
Sbjct: 182 PALLAQLKNENAAAEYYLTDIVAIARAAGLSAGVVTCPEEETLGINTRTELARAEVIFQA 241

Query: 244 RYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGV 303
           R RR  +  GV +++P+TV  + DT++  D V+EP+V F  GV++E+  +IR+FS+LEG 
Sbjct: 242 RARRDALEDGVQLVSPDTVHFAFDTLLGRDAVVEPYVVFATGVTVESGARIRSFSHLEGA 301

Query: 304 HIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNI 363
           H+ +  ++GP+AR+R    + ++  +GNF EVK ATI EG+K +HLSY+GD+ VG   NI
Sbjct: 302 HVSRGAVVGPYARLRPGAELAEHAHVGNFVEVKNATIGEGTKASHLSYIGDADVGAGTNI 361

Query: 364 GAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVF 423
           GAGTIT NYDG  K++T I + AFIGSNS+LIAPITIG   + A+GS+IT D    +L  
Sbjct: 362 GAGTITVNYDGVFKHRTTIGDRAFIGSNSTLIAPITIGNEGFTAAGSVITDDVAPGALAI 421

Query: 424 ARSRQIVK 431
            R+RQ+ K
Sbjct: 422 GRARQVEK 429


>gi|85709204|ref|ZP_01040270.1| N-acetylglucosamine-1-phosphate uridyltransferase [Erythrobacter
           sp. NAP1]
 gi|85690738|gb|EAQ30741.1| N-acetylglucosamine-1-phosphate uridyltransferase [Erythrobacter
           sp. NAP1]
          Length = 450

 Score =  342 bits (876), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 176/426 (41%), Positives = 256/426 (60%), Gaps = 3/426 (0%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           AI+LAAG+G RMKS   KVL  IAGKPM+ H++++ A    +   +V+G   E++     
Sbjct: 6   AIILAAGKGTRMKSELHKVLHPIAGKPMLLHLLDSFAELAPQRTVVVVGDRREQVDAAL- 64

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQG 126
                V   +QD Q GTAHA L A++A+     ++++ +GDVP+V + T+++ +  +  G
Sbjct: 65  -EERDVSTALQDPQHGTAHAALQAREALSGFSGNLLVCFGDVPMVRAETVQRLIAALEDG 123

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEII-AIREENDATDEERKIHYCNSGLMAIDGLYIMD 185
             +AV+GF  ++   YGR++  ++  +  + E  DAT+ E++   CNSGL+      +  
Sbjct: 124 AKVAVLGFRPEDALAYGRIIADDDGTVRKMVEFKDATEREKRTRLCNSGLIVAHSDDMWP 183

Query: 186 WLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRY 245
            L  +  +    EYYL D+   A   G  +  ++    EV G N+R EL+  E  WQ+  
Sbjct: 184 LLDAVDNDNAQGEYYLPDVATGAISRGDKVVVVETDADEVAGINSRAELAEAEQRWQAVR 243

Query: 246 RRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHI 305
           R + M  G T+ APETVF S DT I  D +IEP+V FG GVSI + V I+AF ++EG  I
Sbjct: 244 REEAMADGATLRAPETVFFSWDTKIGRDVLIEPNVVFGPGVSIADDVHIKAFCHIEGATI 303

Query: 306 GKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGA 365
                +GPFAR+R    +E++  +GNF E+KKAT+  G+K +HL+Y+GD+ VG   NIGA
Sbjct: 304 ASGAAVGPFARLRPGAVMEEDSFVGNFVEMKKATLGPGAKASHLTYLGDATVGAKANIGA 363

Query: 366 GTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFAR 425
           GTITCNYDG  KY T I + AFIGSNS+LIAP+TIG    VA+GS +++D     L   R
Sbjct: 364 GTITCNYDGYFKYHTTIGDRAFIGSNSALIAPVTIGADAIVAAGSAVSRDVGAGDLRMVR 423

Query: 426 SRQIVK 431
             Q VK
Sbjct: 424 GEQAVK 429


>gi|83310379|ref|YP_420643.1| N-acetylglucosamine-1-phosphate uridyltransferase [Magnetospirillum
           magneticum AMB-1]
 gi|82945220|dbj|BAE50084.1| N-acetylglucosamine-1-phosphate uridyltransferase [Magnetospirillum
           magneticum AMB-1]
          Length = 431

 Score =  337 bits (863), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 174/415 (41%), Positives = 255/415 (61%), Gaps = 8/415 (1%)

Query: 18  MKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP-PTLSVEYYI 76
           MKSS  KV+  +AG+PM+SH+++T++    + + +V+G   E + +   P PT+     I
Sbjct: 1   MKSSLPKVMHPLAGRPMVSHLLDTVSGLSPDRMVVVVGPDMELVGKTVAPFPTV-----I 55

Query: 77  QDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKK--AMDKIAQGYSIAVVGF 134
           Q  + GT HAVL A+ A+     DV+++YGD PL++  TL++  A  +  +  ++ V+GF
Sbjct: 56  QADRLGTGHAVLQAKAALGQFDGDVLVLYGDTPLITRATLERMLAERRGPRDPAVVVLGF 115

Query: 135 NADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWLLQIKKNK 194
              +P  YGRL++    + AI E  DAT ++R+   CNSG+MAIDG  +   + ++    
Sbjct: 116 KPQDPGHYGRLVVGAEGLKAIVEYRDATPDQRENPLCNSGVMAIDGNRLWSLIERVDNKN 175

Query: 195 VSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRRQMMISGV 254
              EYYLTDI+  AR DG +   ++  E E+ G N R EL++ E + Q+R R   M +G 
Sbjct: 176 SKGEYYLTDIVALARADGATCTHVEGDEAELLGVNARSELAVAEALVQARLREAAMDNGA 235

Query: 255 TMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGKKTIIGPF 314
           T+I P TV+ S DT I  D  I PHV FG GV++ + V+I+ F + EG  +      GPF
Sbjct: 236 TLIDPATVWFSWDTKIGRDVTIWPHVVFGPGVTVGDNVEIKGFCHFEGCMVEAGVAAGPF 295

Query: 315 ARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDG 374
            R+R    I +   IGNF EVKKAT++ G+KINHL+YVGD+ VG   N+GAGTITCNYDG
Sbjct: 296 TRLRPGAEIGEGAHIGNFVEVKKATVEAGAKINHLAYVGDARVGAGANVGAGTITCNYDG 355

Query: 375 THKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSRQI 429
            +K  T I   AFIGSN+SL+AP+ +G G  V +GS+IT++    +L  AR  Q+
Sbjct: 356 FNKSFTDIGAGAFIGSNTSLVAPVKVGDGAVVGAGSVITKEVTPGALAVARGSQM 410


>gi|332557934|ref|ZP_08412256.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Rhodobacter sphaeroides WS8N]
 gi|332275646|gb|EGJ20961.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Rhodobacter sphaeroides WS8N]
          Length = 436

 Score =  335 bits (860), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 164/414 (39%), Positives = 250/414 (60%), Gaps = 1/414 (0%)

Query: 18  MKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFPPTLSVEYYIQ 77
           M S   KVL  +   PM+ H +    +   E V +V G+GAE + +       S+E  +Q
Sbjct: 1   MNSDLPKVLHPLGAAPMLHHALRAGQSLEPERVVVVAGHGAEAVAKAARAFDESIEVVVQ 60

Query: 78  DCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGYSIAVVGFNAD 137
             Q GTAHAV  A   +     + +++YGD P +   TL++ +D  ++ +++ V+GF+A 
Sbjct: 61  AEQLGTAHAVAQAAPLLADAPGEAVVLYGDTPFIRPETLERMLDLRSR-HAVVVLGFDAA 119

Query: 138 NPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWLLQIKKNKVSQ 197
           +P  YGRL+ +  E+  I E  DATDEER I  CNSG++  +   +   + ++     + 
Sbjct: 120 DPGRYGRLVTQGEELDRIVEWKDATDEERAISLCNSGVICAEAGLLFALVSEVGNANAAG 179

Query: 198 EYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRRQMMISGVTMI 257
           EYYLTD++  AR  G S       E E  G N R +L+  E  +Q R R   +  GVT+ 
Sbjct: 180 EYYLTDVVALARARGLSAGVAICDEAETLGVNTRAQLAEAEAEFQKRARAAALEDGVTLT 239

Query: 258 APETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGKKTIIGPFARI 317
           AP+TVF + DT +  D ++ P+V FG GV++E+  +IRAF +LEG HI +   +GPFAR+
Sbjct: 240 APDTVFFALDTFLGRDAIVGPNVVFGPGVTVESGAEIRAFCHLEGCHISRGATVGPFARL 299

Query: 318 RQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHK 377
           R    + ++V +GNF E+K A + EG K+ HL+Y+GD+ VG++ NIGAGT+TCNYDG  K
Sbjct: 300 RPGAELAEDVHVGNFVEIKNAVLDEGVKVGHLTYLGDAHVGEHTNIGAGTVTCNYDGVMK 359

Query: 378 YKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSRQIVK 431
           ++T I  +AFIGS++ L+AP+T+G     ASGS+IT++ P  +L   R+RQ+ K
Sbjct: 360 HRTEIGAHAFIGSDTMLVAPVTVGARAMTASGSVITENVPAEALALGRARQVTK 413


>gi|192359186|ref|YP_001984257.1| UDP-N-acetylglucosamine pyrophosphorylase [Cellvibrio japonicus
           Ueda107]
 gi|254798734|sp|B3PIS4|GLMU_CELJU RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|190685351|gb|ACE83029.1| UDP-N-acetylglucosamine pyrophosphorylase [Cellvibrio japonicus
           Ueda107]
          Length = 453

 Score =  335 bits (860), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 185/443 (41%), Positives = 268/443 (60%), Gaps = 29/443 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM+S   KVL  I GKP++ HV++T    G E + L++G+GAE++ +    
Sbjct: 5   LILAAGKGTRMRSDLPKVLHPIGGKPLVQHVVDTARQVGGEQLLLIVGHGAEQVEQRMAA 64

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
           P   V++ +Q  Q GT HAV  A   ++P    V+I+YGDVPL  + TL+K +  +    
Sbjct: 65  P--DVKFVVQAQQLGTGHAVQQALPHLRP-EATVLILYGDVPLTRAATLQKLVAGVTD-Q 120

Query: 128 SIAVVGFNADNPKGYGRLLIKNN-EIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
            +A++  +  +P GYGR++   +  ++AI E  DA+DE+R I   N+G+MA+   ++  W
Sbjct: 121 QMALLTVDLPDPSGYGRIVRDTSGAVVAIVEHKDASDEQRLICEINTGIMAVKARHLQQW 180

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE----QEVCGCNNRYELSLIENIWQ 242
           L ++  N    EYYLTDII  A+ DG    +I V++    QEV G NNR + + +E  +Q
Sbjct: 181 LPRLGNNNAQGEYYLTDIIAMAKADG---VAIHVEQPGAIQEVEGINNRQQQATLERYYQ 237

Query: 243 SRYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGVSIE------- 289
            +  R +M +GVT++ P        +    D +I  + VIE  V  G GV IE       
Sbjct: 238 QQQARALMDAGVTLLDPARFDCRGNLSAGRDVVIDINCVIEGEVVLGDGVVIEPNCIIIN 297

Query: 290 ----NYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
               N   I+AFS++E   I     IGP+AR+R  T +   V+IGNF E KKA I +GSK
Sbjct: 298 SKIGNNTHIKAFSHIEDAVIAADCDIGPYARLRPGTNLADAVKIGNFVETKKAVIAKGSK 357

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
           +NHLSY+GD+ VG  VN+GAGTITCNYDG +K+KT I +NAFIGSNS+L+AP+ IG G  
Sbjct: 358 VNHLSYIGDARVGSGVNVGAGTITCNYDGVNKFKTEIGDNAFIGSNSALVAPVNIGAGAT 417

Query: 406 VASGSIITQDTPENSLVFARSRQ 428
           V +GS+IT+D     L  AR +Q
Sbjct: 418 VGAGSVITRDVDAAELAVARGKQ 440


>gi|254447509|ref|ZP_05060975.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [gamma proteobacterium HTCC5015]
 gi|198262852|gb|EDY87131.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [gamma proteobacterium HTCC5015]
          Length = 454

 Score =  335 bits (858), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 177/441 (40%), Positives = 269/441 (60%), Gaps = 22/441 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM S + KVL K+AGKPM+ HV++T  A   + V +V G+G +++ R    
Sbjct: 6   IILAAGKGSRMYSDTPKVLHKLAGKPMLGHVIDTAQALSPQQVVVVYGHGGDQVQR-EMA 64

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               +++  Q  Q GT HAV  A   I P  D  +++YGDVPL+ + TL+  +D+ A G 
Sbjct: 65  VYEGLDWAEQAEQLGTGHAVQQALPKIVPA-DVSLVLYGDVPLIKAQTLQALLDQAASG- 122

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEII-AIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
           ++AV+    ++P GYGR++  ++ ++ AI EE DA+D ++ I   N+G+MAI G +I  W
Sbjct: 123 ALAVLSVEPESPAGYGRIVKDSSGVVTAIVEEKDASDAQKAIREVNTGVMAIPGAHIEQW 182

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQSRY 245
           L Q+  +    EYYLTD++  A   G  + S+    E EV G NN+ +L+ +E  +Q + 
Sbjct: 183 LGQLSNDNAQGEYYLTDLVAMASEQGVGVTSVVCADENEVAGVNNKVQLAALERHYQRQT 242

Query: 246 RRQMMISGVTMIAPETV------FLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIR---- 295
            + ++++G T+  P  +       +  D  I    V E +V    GV I  Y QIR    
Sbjct: 243 AQDLLLAGATLADPNRIDVRGQLQVGRDVSIDVGCVFEGNVTLADGVRIGPYCQIRDSDI 302

Query: 296 -------AFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
                  A+S ++   IG+   +GP+AR+R+ T + +N ++GNF E KK  + +GSK NH
Sbjct: 303 ASGAQIEAYSSIDRASIGQAATVGPYARLREGTVLAENSKVGNFVETKKTHLGKGSKANH 362

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           LSY+GD+ VG+ VNIGAGTITCNYDG +K+KT I + AFIGSNSSL+API IG+G  V +
Sbjct: 363 LSYIGDAEVGEAVNIGAGTITCNYDGVNKFKTTIGDRAFIGSNSSLVAPIDIGEGATVGA 422

Query: 409 GSIITQDTPENSLVFARSRQI 429
           GS ++++ PE  L   R++Q+
Sbjct: 423 GSTVSKEAPEQQLTIGRAKQV 443


>gi|94501597|ref|ZP_01308114.1| glucosamine-1-phosphate
           acetyltransferase/N-acetylglucosamine-1-phosphate
           [Oceanobacter sp. RED65]
 gi|94426280|gb|EAT11271.1| glucosamine-1-phosphate
           acetyltransferase/N-acetylglucosamine-1-phosphate
           [Oceanobacter sp. RED65]
          Length = 457

 Score =  335 bits (858), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 180/446 (40%), Positives = 275/446 (61%), Gaps = 30/446 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           +VLAAG+G RMKS   KVL  IAGKPM++HV+++      E + +V+G+GAE++    F 
Sbjct: 6   VVLAAGQGSRMKSQLPKVLHPIAGKPMLAHVLDSAREVNAEALHVVVGHGAEQVQSY-FG 64

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAI-KPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQG 126
               + + +Q  Q GT HAV+ A + + + G    +I+YGDVPL+ S+TL+  +D IA  
Sbjct: 65  DEADLTWALQKEQNGTGHAVMMALEHLAESGV--TLILYGDVPLIQSNTLQALID-IAAK 121

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNE--IIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
             + ++  N D+P GYGR+ ++N E  + AI E  DA+++++ I  CN+G++A+    + 
Sbjct: 122 EQLGLLTVNMDDPTGYGRI-VRNEEGSVQAIVEHKDASEQQKAIQECNTGILAVPTAKLH 180

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVK-EQEVCGCNNRYELSLIENIWQS 243
           +WL ++  +    EYYLTDIIE +  DG  + ++  +  +E  G NNR + + +E  +Q 
Sbjct: 181 EWLPKLSNDNAQGEYYLTDIIEMSVNDGMPVETLQPEFAEETFGVNNRLQQAELERWYQG 240

Query: 244 RYRRQMMISGVTMIAPET----------VFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQ 293
           R    +M  GVT++ P+           V +  D +I  + V+E  V  G GV IE++  
Sbjct: 241 RLVDGLMTDGVTVLDPQRLDIRPGHTKGVTVGRDVVIDVNVVLEGEVVLGDGVYIESHCV 300

Query: 294 IR-----------AFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKE 342
           IR           AFS++E   + +   IGP+AR+R    +E   ++GNFCEVKK+ I E
Sbjct: 301 IRNAVIAPGTHVKAFSHIEDALVKEGCEIGPYARLRPGAQLENGAKVGNFCEVKKSIIGE 360

Query: 343 GSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQ 402
           GSK+NHL+Y+GD+ +G+  NIGAGTITCNYDG +K+KT I + AFIGSNSSL+AP+TIG+
Sbjct: 361 GSKVNHLTYIGDAEIGQGANIGAGTITCNYDGVNKFKTVIGDGAFIGSNSSLVAPVTIGK 420

Query: 403 GTYVASGSIITQDTPENSLVFARSRQ 428
           G  + +GS IT+D  ++ L   R RQ
Sbjct: 421 GATIGAGSTITKDVEDDKLAVGRGRQ 446


>gi|149375666|ref|ZP_01893435.1| UDP-N-acetylglucosamine pyrophosphorylase [Marinobacter algicola
           DG893]
 gi|149360068|gb|EDM48523.1| UDP-N-acetylglucosamine pyrophosphorylase [Marinobacter algicola
           DG893]
          Length = 474

 Score =  334 bits (856), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 180/440 (40%), Positives = 269/440 (61%), Gaps = 23/440 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RMKSS  KVL ++AGKPM+ HV++T    G   +  V+G+GAE++ +I   
Sbjct: 27  VILAAGQGSRMKSSLPKVLHRVAGKPMLHHVIDTARQLGASGIHGVIGHGAEQVRQIT-- 84

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
           P   + + +Q+ Q GT HAV  A  A+ P    V+I+YGDVPL +  TL+  + +++   
Sbjct: 85  PAEDLIWALQEQQLGTGHAVAQALPAL-PDEARVLILYGDVPLTNVETLQNLVSQVSD-R 142

Query: 128 SIAVVGFNADNPKGYGRLLIKNN-EIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
           S+A++  N + P GYGR+L  ++ ++ AI E+ DATD +++I   N+G++A+   ++ DW
Sbjct: 143 SLALLTVNLETPDGYGRILRDDSGKVRAIVEQKDATDAQKQIREVNTGILAVSARHLKDW 202

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDV-KEQEVCGCNNRYELSLIENIWQSRY 245
           L Q+       EYYLTDII  A   G  IA      E EV G NNR +L+ +E   Q + 
Sbjct: 203 LPQLSNRNAQGEYYLTDIIAMAADRGVEIAVAQPGSEYEVQGVNNRLQLAELERWVQRQE 262

Query: 246 RRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQI----------- 294
             ++M  G T+  P  V +  +  +  D +I+ +V F   VS+ + V I           
Sbjct: 263 ADRLMTEGATLADPARVDVRGELSVGQDVLIDVNVVFEGTVSLADGVSIGPGCVIRDSQI 322

Query: 295 ------RAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
                  A+S ++G  +G    IGPFAR+R  T +    ++GNF E KKA + EGSKINH
Sbjct: 323 AAGTSIEAYSVIDGADVGAGASIGPFARLRPGTRLAARTKVGNFVETKKADVGEGSKINH 382

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           LSYVGD+ +G+NVN+GAGTITCNYDG +K +T I ++ F+GSN+SL+AP++I  G+ V +
Sbjct: 383 LSYVGDTSLGRNVNVGAGTITCNYDGVNKSRTVIGDDVFVGSNTSLVAPVSIASGSTVGA 442

Query: 409 GSIITQDTPENSLVFARSRQ 428
           GS IT+D  E+ L  AR+RQ
Sbjct: 443 GSTITRDVAESELAVARARQ 462


>gi|302382679|ref|YP_003818502.1| UDP-N-acetylglucosamine pyrophosphorylase [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193307|gb|ADL00879.1| UDP-N-acetylglucosamine pyrophosphorylase [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 449

 Score =  333 bits (855), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 169/438 (38%), Positives = 254/438 (57%), Gaps = 5/438 (1%)

Query: 5   RLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRI 64
           R AI+LAAG+G RMKS   KVL  +  + M+ H ++   A G E + +V+G  + E+ R 
Sbjct: 6   RAAIILAAGQGTRMKSPVPKVLHPVGHRAMLDHAIDAAEALGCERIVVVVGAHSPEV-RA 64

Query: 65  NFPPTLSVE-YYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKI 123
           +    L  E   +QD   GT HAV  A+  +      V++ YGDVPL+ +  ++   +  
Sbjct: 65  HVVDRLGEESIAVQDPPLGTGHAVRAAEAVLGDFVGQVVVTYGDVPLLRAADIEAVFEA- 123

Query: 124 AQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
                + V+GF A +P  YGRL+++ + + AI E  +A+ E   +  CNSG+MA     +
Sbjct: 124 --HDGVTVIGFEAADPGAYGRLVMEGDTLTAITEAKEASAEVLALKTCNSGVMAAPVGLL 181

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQS 243
            + L ++       E+YLTD++E AR  G    ++   E  V G N + EL+  E ++Q 
Sbjct: 182 FELLAEVTNENAKGEFYLTDVVELARKRGAPTRAVMASEDSVMGVNAQAELATAEALFQK 241

Query: 244 RYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGV 303
             R   + +GVTM APETV  + DT +   TVIEP V FG G ++    +IR+FS++EG 
Sbjct: 242 VQRETFLAAGVTMSAPETVHFAWDTRVGAGTVIEPFVVFGPGATVAERARIRSFSHIEGA 301

Query: 304 HIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNI 363
            I     +GP+AR+R    + + VR+GNF EVK   ++ G+K NHLSY+GD  VG   NI
Sbjct: 302 TIATGAEVGPYARLRPGADLGEGVRVGNFVEVKNVRMETGAKANHLSYLGDGSVGVGANI 361

Query: 364 GAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVF 423
           GAGTI CNYDG +K +T +   AF+GSNS+L+AP+TIG G  + SGS+IT+D P +++  
Sbjct: 362 GAGTIFCNYDGFNKVRTEVEAGAFVGSNSALVAPVTIGAGAVIGSGSVITEDVPADAMAL 421

Query: 424 ARSRQIVKEDGALSMRKK 441
            R RQ+       + R++
Sbjct: 422 GRGRQVNMPGAGAAFRER 439


>gi|197105453|ref|YP_002130830.1| UDP-N-acetylglucosamine pyrophosphorylase [Phenylobacterium
           zucineum HLK1]
 gi|196478873|gb|ACG78401.1| UDP-N-acetylglucosamine pyrophosphorylase [Phenylobacterium
           zucineum HLK1]
          Length = 452

 Score =  331 bits (849), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 169/439 (38%), Positives = 258/439 (58%), Gaps = 1/439 (0%)

Query: 5   RLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRI 64
           R A+++AAG+G RMKS   KVL K+ G+ ++  +++T+ AAG E + +++G  + E+  +
Sbjct: 4   RAAVIMAAGQGTRMKSPVPKVLHKVGGRTLLDRIIDTVQAAGCERIHVIVGNHSPEVRAL 63

Query: 65  NFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIA 124
                      +QD   GT HAVL A D +     DV+++ GD PL+ +  L+   +  A
Sbjct: 64  VARRLGEGAAVLQDPPLGTGHAVLCAADTLADYDGDVLVVNGDCPLLQASDLEPLFELRA 123

Query: 125 QGYSIAVVGFNADNPKGYGRLLI-KNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
            G ++A++GF   +   YGRL+   +  ++ I E +  +++ER +  CN+G+   D   +
Sbjct: 124 GGAALAIMGFEPQDQLLYGRLIRGADGHVLRIVEPSQCSEQERAVRLCNAGMYVADRADL 183

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQS 243
             WL ++  +    EY+LT I+ +A  +  ++ +    E  V G + + +LS  E ++Q 
Sbjct: 184 FRWLSRLTNDNPKGEYFLTGIVAEANAEELTVRAHIASETAVMGADTQMQLSQAEAVFQQ 243

Query: 244 RYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGV 303
           R R   +  GV M APETV  + DT I P  V+E  V F  GV +E    IRAFS+LEG 
Sbjct: 244 RRRAHFLAEGVGMPAPETVHFAWDTEIAPGAVVEQFVVFAPGVKVETGAVIRAFSHLEGA 303

Query: 304 HIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNI 363
            + +  ++GP+AR+R    I  +  IGNF EVK   + +G+K NHLSY+GD  VG   NI
Sbjct: 304 VVREGALVGPYARLRPGAEIGPDAHIGNFVEVKNVAVGKGAKANHLSYLGDGEVGAGANI 363

Query: 364 GAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVF 423
           GAGTI CNYDG  KY+T + E AFIGSN++L+AP+TIG G    SGS+IT+D P+++L  
Sbjct: 364 GAGTIFCNYDGFFKYRTVVGEGAFIGSNTALVAPVTIGAGAMTGSGSVITRDVPDHALAL 423

Query: 424 ARSRQIVKEDGALSMRKKK 442
            RS Q  K   A + R+KK
Sbjct: 424 ERSPQADKAGWARAFREKK 442


>gi|159043843|ref|YP_001532637.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Dinoroseobacter shibae DFL 12]
 gi|189041270|sp|A8LIS2|GLMU_DINSH RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|157911603|gb|ABV93036.1| 4-diphosphocytidyl-2C-methyl-D-erythritol synthase [Dinoroseobacter
           shibae DFL 12]
          Length = 450

 Score =  331 bits (849), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 168/424 (39%), Positives = 247/424 (58%), Gaps = 6/424 (1%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF- 66
           IVLAAG+G RM S   KVL  +AG P+++H +   AA     + +V G+GA  +      
Sbjct: 6   IVLAAGQGSRMNSELPKVLHPLAGAPLLAHGLRAGAALDPARIVVVTGHGAAAVEAATAQ 65

Query: 67  --PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIA 124
             P  + V    Q  Q GT HAV     A+     D +++YGD P +S  TL       A
Sbjct: 66  LAPEAICVR---QTEQLGTGHAVAQTAQALAGFGGDALVLYGDTPFISPETLLAMQAARA 122

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
            G  + V+GF A +P  YGRL+   + ++ I E  DAT +E  +  CNSG+M  D   ++
Sbjct: 123 AGADMVVLGFEAADPGRYGRLVTDGDALLRIVEAKDATPDELALDLCNSGVMMADAQVLL 182

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSR 244
             +  +  +  S+EYYLTD I   R +G     +   E E  G N R EL+  E  +Q+R
Sbjct: 183 RLVAGLSNDNASREYYLTDTIAAGRAEGLRARVVVCPEAETLGINTRTELAAAEQAFQAR 242

Query: 245 YRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVH 304
            R + +  GVT+  P T   + DT+I  D  I P V FG GV++E+  +IRAFS+LEG H
Sbjct: 243 ARARALEDGVTLADPATTHFAVDTVIGRDATIGPQVVFGPGVTVESGAEIRAFSHLEGCH 302

Query: 305 IGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIG 364
           + +   +GPFAR+R    + +N  +GNF E+K AT+ +G+K+NHLSY+GD+ +G+  N+G
Sbjct: 303 VSRGARVGPFARLRPGAELAENTHVGNFVEIKNATLAQGAKVNHLSYIGDAAIGEASNVG 362

Query: 365 AGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFA 424
           AGTITCNYDG  K++T I   +FIGSN+ L+AP+ +G     A+G+++TQD P+ ++   
Sbjct: 363 AGTITCNYDGVFKHRTEIGARSFIGSNTCLVAPVRVGDEAMTATGTVVTQDIPDGAMAVG 422

Query: 425 RSRQ 428
           R+RQ
Sbjct: 423 RTRQ 426


>gi|325981218|ref|YP_004293620.1| bifunctional protein glmU [Nitrosomonas sp. AL212]
 gi|325530737|gb|ADZ25458.1| Bifunctional protein glmU [Nitrosomonas sp. AL212]
          Length = 457

 Score =  331 bits (848), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 183/444 (41%), Positives = 269/444 (60%), Gaps = 28/444 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG G RM SS  KVL  +AG+PM++HV+ T        + +V+G+  E+I +    
Sbjct: 7   VILAAGAGKRMHSSLPKVLHTLAGQPMLAHVINTARKLSPNKICVVIGHDGEKIKKSVIG 66

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD--VIIMYGDVPLVSSHTLKKAMDKIAQ 125
             L+  + IQ+ Q GT HA++ A   +    DD   +I+YGDVPLVS+  L++ +  +  
Sbjct: 67  DDLT--WVIQEQQLGTGHALMQALSQLS---DDGLTLILYGDVPLVSAQELRQLLIAV-D 120

Query: 126 GYSIAVVGFNADNPKGYGRLL--IKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
           G S A++    +NP GYGR++  +    I A+ E+ DA+ E + IH  N+G+M I  +Y+
Sbjct: 121 GKSCAMLSAVVENPFGYGRIVRDVNTKAITAVVEQKDASTELQSIHEINTGIMLIPNMYL 180

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQ 242
             WL ++K      EYYLTDII  A  DG  +AS+ VK   EV G NN+Y+L+ +E ++Q
Sbjct: 181 HKWLPKLKNKNSQHEYYLTDIIAMAFKDGVHVASVQVKNFWEVMGVNNKYQLAELERLFQ 240

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRA------ 296
                +++ +GV +I P  + +  + I   D  I+ +  F   V + N+V++ A      
Sbjct: 241 RNCANELLSTGVRVIDPARIDIRGELICGSDVEIDINCIFEGTVKLGNFVRVGAHCILRN 300

Query: 297 -----------FSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
                      +S +EG  I +   IGP+ARIR  T +   V+IGNF EVK + I  GSK
Sbjct: 301 VTVAAGSIIHPYSMIEGAEISENCKIGPYARIRPGTRLASRVQIGNFVEVKNSQIGVGSK 360

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
            NHLSY+GDS VGKNVNIGAGTITCNYDG +K+ T + ++ FIGS++ LIAP+ I +G+Y
Sbjct: 361 TNHLSYIGDSCVGKNVNIGAGTITCNYDGANKHTTIVEDDVFIGSDTQLIAPVKISRGSY 420

Query: 406 VASGSIITQDTPENSLVFARSRQI 429
           + SGS IT++TPEN L  +RSRQI
Sbjct: 421 IGSGSTITKETPENQLTLSRSRQI 444


>gi|239995455|ref|ZP_04715979.1| bifunctional N-acetyl glucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate acetyl
           [Alteromonas macleodii ATCC 27126]
          Length = 452

 Score =  330 bits (846), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 179/440 (40%), Positives = 265/440 (60%), Gaps = 24/440 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           +VLAAG+G RMKSS  KVL K+ G PM+  ++ T+ + G +N+ LV G+G +++      
Sbjct: 6   VVLAAGKGTRMKSSLPKVLHKVGGVPMVQRIINTVKSLGADNIHLVYGHGGDQLKATVVE 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HAV  A   IK   +DV+++ GD PL+   TL  A+  + +  
Sbjct: 66  DNLN--WCLQAEQLGTGHAVQQAAPHIKDN-EDVLVLVGDAPLIREETLS-ALKAVKESC 121

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            +A++  N D+P G GR++ +N+ I AI E  DATD +R+I   N+G+M + G  +  WL
Sbjct: 122 DLALLTVNLDDPTGMGRIIRENDNITAIVEHKDATDAQREIKEINTGMMMMSGADLKRWL 181

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRYR 246
            ++  +    EYYLTD+I  A  +GK I S   +   EV G NNR +L+ +E   Q R  
Sbjct: 182 GELSNDNAQGEYYLTDVIAMAAAEGKRIQSAQPQSAVEVEGVNNRLQLANLERALQRRQA 241

Query: 247 RQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGVSI------------ 288
            ++M +GVT++ P    L       +D II  + ++E  V  G  V+I            
Sbjct: 242 EELMTNGVTLLDPARFDLRGQLETGNDVIIDVNVIVEGKVTLGSNVNIGANCILRNCTIA 301

Query: 289 ENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
           +N V I A S +E   +G+   +GPFAR+R    +++N ++GNF E+KKA + EG+K NH
Sbjct: 302 DNAV-IEANSIVEEASVGEACTVGPFARLRPGAVMQRNAKVGNFVEMKKAILGEGAKANH 360

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           L+Y+GD+ VG   NIGAGTITCNYDG +K KT I +NAFIGSNSSL+AP++IG+G  V +
Sbjct: 361 LTYLGDAEVGAKANIGAGTITCNYDGVNKSKTVIGDNAFIGSNSSLVAPVSIGKGATVGA 420

Query: 409 GSIITQDTPENSLVFARSRQ 428
           GS+IT    E++L  AR +Q
Sbjct: 421 GSVITSTVDEDALAVARGKQ 440


>gi|148270292|ref|YP_001244752.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Thermotoga petrophila RKU-1]
 gi|166226136|sp|A5ILV3|GLMU_THEP1 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|147735836|gb|ABQ47176.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase [Thermotoga
           petrophila RKU-1]
          Length = 445

 Score =  329 bits (844), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 188/455 (41%), Positives = 278/455 (61%), Gaps = 31/455 (6%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A+VLAAG+G RMKS   KVL  ++GKPMI  V+ET A    + V +VLG+ AE + R   
Sbjct: 3   ALVLAAGKGTRMKSKIPKVLHPLSGKPMIEWVVET-AGKVAQKVGVVLGFEAE-LVRKTL 60

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQG 126
           P  + V  ++Q+ Q GTAHAV+ A+D I+PG DDV+I+YGDVPL+S +TLK+ +++  +G
Sbjct: 61  PEWVDV--FVQEEQLGTAHAVMCAKDFIEPG-DDVLILYGDVPLISENTLKRMIEEHRKG 117

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
             + ++  + ++P GYGR+ I++ +   I E+ D  +E + +   N+G     G +++  
Sbjct: 118 ADVTILVADLEDPSGYGRV-IQDGDKYRIIEDADLPEELKSVTTINTGFYVFSGDFLLRV 176

Query: 187 LLQIKKNKVSQEYYLTDII---EKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQS 243
           L +IK      EYYLTD +   EK R+    + + D+   E+ G N R  L  +E   + 
Sbjct: 177 LPEIKNENAKGEYYLTDAVNFAEKVRV----VKTDDL--LEITGVNTRKTLVWLEEQLRM 230

Query: 244 RYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGV 303
           R   +++ +GVT++ P T ++ +   I  DTVI P  F      +    +I   + +   
Sbjct: 231 RKIEELLENGVTILDPATTYIHYSVEIGMDTVIHPMTFIEGRTRVGENCEIGPMTRIVDC 290

Query: 304 HIGK----------KTII------GPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKIN 347
            IG           K++I      GPFAR+R+ T ++K+ +IGNF E+KK+TI EG+K  
Sbjct: 291 EIGNNVKITRSECFKSVIEDDVSVGPFARLREGTILKKSSKIGNFVEIKKSTIGEGTKAQ 350

Query: 348 HLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVA 407
           HLSY+GD+ VGKNVNIGAGTITCNYDG  K  T I + AFIGSNSSL+AP+ IG+G  + 
Sbjct: 351 HLSYIGDAFVGKNVNIGAGTITCNYDGKKKNPTFIEDGAFIGSNSSLVAPVRIGEGALIG 410

Query: 408 SGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           +GS+IT+D P  SL   R+RQ+VKE   L  RK++
Sbjct: 411 AGSVITEDVPPYSLGLGRARQVVKEGWVLKKRKEE 445


>gi|281412598|ref|YP_003346677.1| UDP-N-acetylglucosamine pyrophosphorylase [Thermotoga naphthophila
           RKU-10]
 gi|281373701|gb|ADA67263.1| UDP-N-acetylglucosamine pyrophosphorylase [Thermotoga naphthophila
           RKU-10]
          Length = 445

 Score =  327 bits (837), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 187/455 (41%), Positives = 277/455 (60%), Gaps = 31/455 (6%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A+VLAAG+G RMKS   KVL  ++GKPMI  V+ET A    + V +VLG+ AE + R   
Sbjct: 3   ALVLAAGKGTRMKSKIPKVLHPLSGKPMIEWVVET-AGKVAQKVGVVLGFEAE-LVRKTL 60

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQG 126
           P  + V  ++Q+ Q GTAHAV+ A+D I+PG DDV+I+YGDVPL+S +TLK+ +++  +G
Sbjct: 61  PEWVDV--FVQEEQLGTAHAVMCAKDFIEPG-DDVLILYGDVPLISENTLKRMIEEHRKG 117

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
             + ++  + ++P GYGR+ I++ +   I E+ D  +E + +   N+G     G +++  
Sbjct: 118 ADVTILVADLEDPSGYGRV-IQDGDKYRIIEDADLPEELKSVTTINTGFYVFSGDFLLRV 176

Query: 187 LLQIKKNKVSQEYYLTDII---EKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQS 243
           L +IK      EYYLTD +   EK R+    + + D+   E+ G N R  L  +E   + 
Sbjct: 177 LPEIKNENAKGEYYLTDAVNFAEKVRV----VKTDDL--LEITGVNTRKTLVWLEEQLRM 230

Query: 244 RYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGV 303
           R   +++ +GVT++ P T ++ +   I  DTVI P  F      +    +I   + +   
Sbjct: 231 RKIEELLENGVTILDPATTYIHYSVEIGMDTVIHPMTFIEGRTRVGENCEIGPMTRIVDC 290

Query: 304 HIGK----------KTII------GPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKIN 347
            IG           K++I      GPFAR+R+ T ++K+ +IGNF E+KK+TI EG+K  
Sbjct: 291 EIGNNVKITRSECFKSVIEDDVSVGPFARLREGTILKKSSKIGNFVEIKKSTIGEGTKAQ 350

Query: 348 HLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVA 407
           HLSY+GD+ VGKNVNIGAGTITCNYDG  K  T I + AFIGSNSSL+AP+ IG+G  + 
Sbjct: 351 HLSYIGDAFVGKNVNIGAGTITCNYDGKKKNPTFIEDGAFIGSNSSLVAPVRIGEGALIG 410

Query: 408 SGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           +GS+IT+D P  SL   R+ Q+VKE   L  RK++
Sbjct: 411 AGSVITEDVPPYSLGLGRAMQVVKEGWVLKKRKEE 445


>gi|170289082|ref|YP_001739320.1| UDP-N-acetylglucosamine pyrophosphorylase [Thermotoga sp. RQ2]
 gi|254798817|sp|B1LBD9|GLMU_THESQ RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|170176585|gb|ACB09637.1| UDP-N-acetylglucosamine pyrophosphorylase [Thermotoga sp. RQ2]
          Length = 445

 Score =  326 bits (836), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 187/455 (41%), Positives = 277/455 (60%), Gaps = 31/455 (6%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A+VLAAG+G RMKS   KVL  ++GKPMI  V+ET A    + V +VLG+ AE + R   
Sbjct: 3   ALVLAAGKGTRMKSKIPKVLHPLSGKPMIEWVVET-AGKVAQKVGVVLGFEAE-LVRKTL 60

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQG 126
           P  + V  ++Q+ Q GTAHAV+ A+D I+PG DDV+I+YGDVPL+S +TLK+ +++  +G
Sbjct: 61  PEWVDV--FVQEEQLGTAHAVMCAKDFIEPG-DDVLILYGDVPLISENTLKRMIEEHRKG 117

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
             + ++  + ++P GYGR+ I++ +   I E+ D  +E + +   N+G     G +++  
Sbjct: 118 ADVTILVADLEDPSGYGRV-IQDGDKYRIIEDADLPEELKSVTTINTGFYVFSGDFLLRA 176

Query: 187 LLQIKKNKVSQEYYLTDII---EKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQS 243
           L +IK      EYYLTD +   EK R+    + + D+   E+ G N R  L  +E   + 
Sbjct: 177 LPEIKNENAKGEYYLTDAVNFAEKVRV----VKTDDL--LEITGVNTRKTLVWLEEQLRM 230

Query: 244 RYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGV 303
           R   +++ +GVT++ P T ++ +   I  DTVI P  F      +    +I   + +   
Sbjct: 231 RKIEELLENGVTILDPATTYIHYSVEIGMDTVIHPMTFIEGKSRVGENCEIGPMTRIVDC 290

Query: 304 HIGK----------KTII------GPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKIN 347
            IG           K++I      GPFAR+R+ T ++K+ +IGNF E+KK+TI EG+K  
Sbjct: 291 EIGNNVKITRSECFKSVIEDDVSVGPFARLREGTILKKSSKIGNFVEIKKSTIGEGTKAQ 350

Query: 348 HLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVA 407
           HLSY+GD+ VGKNVNIGAGTITCNYDG  K  T I + AFIGSNSSL+AP+ IG+G  + 
Sbjct: 351 HLSYIGDAFVGKNVNIGAGTITCNYDGKKKNPTFIEDGAFIGSNSSLVAPVRIGEGALIG 410

Query: 408 SGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           +GS+IT+D P  SL   R+ Q+VKE   L  RK++
Sbjct: 411 AGSVITEDVPPYSLGLGRAMQVVKEGWVLKKRKEE 445


>gi|148654078|ref|YP_001281171.1| UDP-N-acetylglucosamine pyrophosphorylase [Psychrobacter sp.
           PRwf-1]
 gi|172048589|sp|A5WHT0|GLMU_PSYWF RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|148573162|gb|ABQ95221.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase [Psychrobacter
           sp. PRwf-1]
          Length = 455

 Score =  326 bits (836), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 178/462 (38%), Positives = 272/462 (58%), Gaps = 28/462 (6%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M      I+LAAG+G RM+S+  KVLQ +A KP+++HV++T  +  ++   +V G+G ++
Sbjct: 1   MNNTLTTIILAAGKGTRMQSAKPKVLQILADKPLLAHVLDTCQSISVDKTIVVYGFGGDQ 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           + +     +L+  +  Q  Q GT HAV  A D + P     +I+YGDVPLVS+ TL +  
Sbjct: 61  VQQAMTDYSLT--WVEQTEQLGTGHAVKVALDEL-PSTGKSLILYGDVPLVSAETLSRLK 117

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNE---IIAIREENDATDEERKIHYCNSGLMA 177
               QG S+  +    DNP G GR  IK +E   I AI E+ DA+++E+ I   NSG+  
Sbjct: 118 QANVQGMSM--LTLTVDNPFGLGR--IKRDEQGNITAIVEQKDASEQEQAIREINSGIYC 173

Query: 178 IDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVK-EQEVCGCNNRYELSL 236
           +D   +  +L  +  +   QEYYLTDI++ A  DG +IA+I+   E E+ G NNR +L+ 
Sbjct: 174 VDNALLHQYLPNLSNDNAQQEYYLTDIVKMAVADGIAIAAIEPDYEFEIEGVNNRQQLAQ 233

Query: 237 IENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRA 296
           +E  WQ++    + + GV    P  V +  +  +  D  ++ +V F   VS+ N V I A
Sbjct: 234 LERKWQAKLVEDLQVQGVQFADPNRVDIRGEVSVGQDVFVDINVVFKGKVSLGNNVTIEA 293

Query: 297 -----------------FSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKAT 339
                            +   +   + +   IGPFA +R +T +EKN R+GNF E+KK+ 
Sbjct: 294 GCMIKDSQIGDNVHIKPYCVFDDAQVAQGATIGPFAHLRPQTVLEKNTRLGNFVEIKKSR 353

Query: 340 IKEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPIT 399
           I EGSK+NHLSYVGD+ +G  VN GAG ITCNYDG +K++T + +NAFIG+N+SL+AP+T
Sbjct: 354 IGEGSKVNHLSYVGDAQIGAGVNFGAGAITCNYDGVNKHQTIVGDNAFIGTNTSLVAPVT 413

Query: 400 IGQGTYVASGSIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           IGQ   + +GS+IT++  +N+L   R RQ+ K++     +KK
Sbjct: 414 IGQTATIGAGSVITKNVEDNALAIGRGRQVQKDNYQRPEKKK 455


>gi|289579386|ref|YP_003478013.1| UDP-N-acetylglucosamine pyrophosphorylase [Thermoanaerobacter
           italicus Ab9]
 gi|289529099|gb|ADD03451.1| UDP-N-acetylglucosamine pyrophosphorylase [Thermoanaerobacter
           italicus Ab9]
          Length = 453

 Score =  325 bits (834), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 189/455 (41%), Positives = 269/455 (59%), Gaps = 23/455 (5%)

Query: 6   LAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRIN 65
           + ++LAAG G RMKS   KV+ K+ GKPMI  V++ +   G   V +V+G+ AEE+  + 
Sbjct: 1   MTLILAAGLGKRMKSKHPKVVHKVCGKPMIEWVVDAVEEIGSSEVIVVVGHKAEEVKEV- 59

Query: 66  FPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMD-KIA 124
                 V+Y  Q  Q GT HAV+ A+D + P   +V+I+ GD PL++S+TLK+ ++  I 
Sbjct: 60  --LKERVKYAYQQVQLGTGHAVMMAEDLL-PDEGNVLILTGDTPLITSNTLKELINFHIK 116

Query: 125 QGYSIAVVGFNADNPKGYGRLL-IKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
           +G S+ ++    ++P GYGR++  ++  +I I E+ DAT+EE++IH  NS +  +D   +
Sbjct: 117 EGNSVTILSSVLEDPTGYGRIIRDRSGNVIKIVEDKDATEEEKRIHEINSAMYVMDIAKL 176

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQS 243
              L +I  N    EYYLTD +E  R  G  I +  V  +E+ G N+R +L   E I + 
Sbjct: 177 KKALRRITNNNAQGEYYLTDAVEIIRDMGGKIGAFTVSSEEITGVNSRVQLFEAEKIMRK 236

Query: 244 RYRRQMMISGVTMIAPETVFLSHD------TIIQPDTVIEPHVFFGCGVSIENYVQIRAF 297
           R   + M +GVT++ PET ++  D      TII P  VIE     G    I    +I   
Sbjct: 237 RINYRHMENGVTIVDPETTYIGADVEIGADTIIMPGCVIEGKTKIGSDCEIGPNCRIVDS 296

Query: 298 SYLEGVHIGKKTI----------IGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKIN 347
              +G  I    I          IGPFA IR ET I+ NV+IG+F EVKK+ I EGSK+ 
Sbjct: 297 EIGDGCSIMYSVILSSKIKNNVKIGPFAHIRPETVIQSNVKIGDFVEVKKSIIDEGSKVP 356

Query: 348 HLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVA 407
           HL+YVGD+ +GKNVN+G G+IT NYDG  KYKT I +N F+G N +L+AP+ IG   YVA
Sbjct: 357 HLTYVGDAEIGKNVNMGCGSITVNYDGKQKYKTIIGDNVFVGCNVNLVAPVKIGSNAYVA 416

Query: 408 SGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           +GS IT++ PE +L  ARSRQ  KE G +  R KK
Sbjct: 417 AGSTITENVPEGALAIARSRQTNKE-GWVQERIKK 450


>gi|329889471|ref|ZP_08267814.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Brevundimonas diminuta ATCC 11568]
 gi|328844772|gb|EGF94336.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Brevundimonas diminuta ATCC 11568]
          Length = 454

 Score =  325 bits (834), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 167/428 (39%), Positives = 244/428 (57%), Gaps = 5/428 (1%)

Query: 5   RLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRI 64
           R AI+LAAG+G RMKS   KVL  +  + M+ H ++   A G E + +V+G  + E+ R 
Sbjct: 11  RAAIILAAGQGTRMKSPLPKVLHPVGARAMLDHAIDAAEALGCERIVVVVGAHSPEV-RA 69

Query: 65  NFPPTLSVEY-YIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKI 123
           +    L  +   +QD   GT HAV  A+  +      V++ YGDVPL+ +  ++      
Sbjct: 70  HVEKRLGADSIAVQDPPLGTGHAVRAAEAVLGDFVGHVVVTYGDVPLLKAADIEPVF--- 126

Query: 124 AQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
           A    + V+GF A +P  YGRL++  + ++AI E  +A+ E   +  CNSG+MA     +
Sbjct: 127 AAHEGVTVIGFEARDPGAYGRLILDGDSLVAITEAKEASAEVLAVTACNSGVMAAPVGLL 186

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQS 243
            + L ++  +    EYYLTD++E AR  G    ++   E  V G N + EL+  E ++Q 
Sbjct: 187 FELLSEVTNDNAKGEYYLTDVVELARKRGAPTRAVFAAEDSVMGVNAQGELAQAEALFQK 246

Query: 244 RYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGV 303
             R   +  GVTM AP+TV  + DT I     IEP V FG G  +    +IR+FS++EG 
Sbjct: 247 TQREHFLAQGVTMSAPDTVHFAWDTDIGAGATIEPFVVFGPGAKVAEGARIRSFSHIEGA 306

Query: 304 HIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNI 363
            +     +GP+AR+R    + + V+IGNF EVK   +  G+K NHL+Y+GD  VG   NI
Sbjct: 307 KVATGAEVGPYARLRPGADLGEGVKIGNFVEVKNVRMDAGAKANHLAYLGDGEVGAKANI 366

Query: 364 GAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVF 423
           GAGTI CNYDG  K +T + E AF+GSNSSL+AP+TIG G  V SGS++T+D     L  
Sbjct: 367 GAGTIFCNYDGFFKQRTTVGEGAFVGSNSSLVAPVTIGAGAMVGSGSVVTKDVAPGDLAL 426

Query: 424 ARSRQIVK 431
            R+ Q +K
Sbjct: 427 GRAEQTMK 434


>gi|15644377|ref|NP_229429.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Thermotoga maritima MSB8]
 gi|81625470|sp|Q9X1W4|GLMU_THEMA RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|4982202|gb|AAD36696.1|AE001806_6 UDP-N-acetylglucosamine pyrophosphorylase [Thermotoga maritima
           MSB8]
          Length = 445

 Score =  325 bits (833), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 186/455 (40%), Positives = 277/455 (60%), Gaps = 31/455 (6%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A+VLAAG+G RMKS   KVL  ++G+PMI  V+ET A    + V +VLG+ AE + R   
Sbjct: 3   ALVLAAGKGTRMKSKIPKVLHPLSGRPMIEWVIET-AGKVAQKVGVVLGFEAE-LVRKAL 60

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQG 126
           P  + V  ++Q  Q GTAHAV+ A+D I+PG DDV+I+YGDVPL+S +TLK+ +++  +G
Sbjct: 61  PEWVDV--FVQGEQLGTAHAVMCAKDFIEPG-DDVLILYGDVPLISENTLKRMIEEHRKG 117

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
             + ++  + ++P GYGR+ I++ +   I E+ D  +E + +   N+G     G +++  
Sbjct: 118 ADVTILVADLEDPSGYGRV-IQDGDKYRIIEDTDLPEELKSVTTINTGFYVFSGDFLLRA 176

Query: 187 LLQIKKNKVSQEYYLTDII---EKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQS 243
           L +IK      EYYLTD +   EK R+    + + D+   E+ G N R  L  +E   + 
Sbjct: 177 LPEIKNENAKGEYYLTDAVNFAEKVRV----VRTDDL--LEITGVNTRKTLVWLEEQLRM 230

Query: 244 RYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGV 303
           R   +++ +GVT++ P T ++ +   I  DTVI P  F      +    +I   + +   
Sbjct: 231 RKIEELLENGVTILDPATTYIHYSVEIGMDTVIYPMTFIEGKSRVGENCEIGPMTRIVDC 290

Query: 304 HIGK----------KTII------GPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKIN 347
            IG           K++I      GPFAR+R+ T ++K+ +IGNF E+KK+TI EG+K  
Sbjct: 291 EIGNNVKITRSECFKSVIEDDVSVGPFARLREGTILKKSSKIGNFVEIKKSTIGEGTKAQ 350

Query: 348 HLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVA 407
           HLSY+GD+ VGKNVN+GAGTITCNYDG  K  T I + AFIGSNSSL+AP+ IG+G  + 
Sbjct: 351 HLSYIGDAFVGKNVNVGAGTITCNYDGKKKNPTFIEDGAFIGSNSSLVAPVRIGKGALIG 410

Query: 408 SGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           +GS+IT+D P  SL   R+RQ+VKE   L  RK++
Sbjct: 411 AGSVITEDVPPYSLGLGRARQVVKEGWVLKKRKEE 445


>gi|154249292|ref|YP_001410117.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Fervidobacterium nodosum Rt17-B1]
 gi|171769328|sp|A7HKM7|GLMU_FERNB RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|154153228|gb|ABS60460.1| UDP-N-acetylglucosamine pyrophosphorylase [Fervidobacterium nodosum
           Rt17-B1]
          Length = 452

 Score =  325 bits (833), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 181/451 (40%), Positives = 272/451 (60%), Gaps = 27/451 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG G RMKS   KV+ KI GKPMI+ V++   A G   V +V+G+ A+ I +   P
Sbjct: 4   LILAAGLGKRMKSKYPKVVHKILGKPMINWVVDLGKAFG--EVGVVVGHKAD-IVKSYLP 60

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKK-AMDKIAQG 126
               V+ Y+Q+ Q GT HAV+ A+D I    +D++++YGDVPL+S  T+ K   +   Q 
Sbjct: 61  E--DVKTYLQEPQLGTGHAVMCARDFISEN-EDLLVLYGDVPLLSKETINKLKKEHEEQK 117

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
             + V+ F  DNP GYGR+ I+ N  + I E+ DAT+EE+KI   NSG+    G ++++ 
Sbjct: 118 NQVTVLTFVTDNPAGYGRI-IRENGKVRIVEDKDATEEEKKIKEVNSGIYIFSGKFVLEN 176

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYR 246
           L ++  N    EYYLTD++  A      I    V   EV G N+R +L+ +E I + R  
Sbjct: 177 LDKLSNNNAQGEYYLTDLVGMAERSSTVILEDIV---EVSGVNDRIQLAQLETIAKQRIL 233

Query: 247 RQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIG 306
            ++M+SGVT++ P + F+  D  I  DT+I P         I    ++  +S++   +IG
Sbjct: 234 EKLMLSGVTIVDPNSTFIGPDVEIGMDTIIYPFTIIEGYTKIGEDCEVGPYSHIVDSNIG 293

Query: 307 K----------------KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLS 350
                            K  +GPF+R+R+ T +++ V+IGNF E KK T+ + SK  HL+
Sbjct: 294 NEVKVIRSEVEKSVIENKVSVGPFSRLREGTVLKEKVKIGNFVETKKTTVGKNSKAQHLT 353

Query: 351 YVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGS 410
           Y+GD+ +G++VN+GAGTITCNYDG  KY T+I + AFIGSNSSL+AP+ IG+G    +GS
Sbjct: 354 YLGDATIGEDVNVGAGTITCNYDGYKKYPTYIGDGAFIGSNSSLVAPVNIGKGAITGAGS 413

Query: 411 IITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           +IT+D P ++L   R+RQI+KE  A   R++
Sbjct: 414 VITEDVPNDALALGRARQIIKEGWAKKKREE 444


>gi|138893722|ref|YP_001124175.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Geobacillus thermodenitrificans
           NG80-2]
 gi|166226099|sp|A4IJC6|GLMU_GEOTN RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|134265235|gb|ABO65430.1| Glucosamine-1-phosphate acetyltransferase [Geobacillus
           thermodenitrificans NG80-2]
          Length = 459

 Score =  325 bits (832), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 184/459 (40%), Positives = 267/459 (58%), Gaps = 24/459 (5%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR 63
           KR A++LAAG+G RMKS   KVL  + GKPM+ HV++ ++  G+E    V+G+GAE++  
Sbjct: 3   KRYAVILAAGQGTRMKSKLYKVLHPVCGKPMVQHVVDQVSKLGVEKTIAVVGFGAEQVKE 62

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK- 122
                    EY +Q+ Q GTAHAV+ A   ++      I++ GD PL+++ T++  ++  
Sbjct: 63  ---QLGAQCEYALQEKQLGTAHAVMQAAPHLQNLEGITIVVCGDTPLITAETMEALLEHH 119

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNE--IIAIREENDATDEERKIHYCNSGLMAIDG 180
           +  G    V+   AD+P GYGR+ ++N++  +  I E  DA ++ER+I   N+G    D 
Sbjct: 120 MTAGAKATVLTAIADDPTGYGRI-VRNSDGHVEKIVEHKDANEQEREIREINTGTYCFDN 178

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIEN 239
             +   L ++  N    EYYLTD+IE  + DG  +++       E  G N+R  L+  E 
Sbjct: 179 RMLFQALTKVTNNNAQGEYYLTDVIEIIKADGGIVSAYQAPSFDETIGINDRIALAEAER 238

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLS------HDTIIQPDTVIEPHVFFGCGVSIENYVQ 293
           I + R  RQ M +GVT+I P   ++S       DT+I P TVIE     G   +I  + +
Sbjct: 239 IMRDRICRQHMKNGVTIIDPACTYISAEATIGRDTVIYPGTVIEGKTVIGEDCTIGPHSE 298

Query: 294 IR----------AFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG 343
           I+            S      IG    IGPFA IR  + I+  VRIGNF EVKK+T  +G
Sbjct: 299 IKNCHIGHRTSIRHSVAHDSEIGDDVTIGPFAHIRPLSKIDDEVRIGNFVEVKKSTFGKG 358

Query: 344 SKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQG 403
           SK +HLSY+GD+ VG +VN+G G+IT NYDG HKY+T I + AFIG N++LIAP+TIGQG
Sbjct: 359 SKASHLSYIGDAEVGADVNLGCGSITVNYDGVHKYRTKIEDGAFIGCNANLIAPVTIGQG 418

Query: 404 TYVASGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
            YVA+GS +T D P  +L   R+RQ+ KE+    +R KK
Sbjct: 419 AYVAAGSTVTDDVPGRALAIGRARQVNKENYVDRLRGKK 457


>gi|258545328|ref|ZP_05705562.1| UDP-N-acetylglucosamine diphosphorylase [Cardiobacterium hominis
           ATCC 15826]
 gi|258519431|gb|EEV88290.1| UDP-N-acetylglucosamine diphosphorylase [Cardiobacterium hominis
           ATCC 15826]
          Length = 457

 Score =  325 bits (832), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 176/444 (39%), Positives = 262/444 (59%), Gaps = 21/444 (4%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR 63
           K LA++LAAG+G RM S+  KVLQ + GK MI H++ET+        A++ G+  E++  
Sbjct: 2   KTLALILAAGQGKRMHSAQPKVLQPVGGKAMIVHLLETLQTLAPTRSAVIYGHQGEQLRA 61

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKI 123
              P    + +  Q  Q+GT HAV  A D I    + V+I+YGD PLV + TL++ +D  
Sbjct: 62  CIAPAWPQLRWIAQTEQRGTGHAVRMALDEIAQA-ELVLILYGDTPLVRAETLQRLLDA- 119

Query: 124 AQGYSIAVVGFNADNPKGYGRLLI-KNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           A+    A++   ADNP GYGR++     E+ AI EE DA+D ER I   N+G+MA+   Y
Sbjct: 120 ARHNGFALLTAVADNPFGYGRIVRDAAGEMTAIVEEKDASDAERAIREINTGMMAVKNEY 179

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIW 241
           +  +L Q++ +  + E+YLTD+I      G  + ++   +  E  G N R + +  E +W
Sbjct: 180 LARYLPQLQDDNAAGEFYLTDVIALHVAAGWRVVTVPATDTAETLGINTRAQQAQAEAVW 239

Query: 242 QSRYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGVSIENY---- 291
           + R  + ++ +GVT+I P       TV   HD +I+ + V++  V  G  V IE+     
Sbjct: 240 RQRQAQALLAAGVTLIDPARIDVHGTVSAGHDVVIEANVVLKGTVRLGDNVYIESGCVLD 299

Query: 292 -------VQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGS 344
                   +I + S LE   +G    +GPFAR+R +T + + VRIGNF E K A +  GS
Sbjct: 300 NCTIASGARIYSHSRLEHCEVGANAQVGPFARLRPKTVLAEGVRIGNFVETKAAHVGRGS 359

Query: 345 KINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGT 404
           KINHLSY+GD+ +G  VNIGAGTITCNYDG +K++T + +  FIGSNS+L+AP+ IG G 
Sbjct: 360 KINHLSYIGDATLGSAVNIGAGTITCNYDGANKHQTILGDRVFIGSNSALVAPVRIGDGA 419

Query: 405 YVASGSIITQDTPENSLVFARSRQ 428
            + +GS+IT+D P+  L  +RS Q
Sbjct: 420 TIGAGSVITRDVPDEQLALSRSEQ 443


>gi|78486500|ref|YP_392425.1| UDP-N-acetylglucosamine pyrophosphorylase [Thiomicrospira crunogena
           XCL-2]
 gi|109892129|sp|Q31DM2|GLMU_THICR RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|78364786|gb|ABB42751.1| UDP-N-acetylglucosamine pyrophosphorylase / glucosamine-1-phosphate
           N-acetyltransferase [Thiomicrospira crunogena XCL-2]
          Length = 454

 Score =  325 bits (832), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 177/444 (39%), Positives = 266/444 (59%), Gaps = 28/444 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM+S+  KVLQ +A KP++SHV+ T      E +  V+G+GA+ +  ++  
Sbjct: 6   IILAAGKGTRMRSNLPKVLQPLAQKPLLSHVISTAQKLTNEPIITVIGHGAQRV--VDVI 63

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAMDKIA 124
            T  ++Y  Q  Q GT HAV+       P Y+D   V+I+YGDVPL   +TL   ++ + 
Sbjct: 64  GTDGIQYAEQLEQLGTGHAVVQG----NPHYNDDDTVLILYGDVPLTQQNTLTDLLNLVD 119

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNNEII-AIREENDATDEERKIHYCNSGLMAIDGLYI 183
             + +A++    DNP GYGR++   + ++ AI EE DA+ E++ +   N+G+MA+ G Y+
Sbjct: 120 DIHPLALLTITLDNPSGYGRIVRNQHHLVQAIVEEKDASFEQKAVQEVNTGMMAVKGYYL 179

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASID-VKEQEVCGCNNRYELSLIENIWQ 242
             WL Q+  +    EYYLTDIIE    DG  + +     E EV G NN+ +L  +E  +Q
Sbjct: 180 KKWLGQLSNSNAQGEYYLTDIIEMCVQDGFEVHTTQPASEMEVLGVNNKSQLQSLERQYQ 239

Query: 243 SRYRRQMMISGVTMI------------APETVFLSHDTIIQPDTVIEPHVFFGCGVSIEN 290
           ++   ++M  GVT++              + V L  + I +   V+E HV  G    I+N
Sbjct: 240 AQLAEELMEQGVTVLDASRIDIRGDLTVGQDVTLDVNVIFEGTVVLEDHVSIGPNCVIKN 299

Query: 291 YV-----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
            V     +I++FS++E   IG+   IGP+AR+R  T +   V+IGNF E KK  I  GSK
Sbjct: 300 AVIKSGTEIKSFSHIEDAQIGQNCEIGPYARLRPGTELSTGVKIGNFVETKKVQIGSGSK 359

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
           +NHLSY+GD+ +G  VNIGAGTITCNYDG +K++T I +N FIGS+S L+AP+TI     
Sbjct: 360 VNHLSYIGDTEMGAGVNIGAGTITCNYDGVNKHQTVIGDNVFIGSDSQLVAPVTIESDAT 419

Query: 406 VASGSIITQDTPENSLVFARSRQI 429
           + +GS IT+D P  +L  +RS+Q+
Sbjct: 420 IGAGSTITKDAPAGTLTLSRSKQL 443


>gi|332143276|ref|YP_004429014.1| bifunctional N-acetyl glucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate acetyl
           [Alteromonas macleodii str. 'Deep ecotype']
 gi|254798702|sp|B4S0Y2|GLMU_ALTMD RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|327553298|gb|AEB00017.1| bifunctional N-acetyl glucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate acetyl
           [Alteromonas macleodii str. 'Deep ecotype']
          Length = 452

 Score =  324 bits (831), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 177/439 (40%), Positives = 261/439 (59%), Gaps = 22/439 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           +VLAAG+G RMKSS  KVL K+ G PM+  ++ T+ + G +N+ LV G+G +++      
Sbjct: 6   VVLAAGKGTRMKSSLPKVLHKVGGVPMVQRIINTVRSLGADNIHLVYGHGGDQLKATVVE 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HAV  A   I    +DV+I+ GD PL+   TL  A+  + +  
Sbjct: 66  ENLN--WCLQAEQLGTGHAVQQAAPHINDD-EDVLILVGDAPLIREDTLS-ALKAVKESC 121

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            +A++  N D+P G GR++ +N+ I AI E  DAT+ +R I   N+G+M + G  +  WL
Sbjct: 122 DLALLTVNLDDPTGMGRIIRENDNITAIVEHKDATEAQRAIKEINTGMMMMSGADLKRWL 181

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRYR 246
            ++  +    EYYLTD+I  A  +GK I S   +   EV G NNR +L+ +E   Q+R  
Sbjct: 182 GELSNDNAQGEYYLTDVIAMAASEGKRIQSAQPQSAVEVEGVNNRLQLANLERALQNRQA 241

Query: 247 RQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGV-----------SIE 289
            ++M +GVT++ P       T+   +D II  + ++E  V  G  V           +I 
Sbjct: 242 DELMTNGVTLLDPSRFDLRGTLQTGNDVIIDVNVIVEGDVTLGNNVEIGANCILRNCTIA 301

Query: 290 NYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
           +   I A S +E   +G+   +GP+AR+R    ++KN ++GNF E+KKA + EG+K NHL
Sbjct: 302 DNAVIEANSIIEEARVGEACTVGPYARLRPGAVMQKNAKVGNFVEMKKAVLGEGAKANHL 361

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ VG   NIGAGTITCNYDG +K KT I ENAFIGSNSSL+AP+ IG+G  V +G
Sbjct: 362 TYLGDAEVGAKANIGAGTITCNYDGVNKSKTVIGENAFIGSNSSLVAPVNIGKGATVGAG 421

Query: 410 SIITQDTPENSLVFARSRQ 428
           S+IT    E +L  AR +Q
Sbjct: 422 SVITSTVDEAALAVARGKQ 440


>gi|196250763|ref|ZP_03149450.1| UDP-N-acetylglucosamine pyrophosphorylase [Geobacillus sp. G11MC16]
 gi|196209713|gb|EDY04485.1| UDP-N-acetylglucosamine pyrophosphorylase [Geobacillus sp. G11MC16]
          Length = 459

 Score =  324 bits (830), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 184/459 (40%), Positives = 267/459 (58%), Gaps = 24/459 (5%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR 63
           KR A++LAAG+G RMKS   KVL  + GKPM+ HV++ ++  G+E    V+G+GAE++  
Sbjct: 3   KRYAVILAAGQGTRMKSKLYKVLHPVCGKPMVQHVVDQVSKLGVEKTIAVVGFGAEQVKE 62

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK- 122
                    EY +Q+ Q GTAHAV+ A   ++      I++ GD PL+++ T++  ++  
Sbjct: 63  ---QLGAQCEYALQEKQLGTAHAVMQAAPHLQNLEGITIVVCGDTPLITAETMEALLEHH 119

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNE--IIAIREENDATDEERKIHYCNSGLMAIDG 180
           +  G    V+   AD+P GYGR+ ++N++  +  I E  DA ++ER+I   N+G    D 
Sbjct: 120 MTAGAKATVLTAIADDPTGYGRI-VRNSDGHVEKIVEHKDANEQEREIREINTGTYCFDN 178

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIEN 239
             +   L ++  N    EYYLTD+IE  + DG  +++       E  G N+R  L+  E 
Sbjct: 179 RMLFQALTKVTNNNAQGEYYLTDVIEIIKADGGIVSAYQAPSFDETIGINDRIALAEAER 238

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLS------HDTIIQPDTVIEPHVFFGCGVSIENYVQ 293
           I + R  RQ M +GVT+I P   ++S       DT+I P TVIE     G   +I  + +
Sbjct: 239 IMRDRICRQHMKNGVTIIDPACTYISAEATIGRDTVIYPGTVIEGETVIGEDCTIGPHSE 298

Query: 294 IR----------AFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG 343
           I+            S      IG    IGPFA IR  + I+  VRIGNF EVKK+T  +G
Sbjct: 299 IKNCHIGHRTSIRHSVAHDSEIGDDVTIGPFAHIRPLSKIDDEVRIGNFVEVKKSTFGKG 358

Query: 344 SKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQG 403
           SK +HLSY+GD+ VG +VN+G G+IT NYDG HKY+T I + AFIG NS+LIAP+TIGQG
Sbjct: 359 SKASHLSYIGDAEVGADVNLGCGSITVNYDGVHKYRTKIEDGAFIGCNSNLIAPVTIGQG 418

Query: 404 TYVASGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
            YVA+GS +T + P  +L   R+RQ+ KE+    +R KK
Sbjct: 419 AYVAAGSTVTDNVPGRALAIGRARQVNKENYVDRLRGKK 457


>gi|297545527|ref|YP_003677829.1| UDP-N-acetylglucosamine pyrophosphorylase [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
 gi|296843302|gb|ADH61818.1| UDP-N-acetylglucosamine pyrophosphorylase [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
          Length = 453

 Score =  323 bits (828), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 188/455 (41%), Positives = 268/455 (58%), Gaps = 23/455 (5%)

Query: 6   LAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRIN 65
           + ++LAAG G RMKS   KV+ K+ GKPMI  V++ +   G   V +V+G+ AEE+  + 
Sbjct: 1   MTLILAAGLGKRMKSKHPKVVHKVCGKPMIEWVVDAVEEIGSSEVIVVVGHKAEEVKEV- 59

Query: 66  FPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMD-KIA 124
                 V+Y  Q  Q GT HAV+ A+D + P   +V+I+ GD PL++S+TLK+ ++  I 
Sbjct: 60  --LKERVKYAYQQVQLGTGHAVMMAEDLL-PDEGNVMILTGDTPLITSNTLKELINFHIK 116

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNN-EIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
           +G S+ ++    ++P GYGR++   N  +I I E+ DAT+EE++IH  NS +  +D   +
Sbjct: 117 EGNSVTILSSVLEDPTGYGRIIRDGNGNVIKIVEDKDATEEEKRIHEINSAMYVMDIPKL 176

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQS 243
              L +I  N    EYYLTD +E  R  G  I +  V  +E+ G N+R +L   E I + 
Sbjct: 177 KKALRRITNNNAQGEYYLTDAVEIIRDMGGKIVAFTVSSEEITGVNSRVQLFEAEKIMRK 236

Query: 244 RYRRQMMISGVTMIAPETVFLSHD------TIIQPDTVIEPHVFFGCGVSIENYVQIRAF 297
           R   + M +GVT++ PET ++  D      TII P  VIE     G    I    +I   
Sbjct: 237 RINYRHMENGVTIVDPETTYIGADVEIGADTIIMPGCVIEGKTKIGSDCEIGPNCRIVDS 296

Query: 298 SYLEGVHIGKKTI----------IGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKIN 347
              +G  I    I          IGPFA IR ET I+ NV+IG+F E+KK+ I EGSK+ 
Sbjct: 297 EIGDGCSIMYSVILSSKIKNNVKIGPFAHIRPETVIQSNVKIGDFVEIKKSIIDEGSKVP 356

Query: 348 HLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVA 407
           HL+YVGD+ +GKNVN+G G+IT NYDG  K+KT I +N F+G N +L+AP+ IG   YVA
Sbjct: 357 HLTYVGDAEIGKNVNMGCGSITVNYDGKQKHKTIIGDNVFVGCNVNLVAPVKIGSNAYVA 416

Query: 408 SGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           +GS IT++ PE +L  ARSRQ  KE G +  R KK
Sbjct: 417 AGSTITENVPEGALAIARSRQTNKE-GWVQERIKK 450


>gi|85712585|ref|ZP_01043632.1| N-acetylglucosamine-1-phosphate uridyltransferase [Idiomarina
           baltica OS145]
 gi|85693576|gb|EAQ31527.1| N-acetylglucosamine-1-phosphate uridyltransferase [Idiomarina
           baltica OS145]
          Length = 456

 Score =  323 bits (828), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 180/441 (40%), Positives = 254/441 (57%), Gaps = 24/441 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM+SS  KVL K+A KPM+ HV++         + LV G+G E++      
Sbjct: 6   IILAAGKGTRMRSSLPKVLHKVAHKPMVQHVIDCAKVLKPHAINLVYGHGGEQLKA--HV 63

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
              S+ +  Q  Q GT HAV    D + P  + V I+YGDVPL++  TL K +D +A   
Sbjct: 64  SDSSLVWNEQKEQLGTGHAVQQVMDELLPD-EKVAILYGDVPLLTPETLSKLLD-VATRT 121

Query: 128 SIAVVGFNADNPKGYGRLLIK--NNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMD 185
            + ++    D+P GYGR++       I+ I E+ DA+DEE +++  N+G+M   G  +  
Sbjct: 122 DLGLLTMKLDDPSGYGRIIRDKATQRIVGIVEQKDASDEELQVNEVNTGIMVASGDALKR 181

Query: 186 WLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSR 244
           WL  +  N   QEYYLTDI+  A  +G  IAS    E  EV G NNR +L+ +E  +Q R
Sbjct: 182 WLGALDNNNAQQEYYLTDIVAMAASEGVDIASTQPGETNEVEGANNRIQLASLERAYQQR 241

Query: 245 YRRQMMISGVTMIAP------ETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIR--- 295
             R +M  G T++ P       +V +  D +I  + V E HV  G GV IE    IR   
Sbjct: 242 VARDLMTQGATLMDPMRFDVRGSVVVGEDVVIDVNVVFEGHVELGNGVVIEPNCVIRNAK 301

Query: 296 --------AFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKIN 347
                   A S++E  HI     +GPFAR+R    +E+   +GNF E+KK  + EGSK N
Sbjct: 302 IGANTVIKANSHIEDAHIETDCQVGPFARLRPGAIMERGALVGNFVEMKKTRLGEGSKAN 361

Query: 348 HLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVA 407
           HL+Y+GD+ +GK  NIGAGTITCNYDG +K KT I + AFIGSNSSL+AP+ IG+   + 
Sbjct: 362 HLTYLGDTEIGKQANIGAGTITCNYDGVNKSKTEIGDGAFIGSNSSLVAPVKIGKEATIG 421

Query: 408 SGSIITQDTPENSLVFARSRQ 428
           +GS++T+D  +  L  AR +Q
Sbjct: 422 AGSVVTRDVEDQQLAVARGKQ 442


>gi|307823037|ref|ZP_07653267.1| UDP-N-acetylglucosamine pyrophosphorylase [Methylobacter
           tundripaludum SV96]
 gi|307735812|gb|EFO06659.1| UDP-N-acetylglucosamine pyrophosphorylase [Methylobacter
           tundripaludum SV96]
          Length = 488

 Score =  322 bits (826), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 179/445 (40%), Positives = 273/445 (61%), Gaps = 30/445 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIEN--VALVLGYGAEEITRIN 65
           I+LAAG+G RM+S   K+L KIA +P++ HV +T  A  +EN  + +V+G+GA+++T   
Sbjct: 6   IILAAGKGTRMRSELPKILHKIANRPLLQHVYDT--AKHLENNTIKIVVGHGADQVTE-- 61

Query: 66  FPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQ 125
               L  ++  Q  Q GT HAV    D I    D+V+I+YGDVPL+   T++  ++ +  
Sbjct: 62  ALKNLDADWIEQKQQLGTGHAVQQVSDQIADS-DNVLILYGDVPLLKLATIRLLINNV-N 119

Query: 126 GYSIAVVGFNADNPKGYGRLLIKN--NEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
             S+A++  N  NP GYGR+ ++N   ++  I EE DA   E++I+  N+G+MA+ G  +
Sbjct: 120 DQSLALLTVNLANPAGYGRI-VRNAAGQVTKIVEEKDAALSEKQINEVNTGIMAVQGKQL 178

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVK-EQEVCGCNNRYELSLIENIWQ 242
             WL Q+  + V  EYYLTD+IE A  D  +I +   + E EV G NNR +LS +E ++Q
Sbjct: 179 KKWLSQLNNSNVQGEYYLTDVIEMAVADQINIVTSQPETEDEVLGVNNRIQLSHLERVYQ 238

Query: 243 SRYRRQMMISGVTMIAP-------------ETVFLSHDTIIQPDTVIEPHVFFGCGVSIE 289
                 +M  GVT+  P             + + +  + I++    I  +V  G    I+
Sbjct: 239 QEQANSLMEQGVTLKDPMRFDQRGSIESLGQDIEIDINVILEGKNSIGSNVKIGANTQIK 298

Query: 290 N-----YVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGS 344
           N     YV+I A   +E   IG+ + IGP+AR+R E+ +  +V IGNF E+KK+++  GS
Sbjct: 299 NSIIGDYVEILANCVIEDAVIGQGSRIGPYARLRPESVLANDVHIGNFVEIKKSSVAAGS 358

Query: 345 KINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGT 404
           KINHLSY+GD+ VG  VNIGAGTITCNYDG +K++T I + AFIGS++ L+AP+TIG+  
Sbjct: 359 KINHLSYIGDTTVGSKVNIGAGTITCNYDGVNKFRTVIEDGAFIGSDTQLVAPVTIGRNA 418

Query: 405 YVASGSIITQDTPENSLVFARSRQI 429
            + +GS IT+D+PEN L  +R++Q+
Sbjct: 419 TIGAGSTITKDSPENQLTLSRAKQM 443


>gi|261856897|ref|YP_003264180.1| UDP-N-acetylglucosamine pyrophosphorylase [Halothiobacillus
           neapolitanus c2]
 gi|261837366|gb|ACX97133.1| UDP-N-acetylglucosamine pyrophosphorylase [Halothiobacillus
           neapolitanus c2]
          Length = 462

 Score =  322 bits (825), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 183/456 (40%), Positives = 272/456 (59%), Gaps = 25/456 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           +VLAAG+G RM+S+  KVL  +AG+ M+  V++   +    ++ +V+GYGAE I +    
Sbjct: 9   VVLAAGKGTRMRSAKPKVLHPLAGRSMLDRVLDVAESLDPASLHVVIGYGAEHIRQ--HC 66

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIK-PGYDDVIIMYGDVPLVSSHTLKKAMDKIAQG 126
           P   V +  Q  Q+GT HAV  A   I+    D V+++YGDVPL+ ++ L   +   A  
Sbjct: 67  PRPGVSWVEQREQRGTGHAVACAVAVIQGQSGDRVLVLYGDVPLLDANVLSSLLGS-AHS 125

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNE--IIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
             +AV+    D+P GYGR+ I+++E  +IAIREE DA+ +E+KI   N+G++      + 
Sbjct: 126 ADLAVLTTRLDDPSGYGRI-IRDHEHRMIAIREERDASSDEKKITEINTGMLVARLGSLR 184

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIAS-IDVKEQEVCGCNNRYELSLIENIWQS 243
            WL ++K +    E YLTDI++ A  DGKSIA+ +      V G N+R+ L+ +E  WQ 
Sbjct: 185 AWLPKLKPHNAQGELYLTDIVQMAEEDGKSIATHLAPDPLRVAGVNDRWALAQMERAWQL 244

Query: 244 RYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGVSIE-------- 289
           R  + + +SG T++ P        V    D  I  + V E HV  G  V IE        
Sbjct: 245 RQAQTLALSGTTIVDPARIDFRGEVICGMDCQIDVNVVFEGHVRMGDNVVIEPNCVLRHV 304

Query: 290 ---NYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
              + V++RAFS+LEG  +G+   +GP+AR+R  + + ++ +IGNF EVK + I   SK+
Sbjct: 305 TLGDGVRVRAFSHLEGATLGEGVEVGPYARLRPGSDLAEHSKIGNFVEVKASRIGARSKV 364

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
           NHLSY+GD+V+G + NIGAGTITCNYDG +K++T I +  F+GS+S L+AP+++G    V
Sbjct: 365 NHLSYIGDTVMGADCNIGAGTITCNYDGANKHQTVIGDRVFVGSSSQLVAPVSLGDEATV 424

Query: 407 ASGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
            +GS ITQD P   L  ARSRQI+K   A    K K
Sbjct: 425 GAGSTITQDVPPGHLAVARSRQIMKGGWARPKEKLK 460


>gi|238750322|ref|ZP_04611824.1| Glucosamine-1-phosphate N-acetyltransferase [Yersinia rohdei ATCC
           43380]
 gi|238711555|gb|EEQ03771.1| Glucosamine-1-phosphate N-acetyltransferase [Yersinia rohdei ATCC
           43380]
          Length = 456

 Score =  322 bits (825), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 169/443 (38%), Positives = 264/443 (59%), Gaps = 28/443 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++     G +NV LV G+G E + +    
Sbjct: 9   VILAAGKGTRMYSDLPKVLHPLAGKPMVQHVIDAAMKLGAQNVHLVYGHGGELLKKTLTD 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGY---DDVIIMYGDVPLVSSHTLKKAMDKIA 124
           P L+  + +Q  Q GT HA+  A     P +   +DV+++YGDVPL+S  TL++ +    
Sbjct: 69  PALN--WVLQAEQLGTGHAMQQA----APHFADDEDVLMLYGDVPLISVDTLQRLLAAKP 122

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
           QG  I ++    DNP GYGR++ +N +++ I E  DA+D +R+I+  N+G++  +G  + 
Sbjct: 123 QG-GIGLLTVKLDNPSGYGRIVRENGDVVGIVEHKDASDAQREINEINTGILVANGRDLK 181

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQS 243
            WL  +  N    E+Y+TDII  A  DGK IA++   +  EV G NNR +L+ +E ++QS
Sbjct: 182 RWLSLLNNNNAQGEFYITDIIALAHADGKKIAAVHPARLSEVEGVNNRLQLATLERVYQS 241

Query: 244 RYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFG------CGVSIENY 291
               +++++GV ++ P    L        D  I  + +IE  V  G       G  ++N 
Sbjct: 242 EQAERLLLAGVMLLDPARFDLRGELTHGRDITIDTNVIIEGQVTLGDRVRIGTGCVLKNC 301

Query: 292 V-----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
           V     +I  +S LE   +     +GPFAR+R    + +   +GNF E+KKA + +GSK 
Sbjct: 302 VIGDDSEISPYSVLEDARLDTGCTVGPFARLRPGAELAEGAHVGNFVEIKKARLGKGSKA 361

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
            HLSY+GD+ +G  VNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+  G  +
Sbjct: 362 GHLSYLGDAEIGSGVNIGAGTITCNYDGANKFKTIIGDDVFVGSDTQLVAPVTVANGVTI 421

Query: 407 ASGSIITQDTPENSLVFARSRQI 429
           A+G+ +T+D  EN LV +R +Q+
Sbjct: 422 AAGTTVTRDIAENELVLSRVKQV 444


>gi|123444371|ref|YP_001008336.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|166226137|sp|A1JTC3|GLMU_YERE8 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|122091332|emb|CAL14218.1| UDP-N-acetylglucosamine pyrophosphorylase [Yersinia enterocolitica
           subsp. enterocolitica 8081]
          Length = 456

 Score =  322 bits (824), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 171/455 (37%), Positives = 269/455 (59%), Gaps = 28/455 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++     G + V LV G+G E + +    
Sbjct: 9   VILAAGKGTRMYSDLPKVLHPLAGKPMVQHVIDAAMKLGAQQVHLVYGHGGELLQKTLTD 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGY---DDVIIMYGDVPLVSSHTLKKAMDKIA 124
           P L+  + +Q  Q GT HA+  A     P +   +DV+++YGDVPL+S  TL++ +    
Sbjct: 69  PALN--WVLQAEQLGTGHAMQQA----APHFADDEDVLMLYGDVPLISVDTLQRLLAAKP 122

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
           QG  I ++    DNP GYGR++ +N +++ I E  DA+D +R+I+  N+G++  +G  + 
Sbjct: 123 QG-GIGLLTVKLDNPSGYGRIVRENGDVVGIVEHKDASDTQREINEINTGILVANGRDLK 181

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQS 243
            WL  +  N    E+Y+TDII  A  DGK IA++   +  EV G NNR +L+ +E ++QS
Sbjct: 182 RWLSLLNNNNAQGEFYITDIIALAHADGKKIATVHPARLSEVEGVNNRLQLAALERVYQS 241

Query: 244 RYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFG------CGVSIENY 291
               +++++GV ++ P    L        D  I  + +IE HV  G       G  ++N 
Sbjct: 242 EQAEKLLLAGVMLLDPARFDLRGELTHGRDITIDTNVIIEGHVTLGDRVRIGTGCVLKNC 301

Query: 292 V-----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
           V     +I  +S LE   +     +GPFAR+R    + +   +GNF E+KKA + +GSK 
Sbjct: 302 VIGDDSEISPYSVLEDSRLDAGCTVGPFARLRPGAELAEGAHVGNFVEIKKARLGKGSKA 361

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
            HLSY+GD+ +G  VNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+  G  +
Sbjct: 362 GHLSYLGDAEIGSGVNIGAGTITCNYDGANKFKTIIGDDVFVGSDTQLVAPVTVANGATI 421

Query: 407 ASGSIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           A+G+ +T+D  EN LV +R +Q+  +     ++KK
Sbjct: 422 AAGTTVTRDIAENELVLSRVKQVHVQGWQRPIKKK 456


>gi|302388647|ref|YP_003824468.1| glucosamine-1-phosphate N-acetyltransferase
           ;UDP-N-acetylglucosamine pyrophosphorylase
           [Thermosediminibacter oceani DSM 16646]
 gi|302199275|gb|ADL06845.1| glucosamine-1-phosphate N-acetyltransferase
           ;UDP-N-acetylglucosamine pyrophosphorylase
           [Thermosediminibacter oceani DSM 16646]
          Length = 466

 Score =  322 bits (824), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 185/455 (40%), Positives = 268/455 (58%), Gaps = 23/455 (5%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG G RMKS++ KVL K+ G PM+ HV+     AG + + +V+G G++E+ R  F
Sbjct: 5   AVILAAGEGTRMKSNTPKVLHKVCGIPMLGHVVSAARGAGAKRIVVVVGRGSDEVKRA-F 63

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMD-KIAQ 125
                VE+ +Q  Q+GT HA+  AQ+A+K G   ++++YGD+PLV S TL+   D     
Sbjct: 64  EGE-EVEFVLQAEQKGTGHALKQAQEAVK-GEAAILVLYGDMPLVKSETLRAMADFHWKN 121

Query: 126 GYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMD 185
           G +  V+     +P GYGR++ K  E++AIREE DAT EE+ I   NSG+       + D
Sbjct: 122 GATATVMTARVKDPTGYGRIIRKGLEVLAIREEKDATPEEKAIDEINSGIYFFQAEKVFD 181

Query: 186 WLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSR 244
            L Q+  N    EYYLTD+IE      + + + +V++  EV G N+R++LS+ + I Q R
Sbjct: 182 ALNQVNNNNKQGEYYLTDVIEILNAGKEKVLAYEVQDPDEVQGVNDRFQLSVAQAIMQRR 241

Query: 245 YRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFF--------GCGV---------S 287
              ++M  GVT ++PET  +     I  DTVI P VF         GC +          
Sbjct: 242 IIHRLMAQGVTFLSPETCVVDAGVKIGRDTVIYPGVFLEGDTWIGEGCTIIGTSRIIDSR 301

Query: 288 IENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKIN 347
           I N V+I      E V +     IGPFA +R  + +    +IG+F EVK + + EGSKI 
Sbjct: 302 IGNGVEITMCHIQESV-VEDGVKIGPFANLRPGSHVMAGAKIGDFVEVKNSRVGEGSKIP 360

Query: 348 HLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVA 407
           HL+YVGD+ +G+ VNIGAG I  NYDG  K++T + ++AFIG NS+LIAP+TIG G+YVA
Sbjct: 361 HLAYVGDAEIGRRVNIGAGVIFVNYDGFEKHRTVVEDDAFIGCNSNLIAPVTIGAGSYVA 420

Query: 408 SGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           +GS I  D  + +L  AR RQ+ K +     R+K+
Sbjct: 421 AGSTINMDVEKGALAIARERQVNKPEWVEKRRRKR 455


>gi|167036592|ref|YP_001664170.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Thermoanaerobacter pseudethanolicus
           ATCC 33223]
 gi|320115019|ref|YP_004185178.1| UDP-N-acetylglucosamine pyrophosphorylase [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
 gi|254798816|sp|B0KBF5|GLMU_THEP3 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|166855426|gb|ABY93834.1| UDP-N-acetylglucosamine pyrophosphorylase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|319928110|gb|ADV78795.1| UDP-N-acetylglucosamine pyrophosphorylase [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
          Length = 457

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 187/456 (41%), Positives = 272/456 (59%), Gaps = 25/456 (5%)

Query: 6   LAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRIN 65
           + ++LAAG G RMKS   KV+ K+ GKPMI  V++ +   G + V +V+G+ AEE+  + 
Sbjct: 5   VTLILAAGLGKRMKSKHPKVVHKVCGKPMIEWVVDAVEEIGSKEVIVVVGHKAEEVKEV- 63

Query: 66  FPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMD-KIA 124
                 V+Y  Q+ Q GT HAV+ A+D + P   +V+I+ GD PL++S+TLK+ ++  I 
Sbjct: 64  --LKERVKYAYQEVQLGTGHAVMMAEDLL-PEEGNVLILTGDTPLITSNTLKELINFHIK 120

Query: 125 QGYSIAVVGFNADNPKGYGRLL-IKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
           +G S+ ++    ++P GYGR++  K+  +I I E+ DAT+EE+ IH  NS +  +D   +
Sbjct: 121 EGNSVTILSSVLEDPTGYGRIIRDKSGNVIRIVEDKDATEEEKSIHEINSAMYVMDIAKL 180

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKAR-LDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
              L  I  N    EYYLTD +E  R +DGK I +  V  +E+ G N+R +L   E I +
Sbjct: 181 KKALRMITNNNAQGEYYLTDAVEIIRDMDGK-IGAFTVPSEEITGVNSRVQLFEAEKIMR 239

Query: 243 SRYRRQMMISGVTMIAPETVFLSH------DTIIQPDTVIEPHVFFGCGVSIENYVQIR- 295
            R   + M +GVT++ P+T ++        DT++ P  VIE     G    I    +I  
Sbjct: 240 KRINYRHMENGVTIVDPDTTYIGAEVEIGADTVVLPGCVIEGKTKIGSDCEIGPNCRIVD 299

Query: 296 ---------AFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
                     +S +    I     IGPFA IR ET I+ NV+IG+F E+KK+ I EGSK+
Sbjct: 300 SEIGDGCSVTYSVILSSKIKNNVKIGPFAHIRPETVIQSNVKIGDFVEIKKSIIDEGSKV 359

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
            HL+YVGD+ VGKNVN+G G+IT NYDG  K+KT I +N F+G N +L+AP+ IG   Y+
Sbjct: 360 PHLTYVGDAEVGKNVNMGCGSITVNYDGKQKHKTVIGDNVFVGCNVNLVAPVKIGNNAYI 419

Query: 407 ASGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           A+GS IT+D PE +L  ARSRQ  KE G +  R KK
Sbjct: 420 AAGSTITEDVPEGALAIARSRQTNKE-GWVQERIKK 454


>gi|325915878|ref|ZP_08178174.1| glucosamine-1-phosphate N-acetyltransferase
           ;UDP-N-acetylglucosamine pyrophosphorylase [Xanthomonas
           vesicatoria ATCC 35937]
 gi|325537845|gb|EGD09545.1| glucosamine-1-phosphate N-acetyltransferase
           ;UDP-N-acetylglucosamine pyrophosphorylase [Xanthomonas
           vesicatoria ATCC 35937]
          Length = 458

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 180/444 (40%), Positives = 254/444 (57%), Gaps = 24/444 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG G RM+SS  KVLQ +AG+PM++HV+ T        V +V G+G +++ R  F 
Sbjct: 12  VILAAGEGKRMRSSLPKVLQPLAGQPMLAHVIATARQLQPAAVHIVYGHGGDQV-RAAFA 70

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               +++  Q  Q GT HAV  A DAI P    V+++YGDVPL+ S +L + +    +  
Sbjct: 71  GQADLQWAEQQQQLGTGHAVQQAMDAI-PDAATVLVLYGDVPLIQSESLLQLLHAPGR-- 127

Query: 128 SIAVVGFNADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
            +AV+     NP GYGR+L     ++ AI E+ DA DE+R+I   N+G++  +   +  W
Sbjct: 128 -MAVLVAELANPTGYGRILRDAEGKVAAIIEQKDANDEQRRIRTINTGILTAESTALRRW 186

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSRY 245
           L  +  N    E+YLTD+   A  D      + V + QEV G N+ ++L+ +E  WQ R 
Sbjct: 187 LGGLSNNNAQGEFYLTDVFASAAADFTPADMVHVADPQEVEGANDPWQLAQLERAWQLRA 246

Query: 246 RRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV------- 292
            R + + GV M  P       TV +  D  +  D ++E  V  G GV I  +V       
Sbjct: 247 ARALCLQGVRMADPARVEQRGTVQVGRDVQLDIDVILEGDVTLGDGVVIGPFVRLRDVTL 306

Query: 293 ----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
               Q+RA   L+GV       IGPFAR+R  T +   V IGNF E KK T+  GSK NH
Sbjct: 307 GAGAQVRAHCDLDGVVTEGAVQIGPFARLRPGTMLADGVHIGNFVETKKVTMGVGSKANH 366

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           L+Y+GD+V+G  VNIGAGTITCNYDG +K +T I +NAF+GSNS+L+API +G    + +
Sbjct: 367 LTYLGDAVIGSKVNIGAGTITCNYDGVNKSQTTIGDNAFVGSNSALVAPIQVGANATIGA 426

Query: 409 GSIITQDTPENSLVFARSRQIVKE 432
           GS+IT+D P   L  AR RQ V E
Sbjct: 427 GSVITRDAPAGQLSVARPRQTVIE 450


>gi|37524070|ref|NP_927414.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|81420625|sp|Q7NA96|GLMU_PHOLL RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|36783493|emb|CAE12333.1| UDP-N-acetylglucosamine pyrophosphorylase
           (N-acetylglucosamine-1-phosphate uridyltransferase)
           [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 457

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 172/439 (39%), Positives = 269/439 (61%), Gaps = 22/439 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++T  A G +NV LV G+G + I +    
Sbjct: 9   VILAAGKGTRMYSDLPKVLHLLAGKPMVQHVIDTAMALGAKNVHLVYGHGGDLIEQTLSD 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
            TL+  + +Q  Q GT HA+  A      G +D++I+YGDVPL+ + TL++ +    +G 
Sbjct: 69  QTLN--WVLQAEQLGTGHAMQQAAPHF-AGDEDILILYGDVPLIGADTLERLLAVKPEG- 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    DNP GYGR++ +N E+  I E+ DAT+E+RKI+  N+G++  +G  +  WL
Sbjct: 125 GIGLLTAILDNPTGYGRIVRENGEVTGIIEQKDATEEQRKINEINTGILVANGSDLKRWL 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQSRYR 246
            Q+  N V  EYYLTD+I  A  +G+ I ++   +  E+ G NNR +LS +E I+QS   
Sbjct: 185 SQLDNNNVQGEYYLTDVIALAYKEGRKIEAVHPTRLSEMEGVNNRLQLSALERIYQSEQA 244

Query: 247 RQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIG 306
            Q++++GV ++ P    L    I   D VI+ +V     V++ N VQI     L+   IG
Sbjct: 245 EQLLLAGVMLLDPARFDLRGTLIHGRDVVIDTNVIIEGNVTLGNNVQIGTGCVLKNCIIG 304

Query: 307 KKTII-----------------GPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
             +II                 GPFAR+R  + + +   +GNF E+KK+ + +GSK  HL
Sbjct: 305 DDSIISPYTIVEDSEMETGCTVGPFARLRPGSKLAEKAHVGNFVEMKKSYLGKGSKAGHL 364

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G++VNIGAGTITCNYDG +K+KT I +N F+GS++ L+AP+ + +G  + +G
Sbjct: 365 TYLGDADIGRDVNIGAGTITCNYDGANKFKTIIGDNVFVGSDTQLVAPVIVAKGATIGAG 424

Query: 410 SIITQDTPENSLVFARSRQ 428
           + +T++  EN LV +R++Q
Sbjct: 425 TTVTKNIAENELVVSRTKQ 443


>gi|189485714|ref|YP_001956655.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [uncultured Termite group 1
           bacterium phylotype Rs-D17]
 gi|170287673|dbj|BAG14194.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [uncultured Termite group 1
           bacterium phylotype Rs-D17]
          Length = 451

 Score =  321 bits (822), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 180/443 (40%), Positives = 266/443 (60%), Gaps = 21/443 (4%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG G RMKSS  KV+ K++GKP++  V+++++A   + + LVLG+G E +     
Sbjct: 6   AVILAAGAGARMKSSLPKVIHKLSGKPLVKWVIDSVSALKPDGIVLVLGHGTEVVEEYLS 65

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM-DKIAQ 125
              + + Y  Q  Q G+ HA++ A+  +K     ++++  DVPLV S TL   + +    
Sbjct: 66  ESGIKIVY--QREQLGSGHALMQAEKVLKNYKGGILVVSADVPLVRSSTLSSLVSNNKKT 123

Query: 126 GYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMD 185
           G S+ V+    +NP GYGR++     +  I EE DAT  E++I   NSG+   D   +  
Sbjct: 124 GASVTVLAARVENPFGYGRIVRNGGFLEKIVEEKDATPAEKRIKEINSGIYCFDK-NLWK 182

Query: 186 WLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSR 244
            L ++K N  ++EYY+TD +   +  G+  + + V++  EV G NNR ELS  E+I  +R
Sbjct: 183 ALSKLKSNNANKEYYITDTVAILKESGRKTSLVVVEDNYEVRGINNRSELSRAESIVNNR 242

Query: 245 YRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRA-------- 296
             ++++ +GV+++  + V++S+D  I  DTV+ P  F   GVSI     IR         
Sbjct: 243 KIKELLSNGVSIVDADNVYISYDAKIGGDTVVYPGAFIDVGVSIGKNCIIRGASYISNSK 302

Query: 297 --------FSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
                   +SY+EG  I KK  +GPF+ IR+ + + +NVRIGNF E KKA I + SK+NH
Sbjct: 303 IGDESAILYSYIEGAVIDKKVTVGPFSHIREGSVLRENVRIGNFSETKKAVIAKNSKVNH 362

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           LSY+GD++VGKNVNIGAGTITCNYDG  K++T I   +FIGSN + +AP+ IG G  VA+
Sbjct: 363 LSYIGDALVGKNVNIGAGTITCNYDGAKKHQTIIGSESFIGSNVNFVAPVKIGCGVLVAA 422

Query: 409 GSIITQDTPENSLVFARSRQIVK 431
           GS IT D     LV AR RQ VK
Sbjct: 423 GSTITHDVQSGKLVIARVRQEVK 445


>gi|239618102|ref|YP_002941424.1| UDP-N-acetylglucosamine pyrophosphorylase [Kosmotoga olearia TBF
           19.5.1]
 gi|259647738|sp|C5CFS2|GLMU_KOSOT RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|239506933|gb|ACR80420.1| UDP-N-acetylglucosamine pyrophosphorylase [Kosmotoga olearia TBF
           19.5.1]
          Length = 446

 Score =  320 bits (821), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 187/444 (42%), Positives = 264/444 (59%), Gaps = 28/444 (6%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           AI+LAAG G RMKS   KV+  I G PMI+ V+  +  AGIEN+ +V GY AE I     
Sbjct: 3   AIILAAGLGKRMKSEIPKVVHSILGLPMINWVLRAVKKAGIENIIVVTGYKAE-IVEALL 61

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMD-KIAQ 125
           P    V+   Q  Q GT HAV+ AQDA+    D+VI++ GD PL+S  TL      +  +
Sbjct: 62  PE--DVKTVRQVKQLGTGHAVMVAQDAVMD--DEVIVLTGDAPLISPETLINLYKIRREK 117

Query: 126 GYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMD 185
            Y + V     ++P GYGR+ ++ N  + I EE DA++E ++I   NSG+      ++ D
Sbjct: 118 DYDVVVASTFQEDPTGYGRI-VRENGKLRIIEEKDASEEIKRIKEINSGIYVFKSDFLKD 176

Query: 186 WLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRY 245
            L +I  N   +EYYLTD +  A    K+ A +     EV G NNR +L+ I+ I Q + 
Sbjct: 177 ALKKINNNNNQKEYYLTDTVALAE---KATAHVIEDPTEVLGVNNRVQLAEIQKIAQKKI 233

Query: 246 RRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFF--------GCGV---------SI 288
             ++M++G+T++ P+T ++S D  I  DTVIEP  F          C +         SI
Sbjct: 234 NERLMLNGITIVDPDTTYISPDVEIGQDTVIEPMTFILGKTKIGNNCLIGPMTRIIDSSI 293

Query: 289 ENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
           ++ V I   S +E   I     +GPF+R+R  TT+ +N +IGNF EVKK+TI   SK  H
Sbjct: 294 DDSVSI-IRSEVEQAIIKSGARVGPFSRLRPGTTLLENTKIGNFVEVKKSTIGRNSKAQH 352

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           L+Y+GD+ +G++VNIGAGTITCNYDG  K++T I  N+FIGSN SL+AP+ IG+G+ V +
Sbjct: 353 LTYLGDATIGEDVNIGAGTITCNYDGVRKHQTIIENNSFIGSNCSLVAPVKIGEGSVVGA 412

Query: 409 GSIITQDTPENSLVFARSRQIVKE 432
           GS+IT D P  SL   R RQ++KE
Sbjct: 413 GSVITDDVPPYSLALGRGRQVIKE 436


>gi|242371671|ref|ZP_04817245.1| UDP-N-acetylglucosamine pyrophosphorylase [Staphylococcus
           epidermidis M23864:W1]
 gi|242350620|gb|EES42221.1| UDP-N-acetylglucosamine pyrophosphorylase [Staphylococcus
           epidermidis M23864:W1]
          Length = 451

 Score =  320 bits (821), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 176/448 (39%), Positives = 270/448 (60%), Gaps = 22/448 (4%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR 63
           +R AI+LAAG+G RMKS   KVL ++AGK MI HV+ ++  +G+ ++  ++G+GAE +  
Sbjct: 2   QRHAIILAAGKGTRMKSKKYKVLHEVAGKSMIEHVLNSVKQSGVNHIVTIVGHGAESVKE 61

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKI 123
                +L   Y  Q+ Q GTAHAV TAQ+ +       +++ GD PL++S TL+  +D  
Sbjct: 62  TLGEQSL---YSFQEEQLGTAHAVKTAQEHLADKEGTTLVVCGDTPLITSKTLQSLIDHH 118

Query: 124 AQGYS-IAVVGFNADNPKGYGRLLIKNNEIIA-IREENDATDEERKIHYCNSGLMAIDGL 181
               S + V+  +   P GYGR++  +N ++  I EE DA+D ER+I+  +SG+ A D  
Sbjct: 119 EGTNSQVTVLSASTSQPHGYGRIVRDSNHLLQRIVEEKDASDIEREINEISSGIFAFDNQ 178

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENI 240
            + D L Q+K +    EYYL D++     DG         +  E+ G N+R  LS  E  
Sbjct: 179 VLFDKLAQVKNDNAQGEYYLPDVLSLILEDGGKAEIYHTDDFDEIMGVNDRVMLSEAEKA 238

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           +Q R     M +GVT++ P + ++  D  I  DT IEP V  G   +I   V I  +S +
Sbjct: 239 FQKRINDFHMRNGVTILDPNSTYIGPDVEIGMDTTIEPGVRIGGHTTIGEDVLIGQYSEI 298

Query: 301 EG--VH--------------IGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGS 344
               +H              +G+KT +GPFA++R  + +  +V++GNF EVKKA++K+G+
Sbjct: 299 NNSTIHSNANIKQSIINDSIVGEKTKVGPFAQLRPGSNLGADVKVGNFVEVKKASLKDGA 358

Query: 345 KINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGT 404
           K++HLSY+GD+ +G+  NIG G+IT NYDG +K+KT + ++AFIG N++LIAP+T+G  T
Sbjct: 359 KVSHLSYIGDAEIGERTNIGCGSITVNYDGVNKFKTIVGKDAFIGCNTNLIAPVTVGDHT 418

Query: 405 YVASGSIITQDTPENSLVFARSRQIVKE 432
            +A+GS IT D PE+SL  AR+RQ+ KE
Sbjct: 419 LIAAGSTITDDIPEDSLALARARQVNKE 446


>gi|253698730|ref|YP_003019919.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Geobacter sp. M21]
 gi|251773580|gb|ACT16161.1| UDP-N-acetylglucosamine pyrophosphorylase [Geobacter sp. M21]
          Length = 458

 Score =  320 bits (821), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 178/461 (38%), Positives = 271/461 (58%), Gaps = 23/461 (4%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M  K  AIVLAAG G RMKS   KV+  +AG PMI   +    A+G+E   LV+G+  E+
Sbjct: 1   MGNKIAAIVLAAGMGTRMKSDLVKVMHPVAGVPMIQWPVAAAFASGVERCVLVVGHQQEK 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           + R +F     V + +Q  Q GT HAV  A   + PG D V+I+ GD PL+ + +L   +
Sbjct: 61  V-REHFAGRGEVSFALQSEQLGTGHAVRCAMTELDPGADTVLILCGDTPLLEAKSLAGML 119

Query: 121 DKIAQGYS-IAVVGFNADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNSGLMAI 178
               +  + + V+     NP GYGR++     ++ AI EE DAT++ER I   N+G+  +
Sbjct: 120 KAHRETKACLTVMTATLGNPFGYGRIVKDATGKVTAITEEKDATEKERLIDEVNAGVYCV 179

Query: 179 DGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLI 237
           D  ++   +  IK +    EYYLTD++ +A   G +  S  V + +E+ G N+R +++  
Sbjct: 180 DRAFLEKSITSIKNDNAQGEYYLTDVVRQAAQQGLACLSFKVADPREISGVNDRAQMAEA 239

Query: 238 ENIWQSRYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFG--C----- 284
             + + R  R++M+SGVTMI PETV++        D+++ P   IE +   G  C     
Sbjct: 240 ARVLRGRINRELMLSGVTMIDPETVYIDRGVRIGRDSVVYPGATIEGNTVIGERCVIGQG 299

Query: 285 ----GVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATI 340
                 SI + V ++A S LE   +G +  IGP A +R  T +  +V+IGNF E KKA +
Sbjct: 300 SLIQNCSIADDVAVKAGSVLEDSKVGPEAAIGPMAHLRAGTELSAHVKIGNFVETKKAFM 359

Query: 341 KEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITI 400
            EGSK +HL+Y+GD+ +G++VNIG GTITCNYDG  K+KT I +  F+GS+  L+AP+T+
Sbjct: 360 GEGSKASHLTYLGDATIGRDVNIGCGTITCNYDGVKKHKTVIEDGVFVGSDVQLVAPVTV 419

Query: 401 GQGTYVASGSIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           G+ + +A+G+ +T+D P +SL  ARS Q+ KE    ++RKK
Sbjct: 420 GRNSLIAAGTTVTKDVPADSLAIARSPQVNKE--GWTLRKK 458


>gi|332163548|ref|YP_004300125.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318608055|emb|CBY29553.1| N-acetylglucosamine-1-phosphate
           uridyltransferase;glucosamine-1-phosphate
           N-acetyltransferase [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325667778|gb|ADZ44422.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 456

 Score =  320 bits (819), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 169/443 (38%), Positives = 263/443 (59%), Gaps = 28/443 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++     G + V LV G+G E + +    
Sbjct: 9   VILAAGKGTRMYSDLPKVLHPLAGKPMVQHVIDAAMKLGAQQVHLVYGHGGELLQKRLTD 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGY---DDVIIMYGDVPLVSSHTLKKAMDKIA 124
           P L+  + +Q  Q GT HA+  A     P +   +DV+++YGDVPL+S  TL++ +    
Sbjct: 69  PALN--WVLQAEQLGTGHAMQQA----APHFADDEDVLMLYGDVPLISVDTLQRLLAAKP 122

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
           QG  I ++    DNP GYGR++ +N +++ I E  DA+D +R+I+  N+G++  +G  + 
Sbjct: 123 QG-GIGLLTVKLDNPSGYGRIVRENGDVVGIVEHKDASDTQREINEINTGILVANGRDLK 181

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQS 243
            WL  +  N    E+Y+TDII  A  DGK IA++   +  EV G NNR +L+ +E ++QS
Sbjct: 182 RWLSLLDNNNAQGEFYITDIIALAHADGKKIATVHPARLSEVEGVNNRLQLAALERVYQS 241

Query: 244 RYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFG------CGVSIENY 291
               +++++GV ++ P    L        D  I  + +IE HV  G       G  ++N 
Sbjct: 242 EQAEKLLLAGVMLLDPARFDLRGELTHGRDITIDTNVIIEGHVTLGDRVRIGTGCVLKNC 301

Query: 292 V-----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
           V     +I  +S LE   +     +GPFAR+R    + +   +GNF E+KKA + +GSK 
Sbjct: 302 VIGDDSEISPYSVLEDSRLDAGCTVGPFARLRPGAELAEGAHVGNFVEIKKARLGKGSKA 361

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
            HLSY+GD+ +G  VNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+  G  +
Sbjct: 362 GHLSYLGDAEIGSGVNIGAGTITCNYDGANKFKTIIGDDVFVGSDTQLVAPVTVANGATI 421

Query: 407 ASGSIITQDTPENSLVFARSRQI 429
           A+G+ +T D  EN LV +R +Q+
Sbjct: 422 AAGTTVTGDIAENELVLSRVKQV 444


>gi|22128001|ref|NP_671424.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Yersinia pestis KIM 10]
 gi|45443749|ref|NP_995288.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Yersinia pestis biovar Microtus str.
           91001]
 gi|162418198|ref|YP_001608470.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Yersinia pestis Angola]
 gi|165926087|ref|ZP_02221919.1| UDP-N-acetylglucosamine pyrophosphorylase [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165939981|ref|ZP_02228518.1| UDP-N-acetylglucosamine pyrophosphorylase [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166009499|ref|ZP_02230397.1| UDP-N-acetylglucosamine pyrophosphorylase [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166213193|ref|ZP_02239228.1| UDP-N-acetylglucosamine pyrophosphorylase [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167401598|ref|ZP_02307092.1| UDP-N-acetylglucosamine pyrophosphorylase [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167422862|ref|ZP_02314615.1| UDP-N-acetylglucosamine pyrophosphorylase [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167425485|ref|ZP_02317238.1| UDP-N-acetylglucosamine pyrophosphorylase [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|270488389|ref|ZP_06205463.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Yersinia pestis KIM D27]
 gi|21961148|gb|AAM87675.1|AE014014_9 N-acetyl glucosamine-1-phosphate uridyltransferase [Yersinia pestis
           KIM 10]
 gi|45438619|gb|AAS64165.1| UDP-N-acetylglucosamine pyrophosphorylase [Yersinia pestis biovar
           Microtus str. 91001]
 gi|162351013|gb|ABX84961.1| UDP-N-acetylglucosamine pyrophosphorylase [Yersinia pestis Angola]
 gi|165912107|gb|EDR30747.1| UDP-N-acetylglucosamine pyrophosphorylase [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165921947|gb|EDR39124.1| UDP-N-acetylglucosamine pyrophosphorylase [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165991421|gb|EDR43722.1| UDP-N-acetylglucosamine pyrophosphorylase [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166205491|gb|EDR49971.1| UDP-N-acetylglucosamine pyrophosphorylase [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166958254|gb|EDR55275.1| UDP-N-acetylglucosamine pyrophosphorylase [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167048980|gb|EDR60388.1| UDP-N-acetylglucosamine pyrophosphorylase [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167055499|gb|EDR65292.1| UDP-N-acetylglucosamine pyrophosphorylase [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|270336893|gb|EFA47670.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Yersinia pestis KIM D27]
          Length = 458

 Score =  319 bits (818), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 165/443 (37%), Positives = 265/443 (59%), Gaps = 28/443 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++     G ++V LV G+G E + +    
Sbjct: 11  VILAAGKGTRMYSDLPKVLHPLAGKPMVQHVIDAAMKLGAQHVHLVYGHGGELLKKTLAD 70

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGY---DDVIIMYGDVPLVSSHTLKKAMDKIA 124
           P+L+  + +Q  Q GT HA+  A     P +   +D++++YGDVPL+S  TL++ +    
Sbjct: 71  PSLN--WVLQAEQLGTGHAMQQA----APHFADDEDILMLYGDVPLISVDTLQRLLAAKP 124

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
           +G  I ++    DNP GYGR++ +N +++ I E  DA+D +R+I+  N+G++  +G  + 
Sbjct: 125 EG-GIGLLTVKLDNPSGYGRIVRENGDVVGIVEHKDASDAQREINEINTGILVANGRDLK 183

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQS 243
            WL  +  N    E+Y+TDII  A  DGK IA++   +  EV G NNR +LS +E ++Q+
Sbjct: 184 RWLSLLDNNNAQGEFYITDIIALAHADGKKIATVHPTRLSEVEGVNNRLQLSALERVFQT 243

Query: 244 RYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFG------CGVSIENY 291
               +++++GV ++ P    L        D  I  + +IE HV  G       G  ++N 
Sbjct: 244 EQAEKLLLAGVMLLDPSRFDLRGELTHGRDITIDTNVIIEGHVILGDRVRIGTGCVLKNC 303

Query: 292 V-----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
           V     +I  ++ LE   +     +GPFAR+R    + +   +GNF E+KKA + +GSK 
Sbjct: 304 VIGDDSEISPYTVLEDARLDANCTVGPFARLRPGAELAEGAHVGNFVEIKKARLGKGSKA 363

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
            HLSY+GD+ +G  VNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+  G  +
Sbjct: 364 GHLSYLGDAEIGAGVNIGAGTITCNYDGANKFKTIIGDDVFVGSDTQLVAPVTVANGATI 423

Query: 407 ASGSIITQDTPENSLVFARSRQI 429
            +G+ +T+D  EN LV +R +Q+
Sbjct: 424 GAGTTVTRDVAENELVISRVKQV 446


>gi|51598249|ref|YP_072440.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Yersinia pseudotuberculosis IP 32953]
 gi|108810154|ref|YP_654070.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Yersinia pestis Antiqua]
 gi|108814136|ref|YP_649903.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Yersinia pestis Nepal516]
 gi|145601154|ref|YP_001165230.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Yersinia pestis Pestoides F]
 gi|150260947|ref|ZP_01917675.1| UDP-N-acetylglucosamine pyrophosphorylase [Yersinia pestis
           CA88-4125]
 gi|153947291|ref|YP_001403116.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Yersinia pseudotuberculosis IP 31758]
 gi|167468117|ref|ZP_02332821.1| UDP-N-acetylglucosamine pyrophosphorylase [Yersinia pestis FV-1]
 gi|170026432|ref|YP_001722937.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Yersinia pseudotuberculosis YPIII]
 gi|186897470|ref|YP_001874582.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Yersinia pseudotuberculosis PB1/+]
 gi|218931095|ref|YP_002348970.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Yersinia pestis CO92]
 gi|229839827|ref|ZP_04459986.1| bifunctional N-acetyl glucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate acetyl
           transferase [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229841912|ref|ZP_04462068.1| bifunctional N-acetyl glucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate acetyl
           transferase [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229896789|ref|ZP_04511952.1| bifunctional N-acetyl glucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate acetyl
           transferase [Yersinia pestis Pestoides A]
 gi|229904678|ref|ZP_04519789.1| bifunctional N-acetyl glucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate acetyl
           transferase [Yersinia pestis Nepal516]
 gi|81515913|sp|Q8Z9S7|GLMU_YERPE RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|81638071|sp|Q663R0|GLMU_YERPS RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|119370605|sp|Q1C097|GLMU_YERPA RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|119370606|sp|Q1CCH7|GLMU_YERPN RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|166226138|sp|A4TSJ5|GLMU_YERPP RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|166990441|sp|A7FPD8|GLMU_YERP3 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|254798826|sp|B2K849|GLMU_YERPB RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|254798827|sp|B1JRN4|GLMU_YERPY RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|225734164|pdb|3FWW|A Chain A, The Crystal Structure Of The Bifunctional
           N-Acetylglucosamine-1- Phosphate
           UridyltransferaseGLUCOSAMINE-1-Phosphate
           Acetyltransferase From Yersinia Pestis Co92
 gi|51591531|emb|CAH23203.1| UDP-N-acetylglucosamine pyrophosphorylase [Yersinia
           pseudotuberculosis IP 32953]
 gi|108777784|gb|ABG20303.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase [Yersinia
           pestis Nepal516]
 gi|108782067|gb|ABG16125.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase [Yersinia
           pestis Antiqua]
 gi|115349706|emb|CAL22687.1| UDP-N-acetylglucosamine pyrophosphorylase [Yersinia pestis CO92]
 gi|145212850|gb|ABP42257.1| UDP-N-acetylglucosamine pyrophosphorylase / glucosamine-1-phosphate
           N-acetyltransferase [Yersinia pestis Pestoides F]
 gi|149290355|gb|EDM40432.1| UDP-N-acetylglucosamine pyrophosphorylase [Yersinia pestis
           CA88-4125]
 gi|152958786|gb|ABS46247.1| UDP-N-acetylglucosamine pyrophosphorylase [Yersinia
           pseudotuberculosis IP 31758]
 gi|169752966|gb|ACA70484.1| UDP-N-acetylglucosamine pyrophosphorylase [Yersinia
           pseudotuberculosis YPIII]
 gi|186700496|gb|ACC91125.1| UDP-N-acetylglucosamine pyrophosphorylase [Yersinia
           pseudotuberculosis PB1/+]
 gi|229678796|gb|EEO74901.1| bifunctional N-acetyl glucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate acetyl
           transferase [Yersinia pestis Nepal516]
 gi|229691251|gb|EEO83304.1| bifunctional N-acetyl glucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate acetyl
           transferase [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229696193|gb|EEO86240.1| bifunctional N-acetyl glucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate acetyl
           transferase [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229700227|gb|EEO88263.1| bifunctional N-acetyl glucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate acetyl
           transferase [Yersinia pestis Pestoides A]
 gi|320017452|gb|ADW01024.1| 3-deoxy-manno-octulosonate cytidylyltransferase [Yersinia pestis
           biovar Medievalis str. Harbin 35]
          Length = 456

 Score =  319 bits (818), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 165/443 (37%), Positives = 265/443 (59%), Gaps = 28/443 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++     G ++V LV G+G E + +    
Sbjct: 9   VILAAGKGTRMYSDLPKVLHPLAGKPMVQHVIDAAMKLGAQHVHLVYGHGGELLKKTLAD 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGY---DDVIIMYGDVPLVSSHTLKKAMDKIA 124
           P+L+  + +Q  Q GT HA+  A     P +   +D++++YGDVPL+S  TL++ +    
Sbjct: 69  PSLN--WVLQAEQLGTGHAMQQA----APHFADDEDILMLYGDVPLISVDTLQRLLAAKP 122

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
           +G  I ++    DNP GYGR++ +N +++ I E  DA+D +R+I+  N+G++  +G  + 
Sbjct: 123 EG-GIGLLTVKLDNPSGYGRIVRENGDVVGIVEHKDASDAQREINEINTGILVANGRDLK 181

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQS 243
            WL  +  N    E+Y+TDII  A  DGK IA++   +  EV G NNR +LS +E ++Q+
Sbjct: 182 RWLSLLDNNNAQGEFYITDIIALAHADGKKIATVHPTRLSEVEGVNNRLQLSALERVFQT 241

Query: 244 RYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFG------CGVSIENY 291
               +++++GV ++ P    L        D  I  + +IE HV  G       G  ++N 
Sbjct: 242 EQAEKLLLAGVMLLDPSRFDLRGELTHGRDITIDTNVIIEGHVILGDRVRIGTGCVLKNC 301

Query: 292 V-----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
           V     +I  ++ LE   +     +GPFAR+R    + +   +GNF E+KKA + +GSK 
Sbjct: 302 VIGDDSEISPYTVLEDARLDANCTVGPFARLRPGAELAEGAHVGNFVEIKKARLGKGSKA 361

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
            HLSY+GD+ +G  VNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+  G  +
Sbjct: 362 GHLSYLGDAEIGAGVNIGAGTITCNYDGANKFKTIIGDDVFVGSDTQLVAPVTVANGATI 421

Query: 407 ASGSIITQDTPENSLVFARSRQI 429
            +G+ +T+D  EN LV +R +Q+
Sbjct: 422 GAGTTVTRDVAENELVISRVKQV 444


>gi|290473114|ref|YP_003465975.1| bifunctional N-acetyl glucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate acetyl
           transferase [Xenorhabdus bovienii SS-2004]
 gi|289172408|emb|CBJ79175.1| bifunctional: N-acetyl glucosamine-1-phosphate uridyltransferase
           (N-terminal); glucosamine-1-phosphate acetyl transferase
           (C-terminal) [Xenorhabdus bovienii SS-2004]
          Length = 459

 Score =  319 bits (817), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 168/442 (38%), Positives = 271/442 (61%), Gaps = 28/442 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S+  KVL  +AGKPM+ HV++T  A G +NV LV G+G + + +    
Sbjct: 12  VILAAGKGTRMYSALPKVLHSLAGKPMVQHVIDTAMALGTQNVHLVYGHGGDLMKQ---- 67

Query: 68  PTLS---VEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIA 124
            TLS   + + +Q  Q GT HA+  A        +D++++YGDVPL++  TL++ ++   
Sbjct: 68  -TLSNQNLNWVLQAEQLGTGHAMQQAAPYFADD-EDILMLYGDVPLIAQDTLERLVEIKP 125

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
           +G  I ++    +NP GYGR++ +N E+  I E+ DATDE+RKI+  N+G++  +G  + 
Sbjct: 126 EG-GIGLLTAILNNPAGYGRIIRENGEVAGIIEQKDATDEQRKINEINTGILVANGGDLK 184

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASID-VKEQEVCGCNNRYELSLIENIWQS 243
            WL Q+  N    EYY+TDII  A  +G+ I ++   +  E+ G NNR +LS +E I+QS
Sbjct: 185 RWLSQLDNNNAQGEYYITDIIALAHKEGRQIKAVHPSRLSEMEGVNNRLQLSALERIYQS 244

Query: 244 RYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGV----------- 286
               +++++GV ++ P       T+    D +I  + +IE HV  G  V           
Sbjct: 245 EQAEKLLLAGVMLLDPARFDLRGTLEHGRDVVIDTNVIIEGHVALGNNVHIGSGCILKNC 304

Query: 287 SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
           +I +   I  ++ +E   I  +  +GPFAR+R  + + +   +GNF E+KK ++ +GSK 
Sbjct: 305 AIGDGTVISPYTVIEDSEIAAECTVGPFARLRPGSKLAEKAHVGNFVEMKKTSLGKGSKA 364

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
            HL+Y+GDS +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+ +G  +
Sbjct: 365 GHLTYLGDSEIGNNVNIGAGTITCNYDGANKFKTIIGDDVFVGSDTQLVAPVTVAKGVTI 424

Query: 407 ASGSIITQDTPENSLVFARSRQ 428
            +G+ +T+D  EN LV +R +Q
Sbjct: 425 GAGTTVTKDVAENELVISRVKQ 446


>gi|239825629|ref|YP_002948253.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Geobacillus sp. WCH70]
 gi|259647736|sp|C5D371|GLMU_GEOSW RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|239805922|gb|ACS22987.1| UDP-N-acetylglucosamine pyrophosphorylase [Geobacillus sp. WCH70]
          Length = 459

 Score =  319 bits (817), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 187/459 (40%), Positives = 268/459 (58%), Gaps = 26/459 (5%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR 63
           KR A++LAAG+G RMKS   KVL  + GKPM+ HV++ +   GIE +  V+G+GAE++  
Sbjct: 3   KRYAVILAAGQGTRMKSKQYKVLHPVCGKPMVQHVVDQVLQLGIEKLITVVGFGAEQVKA 62

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK- 122
                +   EY  Q  Q GTAHAV+ A   ++      +++ GD PL+++ T++  +D  
Sbjct: 63  QLGDQS---EYAFQQEQLGTAHAVMQAAPYLQEKDGVTLVVCGDTPLITAETMQALLDHH 119

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
           +A      ++   ADNP GYGR++   +  +  I E  DA+++ER I   N+G    D  
Sbjct: 120 LATNAKATILTAVADNPAGYGRIVRDAHGNVEKIVEHKDASEQERAIKEINTGTYCFDNK 179

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENI 240
            + + L  +  N    EYYLTD+IE  + +G  I++      +E  G N+R  L+  E I
Sbjct: 180 SLFEALTHVSNNNAQGEYYLTDVIEILKSNGSIISAYKAPSFEETIGVNDRVALAEAEKI 239

Query: 241 WQSRYRRQMMISGVTMIAPETVFLS------HDTIIQPDTVIEPHVFFG--CGVS----- 287
            + R  R+ M++GVT+I P   ++S       DT+I P TVIE     G  C +      
Sbjct: 240 MRERICRKHMMNGVTIIDPAHTYISAEVRIGRDTVIYPGTVIEGKTVIGEDCTIGPNSEI 299

Query: 288 ----IENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG 343
               I N   IR  S      IG    IGPFA IR  + I+  VRIGNF EVKK+T  +G
Sbjct: 300 KDCWIGNGTTIR-HSVAHDSEIGNDVTIGPFAHIRPSSKIDDEVRIGNFVEVKKSTFGKG 358

Query: 344 SKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQG 403
           SK +HLSY+GD+ VG NVN+G G+IT NYDG +K+ T I + AFIG N++LIAP+T+G+G
Sbjct: 359 SKASHLSYIGDAEVGVNVNLGCGSITVNYDGKNKHITKIEDGAFIGCNANLIAPVTVGKG 418

Query: 404 TYVASGSIITQDTPENSLVFARSRQIVKED--GALSMRK 440
            YVA+GS IT D PEN+L  AR+RQ+ KE+    LS++K
Sbjct: 419 AYVAAGSTITDDVPENALSIARARQVNKENYVDRLSIKK 457


>gi|325921273|ref|ZP_08183133.1| glucosamine-1-phosphate N-acetyltransferase
           ;UDP-N-acetylglucosamine pyrophosphorylase [Xanthomonas
           gardneri ATCC 19865]
 gi|325548240|gb|EGD19234.1| glucosamine-1-phosphate N-acetyltransferase
           ;UDP-N-acetylglucosamine pyrophosphorylase [Xanthomonas
           gardneri ATCC 19865]
          Length = 454

 Score =  319 bits (817), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 178/444 (40%), Positives = 256/444 (57%), Gaps = 24/444 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG G RM+SS  KVLQ +AG+PM++HV+ T        + +V G+G E++ +  F 
Sbjct: 8   VILAAGEGKRMRSSLPKVLQPLAGQPMLAHVIATARQLQPAAIHVVHGHGGEQV-QAAFA 66

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               + +  Q  Q GT HAV  A  AI P    V+++YGDVPL+ S+ L + +    +  
Sbjct: 67  AQSDLHWAEQRQQLGTGHAVQQAMHAI-PDAATVLVLYGDVPLIQSNDLLQLLHAPGR-- 123

Query: 128 SIAVVGFNADNPKGYGRLLI-KNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
            +AV+  +  NP GYGR+L     ++ AI E+ DA DE+R+I   N+G++  +   +  W
Sbjct: 124 -MAVLVADVPNPSGYGRILRDAEGKVAAIVEQKDANDEQRRIRTINTGILTAESTALRRW 182

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSRY 245
           L  +       E+YLTD+   A  D      + V + Q+V G N+ ++L+L+E  WQ+R 
Sbjct: 183 LSGLSNQNAQGEFYLTDVFASAAADFTPADMVHVSDPQDVEGANDLWQLALLERAWQTRA 242

Query: 246 RRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV------- 292
            R + + GV M  P       TV + +D  +  D ++E  V  G GV I  +V       
Sbjct: 243 ARALCLRGVRMADPARVEQRGTVTVGNDVQLDIDVILEGEVTLGDGVVIGPFVRLRDVTL 302

Query: 293 ----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
               Q+RA   LEGV      +IGPFAR+R  T +   V IGNF E KK T+  GSK NH
Sbjct: 303 GAGTQVRAHCDLEGVVTEGAAMIGPFARLRPGTVLADGVHIGNFVETKKVTMGVGSKANH 362

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           L+Y+GD+V+G  VNIGAGTITCNYDG +K +T I + AF+GSNS+L+API IG    + +
Sbjct: 363 LTYLGDAVIGSKVNIGAGTITCNYDGVNKSQTTIGDGAFVGSNSALVAPIAIGAMANIGA 422

Query: 409 GSIITQDTPENSLVFARSRQIVKE 432
           GS+IT+D P   L  AR+RQ V E
Sbjct: 423 GSVITRDAPAGQLSVARARQTVIE 446


>gi|167039245|ref|YP_001662230.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Thermoanaerobacter sp. X514]
 gi|256751651|ref|ZP_05492526.1| UDP-N-acetylglucosamine pyrophosphorylase [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|300913885|ref|ZP_07131202.1| UDP-N-acetylglucosamine pyrophosphorylase [Thermoanaerobacter sp.
           X561]
 gi|307725430|ref|YP_003905181.1| UDP-N-acetylglucosamine pyrophosphorylase [Thermoanaerobacter sp.
           X513]
 gi|166853485|gb|ABY91894.1| UDP-N-acetylglucosamine pyrophosphorylase [Thermoanaerobacter sp.
           X514]
 gi|256749460|gb|EEU62489.1| UDP-N-acetylglucosamine pyrophosphorylase [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|300890570|gb|EFK85715.1| UDP-N-acetylglucosamine pyrophosphorylase [Thermoanaerobacter sp.
           X561]
 gi|307582491|gb|ADN55890.1| UDP-N-acetylglucosamine pyrophosphorylase [Thermoanaerobacter sp.
           X513]
          Length = 469

 Score =  319 bits (817), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 186/456 (40%), Positives = 272/456 (59%), Gaps = 25/456 (5%)

Query: 6   LAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRIN 65
           + ++LAAG G RMKS   KV+ K+ GKPMI  V++ +   G   V +V+G+ AEE+  + 
Sbjct: 17  VTLILAAGLGKRMKSKHPKVIHKVCGKPMIEWVVDAVEKIGSNEVIVVVGHKAEEVKEV- 75

Query: 66  FPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMD-KIA 124
                 V+Y  Q+ Q GT HAV+ A+D + P   +V+I+ GD PL++S+TLK+ ++  I 
Sbjct: 76  --LKERVKYAYQEVQLGTGHAVMMAEDLL-PEEGNVLILTGDTPLITSNTLKELINFHIK 132

Query: 125 QGYSIAVVGFNADNPKGYGRLL-IKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
           +  S+ ++    ++P GYGR++  ++  +I I E+ DAT+EE+ IH  NS +  +D   +
Sbjct: 133 EHNSVTILSSVLEDPTGYGRIIRDESGNVIKIVEDKDATEEEKSIHEINSAMYVMDIAKL 192

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKAR-LDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
              L +I  N    EYYLTD +E  R +DGK I +  V  +E+ G N+R +L   E I +
Sbjct: 193 KKALRRITNNNAQGEYYLTDAVEIIRDMDGK-IGAFTVPSEEITGVNSRVQLFEAEKIMR 251

Query: 243 SRYRRQMMISGVTMIAPETVFLSH------DTIIQPDTVIEPHVFFGCGVSIENYVQIR- 295
            R   + M +GVT++ P+T ++        DT+I P  VIE     G    I    +I  
Sbjct: 252 KRINYRHMENGVTIVDPDTTYIGAEVEIGADTVILPGCVIEGKTKIGSDCEIGPNCRIVD 311

Query: 296 ---------AFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
                     +S +    IG    IGPFA IR ET I+ NV+IG+F E+KK+ I EGSK+
Sbjct: 312 SEIGDGCSVTYSVILSSKIGNNVKIGPFAHIRPETVIQSNVKIGDFVEIKKSIIDEGSKV 371

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
            HL+YVGD+ VGKNVN+G G+IT NYDG  KYKT I +N F+G N +L+AP+ IG   Y+
Sbjct: 372 PHLTYVGDAEVGKNVNMGCGSITVNYDGKQKYKTVIGDNVFVGCNVNLVAPVKIGNNAYI 431

Query: 407 ASGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           A+GS IT++ PE +L  AR+RQ  KE G +  R KK
Sbjct: 432 AAGSTITENVPEGALAIARNRQTNKE-GWVQERIKK 466


>gi|108760157|ref|YP_629642.1| UDP-N-acetylglucosamine pyrophosphorylase [Myxococcus xanthus DK
           1622]
 gi|119370582|sp|Q1DCI1|GLMU_MYXXD RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|108464037|gb|ABF89222.1| UDP-N-acetylglucosamine pyrophosphorylase [Myxococcus xanthus DK
           1622]
          Length = 466

 Score =  318 bits (816), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 163/456 (35%), Positives = 264/456 (57%), Gaps = 22/456 (4%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRI-- 64
           A+VL AG+G RMKS  +KVL  I G+P+ ++ ++     G  +V  V+G+ AE + +   
Sbjct: 6   AVVLCAGKGTRMKSEKAKVLHPILGRPLCAYPLKRALELGATSVVPVVGHQAEAVEKAVR 65

Query: 65  NFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIA 124
              P   + + +Q  Q+GTA AV +A++A+K     V+I+YGDVPL+   TL+  +    
Sbjct: 66  GLFPDAPLRFALQREQRGTADAVRSAEEALKGYSGRVLILYGDVPLLRRETLEALLAAHD 125

Query: 125 Q-GYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
           Q G  +A+V    ++P GYGR++    ++  I E  D T E+R +  CN+G+ ++D  ++
Sbjct: 126 QAGGKLAMVTTTLEDPTGYGRVIRDGGKVTRIVEHKDCTPEQRAVRECNAGIYSVDADFL 185

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQS 243
              L +IK      EYYLTD++E A   G  + S++    E  G N+R EL+    + Q 
Sbjct: 186 WKALAEIKPQNAQGEYYLTDLVEMAAKRG-PVGSVEADATETAGVNDRVELAARARVLQQ 244

Query: 244 RYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGV----------------- 286
           R     M +GV++  P T ++     + PDT I P V    G                  
Sbjct: 245 RINEAHMRAGVSLQDPATAYIEEGVTVGPDTEIGPSVTLAAGTVVGKGCTIGQGSVLHAS 304

Query: 287 SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
           ++ +   I+ +S LE   +G++ +IGPF+R+R  T + ++V +GNF E KKA I +GSK 
Sbjct: 305 TVADGTVIKPYSVLEEARVGERNVIGPFSRLRPGTELAEDVHLGNFVETKKARIGKGSKA 364

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
           NHL+Y+GD+V+G   N+GAGTITCNYDG +K+ T + +  FIGS++ L+AP+ +G G+YV
Sbjct: 365 NHLTYLGDAVIGSGCNVGAGTITCNYDGVNKHLTELGDGVFIGSDTQLVAPVKVGDGSYV 424

Query: 407 ASGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
            +G+ +T++ P  SL  +R+ Q+ KE G ++ +K +
Sbjct: 425 GAGTTVTKNVPPGSLAVSRTPQVTKE-GWVATKKAR 459


>gi|119370561|sp|Q1QSD2|GLMU_CHRSD RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
          Length = 453

 Score =  318 bits (816), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 170/445 (38%), Positives = 259/445 (58%), Gaps = 28/445 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI-TRINF 66
           ++LAAG+G RM+S+  KVL  +AGKP++SHV++T    G     +V+G+GAE++ T ++ 
Sbjct: 6   VILAAGQGTRMRSAKPKVLHALAGKPLVSHVLDTAEQLGATRTHVVIGHGAEQVETELD- 64

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQG 126
                V + +Q  Q+GT HAV    D +  G   V+I+YGDVPL+ + TL   +D++ + 
Sbjct: 65  --GRDVRFALQAEQKGTGHAVAQTLDELGDG--KVLILYGDVPLIRAETLTALLDEVDE- 119

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNE--IIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
             + ++    D+P GYGR+ +++ E  +  I E  DA++ ER I  CN+G++A  G  + 
Sbjct: 120 RRLGLLTVTLDDPGGYGRI-VRDAEGRVTRIVEHKDASEAERGITECNTGIVAATGTQLK 178

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASID-VKEQEVCGCNNRYELSLIENIWQS 243
            WL Q+       EYYLTDI   A  +G  +A+       EV G NNR +++ +E  +Q 
Sbjct: 179 RWLPQLSAENAQGEYYLTDIFAMAAAEGIEVATASPASALEVEGVNNRSQMAALERAYQR 238

Query: 244 RYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGVSIENYVQIR-- 295
               +++  GV +  P    +       HD  I    V E  V  G GVS+  Y  IR  
Sbjct: 239 DRAERLLTEGVALADPARFDVRGRLQCGHDVFIDVGCVFEGDVTLGDGVSVGPYTLIRDS 298

Query: 296 ---------AFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
                    A S +EG  + ++  IGPFAR+R  T + +  ++GNF E K A + EGSKI
Sbjct: 299 HVAAGTVIEAHSIIEGAEVAEQAHIGPFARLRPGTRLARQSKVGNFVETKNAEVGEGSKI 358

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
           NHLSYVGD+ +G  VNIGAGTITCNYDG +K++T I ++ F+GSN++L+AP+ +G G  +
Sbjct: 359 NHLSYVGDASLGGGVNIGAGTITCNYDGANKHRTEIGDDVFVGSNTALVAPVALGAGATI 418

Query: 407 ASGSIITQDTPENSLVFARSRQIVK 431
            +GS I++D    +L  AR+RQ  +
Sbjct: 419 GAGSTISRDVEAGALAVARTRQTTR 443


>gi|92115397|ref|YP_575325.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase
           [Chromohalobacter salexigens DSM 3043]
 gi|91798487|gb|ABE60626.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase
           [Chromohalobacter salexigens DSM 3043]
          Length = 456

 Score =  318 bits (816), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 170/445 (38%), Positives = 259/445 (58%), Gaps = 28/445 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI-TRINF 66
           ++LAAG+G RM+S+  KVL  +AGKP++SHV++T    G     +V+G+GAE++ T ++ 
Sbjct: 9   VILAAGQGTRMRSAKPKVLHALAGKPLVSHVLDTAEQLGATRTHVVIGHGAEQVETELD- 67

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQG 126
                V + +Q  Q+GT HAV    D +  G   V+I+YGDVPL+ + TL   +D++ + 
Sbjct: 68  --GRDVRFALQAEQKGTGHAVAQTLDELGDG--KVLILYGDVPLIRAETLTALLDEVDE- 122

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNE--IIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
             + ++    D+P GYGR+ +++ E  +  I E  DA++ ER I  CN+G++A  G  + 
Sbjct: 123 RRLGLLTVTLDDPGGYGRI-VRDAEGRVTRIVEHKDASEAERGITECNTGIVAATGTQLK 181

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASID-VKEQEVCGCNNRYELSLIENIWQS 243
            WL Q+       EYYLTDI   A  +G  +A+       EV G NNR +++ +E  +Q 
Sbjct: 182 RWLPQLSAENAQGEYYLTDIFAMAAAEGIEVATASPASALEVEGVNNRSQMAALERAYQR 241

Query: 244 RYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGVSIENYVQIR-- 295
               +++  GV +  P    +       HD  I    V E  V  G GVS+  Y  IR  
Sbjct: 242 DRAERLLTEGVALADPARFDVRGRLQCGHDVFIDVGCVFEGDVTLGDGVSVGPYTLIRDS 301

Query: 296 ---------AFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
                    A S +EG  + ++  IGPFAR+R  T + +  ++GNF E K A + EGSKI
Sbjct: 302 HVAAGTVIEAHSIIEGAEVAEQAHIGPFARLRPGTRLARQSKVGNFVETKNAEVGEGSKI 361

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
           NHLSYVGD+ +G  VNIGAGTITCNYDG +K++T I ++ F+GSN++L+AP+ +G G  +
Sbjct: 362 NHLSYVGDASLGGGVNIGAGTITCNYDGANKHRTEIGDDVFVGSNTALVAPVALGAGATI 421

Query: 407 ASGSIITQDTPENSLVFARSRQIVK 431
            +GS I++D    +L  AR+RQ  +
Sbjct: 422 GAGSTISRDVEAGALAVARTRQTTR 446


>gi|27469202|ref|NP_765839.1| UDP-N-acetylglucosamine pyrophosphorylase [Staphylococcus
           epidermidis ATCC 12228]
 gi|57866043|ref|YP_187733.1| UDP-N-acetylglucosamine pyrophosphorylase [Staphylococcus
           epidermidis RP62A]
 gi|282875429|ref|ZP_06284301.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Staphylococcus epidermidis SK135]
 gi|293366141|ref|ZP_06612828.1| UDP-N-acetylglucosamine diphosphorylase [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|81675413|sp|Q5HRQ6|GLMU_STAEQ RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|81842449|sp|Q8CMT0|GLMU_STAES RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|27316751|gb|AAO05926.1|AE016751_221 UDP-N-acetylglucosamine pyrophosphorylase [Staphylococcus
           epidermidis ATCC 12228]
 gi|57636701|gb|AAW53489.1| UDP-N-acetylglucosamine pyrophosphorylase [Staphylococcus
           epidermidis RP62A]
 gi|281295786|gb|EFA88308.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Staphylococcus epidermidis SK135]
 gi|291319735|gb|EFE60094.1| UDP-N-acetylglucosamine diphosphorylase [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329723932|gb|EGG60457.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Staphylococcus epidermidis VCU144]
 gi|329733039|gb|EGG69378.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Staphylococcus epidermidis VCU028]
 gi|329737898|gb|EGG74126.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Staphylococcus epidermidis VCU045]
          Length = 451

 Score =  318 bits (815), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 179/449 (39%), Positives = 265/449 (59%), Gaps = 24/449 (5%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR 63
           +R AI+LAAG+G RMKS   KVL ++AGKPM+ HV+  +  AG++ +  ++G+GAE +  
Sbjct: 2   QRHAIILAAGKGTRMKSKKYKVLHEVAGKPMVEHVLNNVKQAGVDQIVTIIGHGAESVKD 61

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKI 123
                +L   Y  QD Q GTAHAV  A + +       +++ GD PL++  TL+  ++  
Sbjct: 62  TLGNQSL---YSFQDKQLGTAHAVKMAHEHLADKEGTTLVVCGDTPLITYQTLQSLIEHH 118

Query: 124 AQGYS-IAVVGFNADNPKGYGRLLIKNNEIIA-IREENDATDEERKIHYCNSGLMAIDGL 181
               S + V+  +  NP GYGR++  +N I+  I EE DA D ER I   +SG+ A +  
Sbjct: 119 ESTQSHVTVLSASTINPYGYGRIIRNHNGILERIVEEKDANDSERAIKEISSGIFAFNNR 178

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ--EVCGCNNRYELSLIEN 239
            + + L Q+K +    EYYL D++     DG   A +   E   E+ G N+R  LS  E 
Sbjct: 179 VLFEKLEQVKNDNAQGEYYLPDVLSLILKDGGK-AEVYCTEDFDEIIGVNDRLMLSEAEK 237

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSY 299
             Q R  R  M +GVT+I P + F+  D  I  DT IEP V  G   +IE  V I  +S 
Sbjct: 238 ALQQRINRYHMENGVTIIDPSSTFIGTDVKIGIDTTIEPGVRIGGHTTIEEDVWIGQYSE 297

Query: 300 LEG--VH--------------IGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG 343
           +    +H              +G+ T +GPFA++R  + +   V++GNF EVKKA IK+G
Sbjct: 298 INNSTIHSNANIKQSVINDSIVGENTTVGPFAQLRPGSNLGSEVKVGNFVEVKKADIKDG 357

Query: 344 SKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQG 403
           +K++HLSY+GD+ +G+  NIG G+IT NYDG +K+KT + ++AFIG N++LIAP+T+G  
Sbjct: 358 AKVSHLSYIGDAEIGERTNIGCGSITVNYDGANKFKTIVGKDAFIGCNTNLIAPVTVGNH 417

Query: 404 TYVASGSIITQDTPENSLVFARSRQIVKE 432
           T +A+GS IT + PE+SL  AR+RQ+ KE
Sbjct: 418 TLIAAGSTITDNIPEDSLALARARQVNKE 446


>gi|148826725|ref|YP_001291478.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Haemophilus influenzae PittEE]
 gi|229847421|ref|ZP_04467521.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Haemophilus influenzae 7P49H1]
 gi|166226100|sp|A5UE94|GLMU_HAEIE RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|148716885|gb|ABQ99095.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Haemophilus influenzae PittEE]
 gi|229809659|gb|EEP45385.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Haemophilus influenzae 7P49H1]
 gi|309751764|gb|ADO81748.1| N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate acetyl
           transferase [Haemophilus influenzae R2866]
 gi|309973866|gb|ADO97067.1| N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate acetyl
           transferase [Haemophilus influenzae R2846]
          Length = 456

 Score =  318 bits (814), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 174/447 (38%), Positives = 263/447 (58%), Gaps = 23/447 (5%)

Query: 1   MKRKRL-AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAE 59
           M +K L A++LAAG+G RM S   KVL  IAGKPM+ HV++T    G EN+ L+ G+G +
Sbjct: 1   MTKKALSAVILAAGKGTRMYSDLPKVLHTIAGKPMVKHVIDTAHQLGAENIHLIYGHGGD 60

Query: 60  EITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKA 119
            + R +      V + +Q  Q GTAHAV  A    K   ++++++YGD PL++  TL+K 
Sbjct: 61  -VMRTHLANE-QVNWVLQTEQLGTAHAVQQAAPFFKDN-ENIVVLYGDAPLITKETLEKL 117

Query: 120 MDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAID 179
           +D   +   IA++  N DNP GYGR++ +N  ++AI E+ DA  ++  I   N+G+M  D
Sbjct: 118 IDAKPEN-GIALLTVNLDNPTGYGRIIRENGNVVAIVEQKDANADQLNIKEVNTGVMVSD 176

Query: 180 GLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIE 238
           G     WL ++  N    EYYLTD+I  A  D   + ++   +  EV G NNR +L+ +E
Sbjct: 177 GASFKKWLARVGNNNAQGEYYLTDLIALANQDNCQVVAVQATDVMEVEGANNRLQLAALE 236

Query: 239 NIWQSRYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG--------C 284
              Q++   ++++ GV +  P       T+    D  I  + +IE +V  G        C
Sbjct: 237 RYLQNKQASKLLLEGVMIYDPARFDLRGTLEHGKDVEIDVNVIIEGNVKLGDRVKIGAGC 296

Query: 285 ---GVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIK 341
               V I N V+I+ +S LE   +G+K  IGPF+R+R    +     +GNF E+KK+T+ 
Sbjct: 297 VLKNVVIGNDVEIKPYSVLEDSIVGEKAAIGPFSRLRPGAELAAETHVGNFVEIKKSTVG 356

Query: 342 EGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIG 401
           +GSK+NHL+YVGDS +G N NIGAG ITCNYDG +K+KT I ++ F+GS++ L+AP+ + 
Sbjct: 357 KGSKVNHLTYVGDSEIGSNCNIGAGVITCNYDGANKFKTIIGDDVFVGSDTQLVAPVKVA 416

Query: 402 QGTYVASGSIITQDTPENSLVFARSRQ 428
            G  + +G+ IT+D  EN LV  R  Q
Sbjct: 417 NGATIGAGTTITRDVGENELVITRVAQ 443


>gi|145638008|ref|ZP_01793643.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Haemophilus influenzae PittHH]
 gi|145268802|gb|EDK08770.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Haemophilus influenzae PittHH]
          Length = 456

 Score =  318 bits (814), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 174/447 (38%), Positives = 264/447 (59%), Gaps = 23/447 (5%)

Query: 1   MKRKRL-AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAE 59
           M +K L A++LAAG+G RM S   KVL  IAGKPM+ HV++T    G EN+ L+ G+G +
Sbjct: 1   MTKKALSAVILAAGKGTRMYSDLPKVLHTIAGKPMVKHVIDTAHQLGSENIHLIYGHGGD 60

Query: 60  EITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKA 119
            + R +      V + +Q  Q GTAHAV  A    K   ++++++YGD PL++  TL+K 
Sbjct: 61  -LMRTHLANE-QVNWVLQTEQLGTAHAVQQAAPFFKDN-ENIVVLYGDAPLITKETLEKL 117

Query: 120 MDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAID 179
           ++   +   IA++  N DNP GYGR++ +N  ++AI E+ D+  E+  I   N+G+M  D
Sbjct: 118 IEAKPEN-GIALLTVNLDNPTGYGRIIRENGNVVAIVEQKDSNAEQLNIKEVNTGVMVSD 176

Query: 180 GLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIE 238
           G     WL ++  N    EYYLTD+I  A  D   + ++   +  EV G NNR +L+ +E
Sbjct: 177 GASFKKWLARVGNNNAQGEYYLTDLIALANQDNCQVVAVQATDVMEVEGANNRLQLAALE 236

Query: 239 NIWQSRYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG--------C 284
             +Q++   ++++ GV +  P       T+    D  I  + +IE +V  G        C
Sbjct: 237 RYFQNKQASKLLLEGVMIHDPARFDLRGTLEHGKDVEIDVNVIIEGNVKLGDRVKIGAGC 296

Query: 285 ---GVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIK 341
               V I N V+I+ +S LE   +G+K  IGPF+R+R    +     +GNF E+KK+T+ 
Sbjct: 297 VLKNVVIGNDVEIKPYSVLEDSVVGEKAAIGPFSRLRPGAELAAETHVGNFVEIKKSTVG 356

Query: 342 EGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIG 401
           +GSK+NHL+YVGDS +G N NIGAG ITCNYDG +K+KT I +N F+GS++ L+AP+ + 
Sbjct: 357 KGSKVNHLTYVGDSEIGSNCNIGAGVITCNYDGANKFKTIIGDNVFVGSDTQLVAPVKVA 416

Query: 402 QGTYVASGSIITQDTPENSLVFARSRQ 428
            G  + +G+ IT+D  EN LV  R  Q
Sbjct: 417 NGATIGAGTTITRDVGENELVITRVAQ 443


>gi|114322014|ref|YP_743697.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase
           [Alkalilimnicola ehrlichii MLHE-1]
 gi|114228408|gb|ABI58207.1| UDP-N-acetylglucosamine pyrophosphorylase [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 466

 Score =  318 bits (814), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 173/442 (39%), Positives = 253/442 (57%), Gaps = 28/442 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI--TRIN 65
           +VLAAG+G RM+S   K+L  + G+PM+ HV+ T  +   E V +V G+GAE +     +
Sbjct: 11  VVLAAGKGTRMRSRYPKLLHPVGGRPMLDHVLRTAFSLEPEAVHVVHGHGAEAVQAAHAD 70

Query: 66  FPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQ 125
           +P    V + +Q+ Q GT HAV  A  AI P    V+++YGDVPLV   TL+  + +   
Sbjct: 71  WP----VRWVVQEPQLGTGHAVEQAIPAI-PDDHQVLVLYGDVPLVRPETLQALLAEADG 125

Query: 126 GYSIAVVGFNADNPKGYGRLLIKNN-EIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
           G  +  V F   +P GYGR+L   +  +  + E  DAT  +R++  CN+GL+A     + 
Sbjct: 126 GLGLLSVDFP--DPTGYGRVLRDGHGAVTGVVEHKDATAAQRRVTECNTGLLAAPAGRLK 183

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQS 243
            WL ++  +    EYYLTD+I  A  DG  +A+  V +  EV G N+R +L+  E +WQ 
Sbjct: 184 AWLQRLDNDNAQAEYYLTDVIAMAVADGVRVAAYPVADPAEVQGVNDRVQLAAAERVWQR 243

Query: 244 RYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGVSIENYVQIR-- 295
           R     M +GVT++ P+   L        D  I    V+E  V  G GV I  +  +R  
Sbjct: 244 RQAEDWMRAGVTILDPDRFDLRGHFAAGEDCRIDVGVVLEGRVELGAGVEIGPHCVLRDV 303

Query: 296 ---------AFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
                    A S L+G   G+   IGPFAR+R  T +    ++GNF E K A I  GSK+
Sbjct: 304 ALGDGTRVEAHSVLDGATAGRNCRIGPFARLRPGTDLADGAKVGNFVETKAARIGPGSKV 363

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
           NHLSY+GD+ +G++VN+GAGTITCNYDG  K++T I + AFIGS + L+AP+ +G+G  +
Sbjct: 364 NHLSYMGDAELGRDVNVGAGTITCNYDGHSKHRTEIGDGAFIGSGTQLVAPVRVGRGATI 423

Query: 407 ASGSIITQDTPENSLVFARSRQ 428
            +GS +T+D P+ +L  ARS Q
Sbjct: 424 GAGSTVTRDAPDEALTVARSAQ 445


>gi|16272585|ref|NP_438802.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Haemophilus influenzae Rd KW20]
 gi|260581382|ref|ZP_05849197.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Haemophilus influenzae RdAW]
 gi|1169921|sp|P43889|GLMU_HAEIN RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|165761161|pdb|2V0H|A Chain A, Characterization Of Substrate Binding And Catalysis Of The
           Potential Antibacterial Target N-Acetylglucosamine-1-
           Phosphate Uridyltransferase (Glmu)
 gi|165761163|pdb|2V0I|A Chain A, Characterization Of Substrate Binding And Catalysis Of The
           Potential Antibacterial Target N-Acetylglucosamine-1-
           Phosphate Uridyltransferase (Glmu)
 gi|165761165|pdb|2V0J|A Chain A, Characterization Of Substrate Binding And Catalysis Of The
           Potential Antibacterial Target N-Acetylglucosamine-1-
           Phosphate Uridyltransferase (Glmu)
 gi|165761167|pdb|2V0K|A Chain A, Characterization Of Substrate Binding And Catalysis Of The
           Potential Antibacterial Target N-Acetylglucosamine-1-
           Phosphate Uridyltransferase (Glmu)
 gi|165761169|pdb|2V0L|A Chain A, Characterization Of Substrate Binding And Catalysis Of The
           Potential Antibacterial Target N-Acetylglucosamine-1-
           Phosphate Uridyltransferase (Glmu)
 gi|165761217|pdb|2VD4|A Chain A, Structure Of Small-Molecule Inhibitor Of Glmu From
           Haemophilus Influenzae Reveals An Allosteric Binding
           Site
 gi|268612100|pdb|2W0V|A Chain A, Crystal Structure Of Glmu From Haemophilus Influenzae In
           Complex With Quinazoline Inhibitor 1
 gi|268612101|pdb|2W0W|A Chain A, Crystal Structure Of Glmu From Haemophilus Influenzae In
           Complex With Quinazoline Inhibitor 2
 gi|1573640|gb|AAC22302.1| UDP-N-acetylglucosamine pyrophosphorylase (glmU) [Haemophilus
           influenzae Rd KW20]
 gi|260091977|gb|EEW75925.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Haemophilus influenzae RdAW]
          Length = 456

 Score =  318 bits (814), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 174/447 (38%), Positives = 264/447 (59%), Gaps = 23/447 (5%)

Query: 1   MKRKRL-AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAE 59
           M +K L A++LAAG+G RM S   KVL  IAGKPM+ HV++T    G EN+ L+ G+G +
Sbjct: 1   MTKKALSAVILAAGKGTRMYSDLPKVLHTIAGKPMVKHVIDTAHQLGSENIHLIYGHGGD 60

Query: 60  EITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKA 119
            + R +      V + +Q  Q GTAHAV  A    K   ++++++YGD PL++  TL+K 
Sbjct: 61  -LMRTHLANE-QVNWVLQTEQLGTAHAVQQAAPFFKDN-ENIVVLYGDAPLITKETLEKL 117

Query: 120 MDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAID 179
           ++   +   IA++  N DNP GYGR++ +N  ++AI E+ DA  E+  I   N+G+M  D
Sbjct: 118 IEAKPEN-GIALLTVNLDNPTGYGRIIRENGNVVAIVEQKDANAEQLNIKEVNTGVMVSD 176

Query: 180 GLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIE 238
           G     WL ++  N    EYYLTD+I  A  D   + ++   +  EV G NNR +L+ +E
Sbjct: 177 GASFKKWLARVGNNNAQGEYYLTDLIALANQDNCQVVAVQATDVMEVEGANNRLQLAALE 236

Query: 239 NIWQSRYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG--------C 284
             +Q++   ++++ GV +  P       T+    D  I  + +IE +V  G        C
Sbjct: 237 RYFQNKQASKLLLEGVMIYDPARFDLRGTLEHGKDVEIDVNVIIEGNVKLGDRVKIGTGC 296

Query: 285 ---GVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIK 341
               V I N V+I+ +S LE   +G+K  IGPF+R+R    +     +GNF E+KK+T+ 
Sbjct: 297 VLKNVVIGNDVEIKPYSVLEDSIVGEKAAIGPFSRLRPGAELAAETHVGNFVEIKKSTVG 356

Query: 342 EGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIG 401
           +GSK+NHL+YVGDS +G N NIGAG ITCNYDG +K+KT I ++ F+GS++ L+AP+ + 
Sbjct: 357 KGSKVNHLTYVGDSEIGSNCNIGAGVITCNYDGANKFKTIIGDDVFVGSDTQLVAPVKVA 416

Query: 402 QGTYVASGSIITQDTPENSLVFARSRQ 428
            G  + +G+ IT+D  EN LV  R  Q
Sbjct: 417 NGATIGAGTTITRDVGENELVITRVAQ 443


>gi|288939812|ref|YP_003442052.1| UDP-N-acetylglucosamine pyrophosphorylase [Allochromatium vinosum
           DSM 180]
 gi|288895184|gb|ADC61020.1| UDP-N-acetylglucosamine pyrophosphorylase [Allochromatium vinosum
           DSM 180]
          Length = 454

 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 173/442 (39%), Positives = 262/442 (59%), Gaps = 27/442 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI-TRINF 66
           ++LAAG+G RM+S   KVL  +AG+P+++HV+    A     + +V G+G E++   +  
Sbjct: 6   VILAAGQGKRMRSRRPKVLHPLAGRPLLAHVLAAARALDPARIVVVHGHGGEQVRAALAD 65

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQG 126
              L VE   Q  Q+GT HAV+ A  A+    D V+++YGDVPL++  TL++ +  +A  
Sbjct: 66  EDCLWVE---QAEQRGTGHAVIQAMPALT-DMDRVLVLYGDVPLITPETLERLV-ALAGS 120

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNE--IIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
             +AV+    D+P GYGR+L ++ E  ++ I E+ DAT +ER I   N+G +  D   ++
Sbjct: 121 TPLAVLTAELDDPSGYGRIL-RDAEARVVRIVEDKDATSDERAIREINTGFLVADHARLV 179

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQS 243
            WL +I  +    EYYLTD+IE A  +G +IA+   ++  EV G N+R +L+ +E I Q 
Sbjct: 180 SWLDRIDDDNAQGEYYLTDVIELAAREGVAIATTQPEDLHEVAGVNDRVQLAELERIHQR 239

Query: 244 RYRRQMMISGVTMIAPETVFLSHDTIIQPDT------VIEPHVFFGCGVSI-ENYV---- 292
           R    +M SGVT+  P    L      +PD       VIE  V    GV +  N V    
Sbjct: 240 RQAESLMRSGVTLADPARFDLRGRLDTEPDVFIDVNVVIEGEVRLASGVRVGPNCVLKDC 299

Query: 293 ------QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
                 +I+A   +E   +G    IGPFAR+R E  +  +  +GNF E+KK  +  GSK+
Sbjct: 300 VIGPDTEIQANCVIESAEVGANARIGPFARLRPEARLADDTHVGNFVEIKKTQVGRGSKV 359

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
           NHL+Y+GD+ VG  VN+GAGTITCNYDG +K+KT I + AFIGSN++L+AP+T+G G  +
Sbjct: 360 NHLTYLGDAEVGAGVNVGAGTITCNYDGVNKFKTRIGDGAFIGSNTALVAPVTVGAGATI 419

Query: 407 ASGSIITQDTPENSLVFARSRQ 428
            +GS++T++ P + L   R+RQ
Sbjct: 420 GAGSVVTREAPADQLTLTRARQ 441


>gi|332289732|ref|YP_004420584.1| uridyltransferase/glucosamine-1-phosphate acetyltransferase
           [Gallibacterium anatis UMN179]
 gi|330432628|gb|AEC17687.1| uridyltransferase/glucosamine-1-phosphate acetyltransferase
           [Gallibacterium anatis UMN179]
          Length = 461

 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 174/446 (39%), Positives = 264/446 (59%), Gaps = 32/446 (7%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  IAGKPM+ HV++T+A  G   + LV G+GAE + +    
Sbjct: 9   VILAAGKGTRMYSDLPKVLHPIAGKPMVKHVIDTVAKLGANQIHLVYGHGAELLQQ--RL 66

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAMDKIA 124
               V + +Q  Q GT HA+  A     P ++D   ++++YGD PL+S+ T+++ +    
Sbjct: 67  ANEKVNWVLQAQQLGTGHAMQQA----APYFNDNETIVMLYGDGPLISAETIQQLIAAKP 122

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNNE----IIAIREENDATDEERKIHYCNSGLMAIDG 180
           +   IA++    D+P GYGR+L +NN+    II I E+ DA+ E+ KI   N+GL+A DG
Sbjct: 123 EN-GIALLTVKLDDPTGYGRILRENNQADGNIIGIVEQKDASAEQLKIQEINTGLLACDG 181

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIEN 239
             +  WL Q+  N   +EYY+TDII  A  DG  + S+  ++  EV G NNR +L+ +E 
Sbjct: 182 KNLKKWLSQLTNNNAQKEYYITDIIAMAYHDGCKVVSVHPQDPMEVEGVNNRLQLARLER 241

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFF--------------GC- 284
            +Q +   ++++ GV +  P    L  + I   D  I+ +V                GC 
Sbjct: 242 YYQQKNAERLLLEGVMLADPNRFDLRGELIHGKDVEIDINVIIEGNVKLGDRVKIGAGCV 301

Query: 285 --GVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKE 342
              V + + V+I+ +S  E   IGK   +GPF+R+R    +  NV +GNF E+KKAT+  
Sbjct: 302 LKNVEVADDVEIKPYSVFEDAVIGKGAQVGPFSRLRPGAVLADNVHVGNFVEIKKATVGV 361

Query: 343 GSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQ 402
           GSK+NHL+YVGD+V+GK+ N+GAG ITCNYDG +K++T I +N F+GS+  L+AP+++  
Sbjct: 362 GSKVNHLTYVGDAVIGKDCNLGAGVITCNYDGANKFQTTIGDNVFVGSDVQLVAPVSVAD 421

Query: 403 GTYVASGSIITQDTPENSLVFARSRQ 428
           G  + +GS IT+D  EN LV  R  Q
Sbjct: 422 GATIGAGSTITKDIAENELVITRVPQ 447


>gi|190575939|ref|YP_001973784.1| putative UDP-N-acetylglucosamine synthesis bifunctional protein
           [Stenotrophomonas maltophilia K279a]
 gi|254798806|sp|B2FHY5|GLMU_STRMK RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|190013861|emb|CAQ47499.1| putative UDP-N-acetylglucosamine synthesis bifunctional protein
           [Stenotrophomonas maltophilia K279a]
          Length = 455

 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 178/440 (40%), Positives = 255/440 (57%), Gaps = 24/440 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG G RMKS   KVLQ IAG+PM++HV++         + +V G+G E + R  F 
Sbjct: 8   IILAAGAGKRMKSVLPKVLQPIAGQPMLAHVIDAARELQPAAIHVVHGHGGEAV-RQYFA 66

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               +++  Q  Q GT HAV  A   + P    V+++YGDVPL+ + TL+   D +AQ  
Sbjct: 67  GQPDLQWAEQAQQLGTGHAVAQAMPQV-PDLAQVLVLYGDVPLIRAQTLR---DLLAQPG 122

Query: 128 SIAVVGFNADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
            +AV+  + D+P GYGR+L     ++ AI E+ DATD++ ++   N+G++A +   +  W
Sbjct: 123 RLAVLVADVDDPTGYGRVLRDAEGKVGAIIEQKDATDDQLRVRTINTGIIAAESTALRRW 182

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLD-GKSIASIDVKEQEVCGCNNRYELSLIENIWQSRY 245
           L Q+  +    EYYLTD+   A  +   +  ++    QE  G N+ ++LS +E  WQ R 
Sbjct: 183 LSQLSNSNAQGEYYLTDVFAFAAHEYTPAEMALVADAQEAEGANDPWQLSQLERAWQRRA 242

Query: 246 RRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGVSIENY-------- 291
            R +   G  +  P       TV +  D +I  D V+E  V  G GV++  +        
Sbjct: 243 VRALCAQGARVRDPARLDIRGTVTVGSDVLIDVDVVLEGKVVLGDGVTVGPFNRLKDVNL 302

Query: 292 ---VQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
                +RA   LEGV       IGPFAR+R  T +   V +GNF E KK T+  GSK NH
Sbjct: 303 GPGTDVRAHCDLEGVVTEGAAQIGPFARLRPGTVLADGVHVGNFVETKKVTLGVGSKANH 362

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           L+Y+GD+V+G  VNIGAGTITCNYDG +K  T I +NAFIGSNSSL+AP+TIG G  +A+
Sbjct: 363 LTYLGDAVIGSKVNIGAGTITCNYDGVNKSTTTIGDNAFIGSNSSLVAPVTIGDGATIAA 422

Query: 409 GSIITQDTPENSLVFARSRQ 428
           GS+IT++ P+  L  AR+RQ
Sbjct: 423 GSVITRNAPDGKLTLARARQ 442


>gi|326390849|ref|ZP_08212401.1| UDP-N-acetylglucosamine pyrophosphorylase [Thermoanaerobacter
           ethanolicus JW 200]
 gi|325993108|gb|EGD51548.1| UDP-N-acetylglucosamine pyrophosphorylase [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 457

 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 186/456 (40%), Positives = 271/456 (59%), Gaps = 25/456 (5%)

Query: 6   LAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRIN 65
           + ++LAAG G RMKS   KV+ K+ GKPMI  V++ +   G + V +V+G+ AEE+  + 
Sbjct: 5   VTLILAAGLGKRMKSKHPKVVHKVCGKPMIEWVVDAVEEIGSKEVIVVVGHKAEEVKEV- 63

Query: 66  FPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMD-KIA 124
                 V+Y  Q+ Q GT HAV+ A+D + P   +V+I+ GD PL++S+TLK+ ++  I 
Sbjct: 64  --LKERVKYAYQEVQLGTGHAVMMAEDLL-PEEGNVLILTGDTPLITSNTLKELINFHIK 120

Query: 125 QGYSIAVVGFNADNPKGYGRLL-IKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
           +  S+ ++    ++P GYGR++  ++  +I I E+ DA++EE+ IH  NS +  +D   +
Sbjct: 121 ERNSVTILSSVLEDPTGYGRIIRDESGNVIKIVEDKDASEEEKSIHEINSAMYVMDIAKL 180

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKAR-LDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
              L  I  N    EYYLTD +E  R +DGK I +  V  +E+ G N+R +L   E I +
Sbjct: 181 KKALRMITNNNAQGEYYLTDAVEIIRDMDGK-IGAFTVPSEEITGVNSRVQLFEAEKIMR 239

Query: 243 SRYRRQMMISGVTMIAPETVFLSH------DTIIQPDTVIEPHVFFGCGVSIENYVQIR- 295
            R   + M +GVT++ P+T ++        DT+I P  VIE     G    I    +I  
Sbjct: 240 KRINYRHMENGVTIVDPDTTYIGAEVEIGADTVILPGCVIEGKTKIGSDCEIGPNCRIVD 299

Query: 296 ---------AFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
                     +S +    I     IGPFA IR ET I+ NV+IG+F E+KK+ I EGSK+
Sbjct: 300 SEIGDGCSVTYSVILSSKIENNVKIGPFAHIRPETVIQSNVKIGDFVEIKKSIIDEGSKV 359

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
            HL+YVGD+ VGKNVN+G G+IT NYDG  KYKT I +N F+G N +L+AP+ IG   Y+
Sbjct: 360 PHLTYVGDAEVGKNVNMGCGSITVNYDGKQKYKTVIGDNVFVGCNVNLVAPVKIGNNAYI 419

Query: 407 ASGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           A+GS IT+D PE +L  ARSRQ  KE G +  R KK
Sbjct: 420 AAGSTITEDVPEGALAIARSRQTNKE-GWVQERIKK 454


>gi|119370125|sp|Q0A4N0|GLMU_ALHEH RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
          Length = 463

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 173/442 (39%), Positives = 253/442 (57%), Gaps = 28/442 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI--TRIN 65
           +VLAAG+G RM+S   K+L  + G+PM+ HV+ T  +   E V +V G+GAE +     +
Sbjct: 8   VVLAAGKGTRMRSRYPKLLHPVGGRPMLDHVLRTAFSLEPEAVHVVHGHGAEAVQAAHAD 67

Query: 66  FPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQ 125
           +P    V + +Q+ Q GT HAV  A  AI P    V+++YGDVPLV   TL+  + +   
Sbjct: 68  WP----VRWVVQEPQLGTGHAVEQAIPAI-PDDHQVLVLYGDVPLVRPETLQALLAEADG 122

Query: 126 GYSIAVVGFNADNPKGYGRLLIKNN-EIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
           G  +  V F   +P GYGR+L   +  +  + E  DAT  +R++  CN+GL+A     + 
Sbjct: 123 GLGLLSVDFP--DPTGYGRVLRDGHGAVTGVVEHKDATAAQRRVTECNTGLLAAPAGRLK 180

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQS 243
            WL ++  +    EYYLTD+I  A  DG  +A+  V +  EV G N+R +L+  E +WQ 
Sbjct: 181 AWLQRLDNDNAQAEYYLTDVIAMAVADGVRVAAYPVADPAEVQGVNDRVQLAAAERVWQR 240

Query: 244 RYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGVSIENYVQIR-- 295
           R     M +GVT++ P+   L        D  I    V+E  V  G GV I  +  +R  
Sbjct: 241 RQAEDWMRAGVTILDPDRFDLRGHFAAGEDCRIDVGVVLEGRVELGAGVEIGPHCVLRDV 300

Query: 296 ---------AFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
                    A S L+G   G+   IGPFAR+R  T +    ++GNF E K A I  GSK+
Sbjct: 301 ALGDGTRVEAHSVLDGATAGRNCRIGPFARLRPGTDLADGAKVGNFVETKAARIGPGSKV 360

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
           NHLSY+GD+ +G++VN+GAGTITCNYDG  K++T I + AFIGS + L+AP+ +G+G  +
Sbjct: 361 NHLSYMGDAELGRDVNVGAGTITCNYDGHSKHRTEIGDGAFIGSGTQLVAPVRVGRGATI 420

Query: 407 ASGSIITQDTPENSLVFARSRQ 428
            +GS +T+D P+ +L  ARS Q
Sbjct: 421 GAGSTVTRDAPDEALTVARSAQ 442


>gi|240949281|ref|ZP_04753625.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Actinobacillus minor NM305]
 gi|257464693|ref|ZP_05629064.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Actinobacillus minor 202]
 gi|240296397|gb|EER47041.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Actinobacillus minor NM305]
 gi|257450353|gb|EEV24396.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Actinobacillus minor 202]
          Length = 455

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 172/450 (38%), Positives = 261/450 (58%), Gaps = 30/450 (6%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M +    ++LAAG+G RM S   KVL  +AGKPM+ HV++T        + L+ G+GA+ 
Sbjct: 1   MTQALSVVILAAGKGTRMYSDLPKVLHPVAGKPMVKHVIDTAKQLNARQINLIYGHGADL 60

Query: 61  IT-RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTL 116
           +  R++  P   V +  Q  Q GT HA+  A     P + D   ++++YGD PL+   TL
Sbjct: 61  LKERLSDEP---VNWVFQAEQLGTGHAMQQA----APFFADDENIVMLYGDAPLIQKETL 113

Query: 117 KKAMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLM 176
           +K +    +   IA++    DNP GYGR++ +N  ++AI E+ DA  E+ KI   N+G+M
Sbjct: 114 EKLIAAKPEN-GIALLTVELDNPTGYGRIIRENGSVVAIVEQKDANPEQLKIREVNTGVM 172

Query: 177 AIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELS 235
              G     WL  +  N    EYY+TD+I  A  DG ++ ++   E  EV G NNR +L+
Sbjct: 173 VASGASFKKWLAGLNNNNAQGEYYITDVIAMANQDGFTVQAVQASEFMEVEGANNRLQLA 232

Query: 236 LIENIWQSRYRRQMMISGVTMIAPE------------TVFLSHDTIIQPDTVIEPHVFFG 283
            +E  +Q +   +++++GVT+I P+             V +  + I++ +  +  +V  G
Sbjct: 233 ALERFYQEKQAEKLLLAGVTIIDPKRFDIRGNITHGKDVSIDVNVILEGNIQLGNNVKIG 292

Query: 284 CGVSIENY-----VQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKA 338
            G  ++N      V+I+ +S LE   IG+   +GPFAR+R    +     +GNF E+KK+
Sbjct: 293 AGCVLKNVILGDNVEIKPYSVLEDSVIGESADVGPFARLRPGVELAAKAHVGNFVEIKKS 352

Query: 339 TIKEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPI 398
           TI EGSK+ HL+Y+GDS VG NVNIGAGTITCNYDG +K+KT I +N F+GS+S L+AP+
Sbjct: 353 TIGEGSKVGHLTYIGDSEVGANVNIGAGTITCNYDGANKFKTVIGDNVFVGSDSQLVAPV 412

Query: 399 TIGQGTYVASGSIITQDTPENSLVFARSRQ 428
           TI  G  + +G+ IT+D  EN LV  R  Q
Sbjct: 413 TIANGATIGAGATITKDVAENELVITRVPQ 442


>gi|320451345|ref|YP_004203441.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Thermus scotoductus SA-01]
 gi|320151514|gb|ADW22892.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Thermus scotoductus SA-01]
          Length = 453

 Score =  317 bits (812), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 162/440 (36%), Positives = 252/440 (57%), Gaps = 24/440 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRI--N 65
           ++LAAG+G RMKS   KVL  + GKPM+++ +ET  A   + + +V+G+GAE++  +   
Sbjct: 5   VILAAGQGTRMKSRLPKVLHPLLGKPMLAYAVETALALEPQRLVVVVGHGAEQVMEVLKA 64

Query: 66  FPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQ 125
           +P    VE  +Q+ Q GTAHA+L A+  +K      ++  GD PL+   TL+  ++++ +
Sbjct: 65  YP----VEVAVQEEQLGTAHALLQAEPLLKDFPGPTLVTQGDTPLLRPETLRDLLERVEE 120

Query: 126 GYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMD 185
           G  +A++     +P GYGR+L +  E++   EE DA+ E + I   N+G  A DG ++  
Sbjct: 121 GAGMALLTVELSDPTGYGRILRQGEEVLGSVEEKDASPEVKAIREVNAGAYAFDG-FLFQ 179

Query: 186 WLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRY 245
            L +++    ++EYYL D+I   R  G+ + ++    +E  G N R EL+ +E +  S  
Sbjct: 180 ALKEVRNENAAREYYLPDLIAIYRAKGRRVVAVKGVVEEALGVNTREELARVEGVLLSAL 239

Query: 246 RRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFF------GCGVSIENYV------- 292
           RR+ M  GV MI PE+++L     + PD  + P V        G G  +  Y        
Sbjct: 240 RREWMRKGVRMILPESIYLEASVELAPDVTLWPGVVLKGKTQIGEGAEVGPYAVLEDTLL 299

Query: 293 ----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
               ++ A +  +G  IG+    GPFAR+R    + + V +GNF EVK + +  G K  H
Sbjct: 300 EPGARVLAHTVAQGAVIGRGADAGPFARLRPGAVLREGVHVGNFVEVKNSLLHPGVKAGH 359

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           L+Y+GD+ VG+  NIGAG IT NYDG  K++T I + AFIGSNS L+AP+ +G G  V +
Sbjct: 360 LAYLGDAEVGEGTNIGAGVITANYDGKRKHRTFIGKGAFIGSNSVLVAPVRVGDGAMVGA 419

Query: 409 GSIITQDTPENSLVFARSRQ 428
           GS+IT D PE++L  AR RQ
Sbjct: 420 GSVITHDVPEDALAVARERQ 439


>gi|119383370|ref|YP_914426.1| nucleotidyl transferase [Paracoccus denitrificans PD1222]
 gi|189041286|sp|A1AZN6|GLMU_PARDP RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|119373137|gb|ABL68730.1| UDP-N-acetylglucosamine pyrophosphorylase [Paracoccus denitrificans
           PD1222]
          Length = 446

 Score =  317 bits (812), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 175/447 (39%), Positives = 256/447 (57%), Gaps = 8/447 (1%)

Query: 1   MKRKRLA-IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAE 59
           M  K +A IVLAAG+G RM+S   KVL ++ G P++ H + T      E V +V G+GAE
Sbjct: 1   MTEKPVALIVLAAGQGSRMQSDLPKVLHRLGGVPLVGHALSTGRTLEPEAVVVVAGHGAE 60

Query: 60  EITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKA 119
            + +         +  +Q+ Q GT HAV  A   ++     VI++YGD P +   TL   
Sbjct: 61  AVAKAVAKLNPEAKIALQEQQLGTGHAVSQALPQLEGFEGRVIVLYGDTPFIGQETLASL 120

Query: 120 MDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAID 179
               A    + V+GF A +P  YGRL+     +  I E  DA +  R I   NSG++A D
Sbjct: 121 A---AHPADVVVLGFEASDPGRYGRLVTGPEGLERIVEYKDADEATRAIRLVNSGVLAAD 177

Query: 180 GLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIEN 239
              + ++L  I     + EYYLTDI E AR  G  +  +   E E  G N R EL+  E 
Sbjct: 178 AALLREFLPMIGNRNAAGEYYLTDIPELARAAGHRVEVVTCDEAETLGINTRAELAAAEA 237

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSY 299
            +Q R R + +  GVTM  P TV+ + DT I  D VI  +V FG GV++E+  +I  F +
Sbjct: 238 AFQVRARARALEDGVTMTDPATVWFALDTCIGRDAVIGQNVVFGPGVTVESGAEILPFCH 297

Query: 300 LEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGK 359
           LEG H+     +GPFAR+R    +  +V +GNF E+K + + EG+K+ HL+Y+GD+ VG+
Sbjct: 298 LEGCHVSAGATVGPFARLRPGAELGGDVHVGNFVEIKNSVLDEGAKVGHLTYLGDAHVGE 357

Query: 360 NVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPEN 419
             NIGAGT+TCNYDG  K++T I  +AFIGS++ L+AP+ +G      SGS+IT+D P++
Sbjct: 358 ATNIGAGTVTCNYDGVSKHRTEIGAHAFIGSDTMLVAPVRVGARAMTGSGSVITEDVPDD 417

Query: 420 SLVFARSRQIVKEDGAL----SMRKKK 442
           +L   R++Q+VK   A     ++R+KK
Sbjct: 418 ALALGRAKQVVKPGLATRLMQALRQKK 444


>gi|307547026|ref|YP_003899505.1| UDP-N-acetylglucosamine pyrophosphorylase [Halomonas elongata DSM
           2581]
 gi|307219050|emb|CBV44320.1| UDP-N-acetylglucosamine pyrophosphorylase [Halomonas elongata DSM
           2581]
          Length = 455

 Score =  317 bits (811), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 170/455 (37%), Positives = 265/455 (58%), Gaps = 28/455 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRI--N 65
           ++LAAG+G RM+SS  KVL  +AGKPM+SH+++T +    E   +V+G+GAE +      
Sbjct: 6   VILAAGKGTRMRSSLPKVLHPLAGKPMVSHILDTTSGLEAERTHVVVGHGAERLREALAE 65

Query: 66  FPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQ 125
           +P    V + +Q  Q+GT HAV  + D +  G   V+++YGDVPL+   TL+  +  + +
Sbjct: 66  YP----VNFVLQAEQKGTGHAVAQSLDGLGEGK--VLVLYGDVPLIQRDTLRALLAPVDE 119

Query: 126 GYSIAVVGFNADNPKGYGRLLI-KNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
            + + ++    ++P GYGR+L  +  E +AI E+ DA +++R +  CN+G+MA+    + 
Sbjct: 120 DH-MGLLTVTLEDPTGYGRILRDEAGEAVAIVEQKDADEQQRAVRECNTGIMAMTTAQLR 178

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASID-VKEQEVCGCNNRYELSLIENIWQS 243
            WL Q+       EYYLTD+I  A  +G  +A+    +  EV G N+R +++ +E   Q+
Sbjct: 179 RWLPQLSAENAQGEYYLTDVIAMAAAEGVKVATAQPSRPVEVEGVNDRRQMARLERTLQA 238

Query: 244 RYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIR-- 295
                +M  GV +  P       ++   HD  I    V E  V  G GV +  +  IR  
Sbjct: 239 DIAESLMTQGVALRDPSRLDVRGSLTCGHDVEIDVGCVFEGDVELGEGVRVGPHCVIRDS 298

Query: 296 ---------AFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
                      S +EG  +     IGPFAR+R  T +    ++GNF E K A + EGSKI
Sbjct: 299 HIGAETVIEPHSIIEGAVVAGHNQIGPFARLRPGTRLAVGAKVGNFVETKNAEVGEGSKI 358

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
           NHLSYVGD+ +G++VN+GAGTITCNYDG +K++T I + AFIGSN++L+AP+++G+G  V
Sbjct: 359 NHLSYVGDARLGRDVNVGAGTITCNYDGANKHRTEIGDEAFIGSNTALVAPVSVGKGATV 418

Query: 407 ASGSIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
            +GS I +D  +N+L   RS+ I K D    +++K
Sbjct: 419 GAGSTIDRDVADNALAVERSKTISKADWQRPVKRK 453


>gi|254521435|ref|ZP_05133490.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Stenotrophomonas sp. SKA14]
 gi|219719026|gb|EED37551.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Stenotrophomonas sp. SKA14]
          Length = 455

 Score =  317 bits (811), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 176/440 (40%), Positives = 255/440 (57%), Gaps = 24/440 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG G RMKS   KVLQ IAG+PM++HV+          + +V G+G E + R +F 
Sbjct: 8   IILAAGAGKRMKSVLPKVLQPIAGEPMLAHVIAAARELQPAAIHVVYGHGGEAV-RQHFA 66

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               +++  Q  Q GT HAV  A   + P    V+++YGDVPL+ + TL+   D +AQ  
Sbjct: 67  DQPDLQWAEQAQQLGTGHAVAQAMPQV-PDAAQVLVLYGDVPLIRAQTLR---DLLAQPG 122

Query: 128 SIAVVGFNADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
            +AV+    D+P GYGR+L     ++ +I E+ DATD++ ++   N+G++A +   +  W
Sbjct: 123 RLAVLVAEVDDPTGYGRVLRDAEGKVGSIVEQKDATDDQLRVRTINTGIIAAESTALRRW 182

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLD-GKSIASIDVKEQEVCGCNNRYELSLIENIWQSRY 245
           L Q+  +    EYYLTD+   A  +   +  ++    QE  G N+ ++LS +E  WQ R 
Sbjct: 183 LSQLSNSNAQGEYYLTDVFAFAAHEYTPAEMALVADAQEAEGANDPWQLSQLERAWQRRA 242

Query: 246 RRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGVSIENY-------- 291
            R +   G  +  P       TV +  D +I  D V+E ++  G GV++  +        
Sbjct: 243 VRALCAQGARVRDPARLDIRGTVTVGSDVLIDVDVVLEGNIVLGDGVTVGPFNRLKDVNL 302

Query: 292 ---VQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
               ++RA   LEGV       IGPFAR+R  T +   V +GNF E KK T+  GSK NH
Sbjct: 303 GPGTEVRAHCDLEGVVTEGAAQIGPFARLRPGTVLADGVHVGNFVETKKVTLGVGSKANH 362

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           L+Y+GD+V+G  VNIGAGTITCNYDG +K  T I +NAFIGSNSSL+AP+TIG G  +A+
Sbjct: 363 LTYLGDAVIGSKVNIGAGTITCNYDGVNKSTTTIGDNAFIGSNSSLVAPVTIGDGATIAA 422

Query: 409 GSIITQDTPENSLVFARSRQ 428
           GS+IT+  P+  L  AR+RQ
Sbjct: 423 GSVITRSAPDGKLTLARARQ 442


>gi|319897823|ref|YP_004136020.1| bifunctional n-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Haemophilus influenzae F3031]
 gi|317433329|emb|CBY81706.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Haemophilus influenzae F3031]
          Length = 456

 Score =  316 bits (810), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 173/447 (38%), Positives = 262/447 (58%), Gaps = 23/447 (5%)

Query: 1   MKRKRL-AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAE 59
           M +K L A++LAAG+G RM S   KVL  IAGKPM+ HV++T    G EN+ L+ G+G +
Sbjct: 1   MTKKALSAVILAAGKGTRMYSDLPKVLHTIAGKPMVKHVIDTAHQLGSENIHLIYGHGGD 60

Query: 60  EITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKA 119
            +   ++     V + +Q  Q GTAHAV  A    K   ++++++YGD PL++  TL+K 
Sbjct: 61  LMC--SYLANEQVNWVLQTEQLGTAHAVQQAVPFFKDN-ENIVVLYGDAPLITKETLEKL 117

Query: 120 MDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAID 179
           ++   +   IA++  N DNP GYGR++ +N  ++AI E+ D+  E+  I   N+G+M  D
Sbjct: 118 IEAKPEN-GIALLTVNLDNPTGYGRIIRENGNVVAIVEQKDSNAEQLNIKEVNTGVMVSD 176

Query: 180 GLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIE 238
           G     WL ++  N    EYYLTD+I  A  D   + ++   +  EV G NNR +L  +E
Sbjct: 177 GASFKKWLARVGNNNAQGEYYLTDLIALANQDNCQVVAVQATDVMEVEGANNRLQLVALE 236

Query: 239 NIWQSRYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFG--------C 284
             +Q++   ++++ GV +  P    L        D  I  + +IE +V  G        C
Sbjct: 237 RYFQNKQASKLLLEGVMIYDPARFDLRGALEHGKDVEIDVNVIIEGNVKLGDRVKIGAGC 296

Query: 285 ---GVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIK 341
               V I N V+I+ +S LE   +G+K  IGPF+R+R    +     +GNF E+KK+T+ 
Sbjct: 297 VLKNVVIGNDVEIKPYSVLEDSVVGEKAAIGPFSRLRPGAELAAETHVGNFVEIKKSTVG 356

Query: 342 EGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIG 401
           +GSK+NHL+YVGDS +G N NIGAG ITCNYDG +K+KT I +N F+GS++ L+AP+ + 
Sbjct: 357 KGSKVNHLTYVGDSEIGSNCNIGAGVITCNYDGANKFKTIIGDNVFVGSDTQLVAPVKVA 416

Query: 402 QGTYVASGSIITQDTPENSLVFARSRQ 428
            G  + +G+ IT+D  EN LV  R  Q
Sbjct: 417 NGATIGAGTTITRDVGENELVITRVAQ 443


>gi|310819418|ref|YP_003951776.1| UDP-n-acetylglucosamine pyrophosphorylase [Stigmatella aurantiaca
           DW4/3-1]
 gi|309392490|gb|ADO69949.1| UDP-N-acetylglucosamine pyrophosphorylase [Stigmatella aurantiaca
           DW4/3-1]
          Length = 462

 Score =  316 bits (810), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 168/458 (36%), Positives = 264/458 (57%), Gaps = 26/458 (5%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT---R 63
           A+VL AG+G RMKS  +KVL  I GKP+ ++ ++     G   +  V+G+ A E+    R
Sbjct: 7   AVVLCAGKGTRMKSEKAKVLHAILGKPLCAYPLKRALDVGASPLVPVVGHQAPEVEKAIR 66

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKK--AMD 121
             FP   ++ + +Q  Q+GTA AV +A+ A+K     V+I+YGDVPL+   TL+   A  
Sbjct: 67  AQFPEA-ALRFALQKEQRGTADAVRSAEGALKDFSGRVLILYGDVPLLRRETLEALVAAH 125

Query: 122 KIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
           +  +G  +++V    ++P GYGR+L +  ++  I E  D T  +R +  CN+G+  ++  
Sbjct: 126 EAGKG-PLSLVATTLEDPTGYGRVLREGGKVTRIVEHKDCTPAQRAVRECNAGIYLVESS 184

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIW 241
           ++   L +I+      EYYLTD++E A   G  +ASID    E  G N+R EL+    + 
Sbjct: 185 FLWRALAEIRPQNAQGEYYLTDLVEMAARQG-PVASIDADATETAGVNDRVELAARARVM 243

Query: 242 QSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV--------- 292
           Q R   + M +GVT+  P T F+  D  +  DT + P V    G  +   V         
Sbjct: 244 QQRINERHMRAGVTLQDPATTFIDEDVTVGADTELGPLVTLAAGTVVGRNVTIGQGSVLT 303

Query: 293 --------QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGS 344
                    I+ +S  E   +G++ IIGPF+R+R  T + + V +GNF E KKA I +GS
Sbjct: 304 ASFVADGTAIKPYSVFEEAKVGERCIIGPFSRLRPGTELAEEVHLGNFVETKKAVIGKGS 363

Query: 345 KINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGT 404
           K NHL+Y+GD+ +G  VN+GAGTITCNYDG +K+ T + +  FIGS++ L+AP+++G G 
Sbjct: 364 KANHLAYLGDAKIGSKVNVGAGTITCNYDGVNKHLTELGDGVFIGSDTQLVAPVSVGDGA 423

Query: 405 YVASGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           YV +G+ +T++ P  SL  +RS Q+ KE G ++ +K++
Sbjct: 424 YVGAGTTVTKNVPPGSLAVSRSPQVNKE-GWVARKKER 460


>gi|319399656|gb|EFV87910.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Staphylococcus epidermidis FRI909]
          Length = 451

 Score =  316 bits (810), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 178/449 (39%), Positives = 265/449 (59%), Gaps = 24/449 (5%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR 63
           +R AI+LAAG+G RMKS   KVL ++AGKPM+ HV+  +  AG++ +  ++G+GAE +  
Sbjct: 2   QRHAIILAAGKGTRMKSKKYKVLHEVAGKPMVEHVLNNVKQAGVDQIVTIIGHGAESVKD 61

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKI 123
                +L   Y  QD Q GTAHAV  A + +       +++ GD PL++  TL+  ++  
Sbjct: 62  TLGNQSL---YSFQDKQLGTAHAVKMAHEHLADKEGTTLVVCGDTPLITYQTLQSLIEHH 118

Query: 124 AQGYS-IAVVGFNADNPKGYGRLLIKNNEIIA-IREENDATDEERKIHYCNSGLMAIDGL 181
               S + V+  +  NP GYGR++  +N I+  I EE DA + ER I   +SG+ A +  
Sbjct: 119 ESTQSQVTVLSASTINPYGYGRIIRNHNGILERIVEEKDANESERAIKEISSGIFAFNNR 178

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ--EVCGCNNRYELSLIEN 239
            + + L Q+K +    EYYL D++     DG   A +   E   E+ G N+R  LS  E 
Sbjct: 179 VLFEKLEQVKNDNAQGEYYLPDVLSLILKDGGK-AEVYCTEDFDEIIGVNDRLMLSEAEK 237

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSY 299
             Q R  R  M +GVT+I P + F+  D  I  DT IEP V  G   +IE  V I  +S 
Sbjct: 238 ALQQRINRYHMENGVTIIDPSSTFIGTDVKIGIDTTIEPGVRIGGHTTIEEDVWIGQYSE 297

Query: 300 LEG--VH--------------IGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG 343
           +    +H              +G+ T +GPFA++R  + +   V++GNF EVKKA IK+G
Sbjct: 298 INNSTIHSNANIKQSVINDSIVGENTTVGPFAQLRPGSNLGSEVKVGNFVEVKKADIKDG 357

Query: 344 SKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQG 403
           +K++HLSY+GD+ +G+  NIG G+IT NYDG +K+KT + ++AFIG N++LIAP+T+G  
Sbjct: 358 AKVSHLSYIGDAEIGERTNIGCGSITVNYDGANKFKTIVGKDAFIGCNTNLIAPVTVGNH 417

Query: 404 TYVASGSIITQDTPENSLVFARSRQIVKE 432
           T +A+GS IT + PE+SL  AR+RQ+ KE
Sbjct: 418 TLIAAGSTITDNIPEDSLALARARQVNKE 446


>gi|301154958|emb|CBW14421.1| fused N-acetyl glucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate acetyl
           transferase [Haemophilus parainfluenzae T3T1]
          Length = 456

 Score =  316 bits (810), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 178/451 (39%), Positives = 270/451 (59%), Gaps = 31/451 (6%)

Query: 1   MKRKRLAIV-LAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAE 59
           M  K L++V LAAG+G RM S   KVL K+AGKPM+ HV++T    G ENV L+ G+G E
Sbjct: 1   MTNKALSVVILAAGKGTRMYSDLPKVLHKVAGKPMVKHVIDTANQLGAENVHLIYGHGGE 60

Query: 60  EITR--INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD--VIIMYGDVPLVSSHT 115
            +    +N     SV +  Q  Q GT HA+   Q A+    DD  V+++YGD P+++  T
Sbjct: 61  LMRERLVNE----SVNWVFQAEQLGTGHAM---QQAMPFFRDDENVLMVYGDGPMITPET 113

Query: 116 LKKAMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGL 175
           L+K +D   +   IAV+    DNP GYGR++ +N +++ I E+ DAT E+ KI   N+G+
Sbjct: 114 LQKLIDAKPEN-GIAVLTVVLDNPTGYGRIVRENGKVVGIVEQKDATPEQLKIQEINTGV 172

Query: 176 MAIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYEL 234
           +  DG     WL ++  N    E+Y+TD+I  A  DG  I ++   +  EV G NNR +L
Sbjct: 173 LVSDGASFKKWLARLDNNNAQGEFYITDVIGLAHQDGCPIVAVQATDFMEVEGVNNRLQL 232

Query: 235 SLIENIWQSRYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG----- 283
           + +E  +Q +   +++++GV +I PE      T+    D  I  + ++E +V  G     
Sbjct: 233 AKMERYYQRKQAEKLLLAGVMLIDPERFDLRGTLEHGKDVEIDVNVIVEGNVRLGNRVKI 292

Query: 284 ---C---GVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKK 337
              C    V+I + V+I+ +S LE   IG+K  IGPF+R+R    +     +GNF E+KK
Sbjct: 293 GAGCVLKNVTIGDDVEIKPYSVLEDATIGEKAAIGPFSRLRPGAELAAETHVGNFVEIKK 352

Query: 338 ATIKEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAP 397
           +T+ +GSK+NHL+YVGD+ +G+N NIGAG ITCNYDG +K+KT I  + FIGS++ L+AP
Sbjct: 353 STVGKGSKVNHLTYVGDTEIGENCNIGAGVITCNYDGANKFKTIIGNDVFIGSDTQLVAP 412

Query: 398 ITIGQGTYVASGSIITQDTPENSLVFARSRQ 428
           +T+  G  + +GS IT++  ++ LV  R  Q
Sbjct: 413 VTVADGATIGAGSTITKNVEKDELVITRVPQ 443


>gi|126667610|ref|ZP_01738579.1| UDP-N-acetylglucosamine pyrophosphorylase [Marinobacter sp. ELB17]
 gi|126627879|gb|EAZ98507.1| UDP-N-acetylglucosamine pyrophosphorylase [Marinobacter sp. ELB17]
          Length = 454

 Score =  316 bits (809), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 175/440 (39%), Positives = 260/440 (59%), Gaps = 23/440 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RMKSS  KVL K+AG+ M+ HV+ T    G   +  V+G+GA+++   +  
Sbjct: 7   VILAAGQGSRMKSSLPKVLHKVAGRSMLHHVIATAKTLGAAGIHGVIGHGADQVKAASAG 66

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             +S  + +Q+ Q GT HAV  A   + P    V+++YGDVPL+++ TL+  +  +    
Sbjct: 67  HKVS--WVMQEQQLGTGHAVAQALPDL-PDDARVLVLYGDVPLITADTLQGLIQNL-DDK 122

Query: 128 SIAVVGFNADNPKGYGRLLIKN-NEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
           ++ ++    DNP+GYGR+L  +  ++ AI E+ DA  E+  I   N+G++A+   ++  W
Sbjct: 123 TLGLLTVTLDNPQGYGRILRNSAGQVTAIVEQKDANVEQLAICEVNTGILAVSARHLKTW 182

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRY 245
           L Q+  +    EYYLTDII  A   G ++         EV G NNR +L+ +E  +QSR 
Sbjct: 183 LPQLSSSNAQGEYYLTDIIAMAVEAGMTVNVAQPSNAFEVQGVNNRVQLAELERWYQSRE 242

Query: 246 RRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFF--------------GCGVS---I 288
             ++MI G T+  P  V +  +  I  D +I+ +V F              GC ++   I
Sbjct: 243 AERLMIEGATLADPARVDVRGELSIGNDVLIDVNVVFIGKVTLGSHVSIGPGCVITDATI 302

Query: 289 ENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
            +  QI A S +E   +G    +GPFAR+R  T +  N ++GNF E KKA + EGSKINH
Sbjct: 303 ADGAQIHAHSVIEQASVGANAQVGPFARLRPGTQLAANTKVGNFVETKKAILGEGSKINH 362

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           LSY+GD+ +G  VN+GAGTITCNYDG +K +T + +  FIGSNS+L+AP+TIG G  VA+
Sbjct: 363 LSYIGDATLGAGVNVGAGTITCNYDGVNKSQTVLGDGVFIGSNSALVAPVTIGAGATVAA 422

Query: 409 GSIITQDTPENSLVFARSRQ 428
           GS IT+D  E  L  AR RQ
Sbjct: 423 GSTITKDVAEQELAVARGRQ 442


>gi|16762464|ref|NP_458081.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29143952|ref|NP_807294.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213052672|ref|ZP_03345550.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213427473|ref|ZP_03360223.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213646875|ref|ZP_03376928.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213852798|ref|ZP_03382330.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|81512733|sp|Q8Z2Q3|GLMU_SALTI RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|25317119|pir||AI0954 UDP-N-acetylglucosamine pyrophosphorylase [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16504769|emb|CAD03133.1| UDP-N-acetylglucosamine pyrophosphorylase [Salmonella enterica
           subsp. enterica serovar Typhi]
 gi|29139588|gb|AAO71154.1| UDP-N-acetylglucosamine pyrophosphorylase [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
          Length = 456

 Score =  316 bits (809), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 171/452 (37%), Positives = 267/452 (59%), Gaps = 22/452 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++     G   V LV G+G E + +    
Sbjct: 9   VILAAGKGTRMYSDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTLKD 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HA+  A        +D++++YGDVPL+S  TL++  D   QG 
Sbjct: 69  DKLN--WVLQAEQLGTGHAMQQAAPFFSDD-EDILMLYGDVPLISVETLQRLRDAKPQG- 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    D+P GYGR+  +N ++  I E  DATDE+R+I   N+G++  +G  +  WL
Sbjct: 125 GIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIANGADLKRWL 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQSRYR 246
            ++  N    EYY+TDII  A  +G+ IA++   +  E  G NNR +LS +E I+Q+   
Sbjct: 185 SKLTNNNAQGEYYITDIIALAYQEGREIAAVHPARISETDGVNNRLQLSRLERIYQAEQA 244

Query: 247 RQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG------CGVSIENYV-- 292
            ++++SGV +  P       T++   D  I  + +IE +V  G       G  I+N V  
Sbjct: 245 EKLLLSGVMLRDPARFDLRGTLYCGMDVEIDANVIIEGYVTLGHRVKIGAGCIIKNSVIG 304

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +I  +S +E  H+     IGPFAR+R    +     +GNF E+KKA + +GSK  HL
Sbjct: 305 DDCEISPYSVVEDAHLEAACTIGPFARLRPGAELLAGAHVGNFVEMKKARLGKGSKAGHL 364

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+G+G  +A+G
Sbjct: 365 TYLGDAEIGDNVNIGAGTITCNYDGANKFKTVIGDDVFVGSDTQLVAPVTVGKGATIAAG 424

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + +T++  +N LV +R  Q+ K+     ++KK
Sbjct: 425 TTVTRNVADNELVLSRVPQVHKQGWQRPVKKK 456


>gi|75450518|sp|Q937Z1|GLMU_STAEP RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|16024900|gb|AAL11408.1| GcaD [Staphylococcus epidermidis]
          Length = 451

 Score =  316 bits (809), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 178/449 (39%), Positives = 264/449 (58%), Gaps = 24/449 (5%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR 63
           +R AI+LAAG+G RMKS   KVL ++AGKPM+ HV+  +  AG++ +  ++G+GAE +  
Sbjct: 2   QRHAIILAAGKGTRMKSKKYKVLHEVAGKPMVEHVLNNVKQAGVDQIVTIIGHGAESVKD 61

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKI 123
                +L   Y  QD Q GTAHAV  A + +       +++ GD PL++  TL+  ++  
Sbjct: 62  TLGNQSL---YSFQDKQLGTAHAVKMAHEHLADKEGTTLVVCGDTPLITYQTLQSLIEHH 118

Query: 124 AQGYS-IAVVGFNADNPKGYGRLLIKNNEIIA-IREENDATDEERKIHYCNSGLMAIDGL 181
               S + V+  +  NP GYGR++  +N I+  I EE DA D ER I   +SG+ A +  
Sbjct: 119 ESTQSHVTVLSASTINPYGYGRIIRNHNGILERIVEEKDANDSERAIKEISSGIFAFNNR 178

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ--EVCGCNNRYELSLIEN 239
            + + L Q+K +    EYYL D++     DG   A +   E   E+ G N+R  LS  E 
Sbjct: 179 VLFEKLEQVKNDNAQGEYYLPDVLSLILKDGGK-AEVYCTEDFDEIIGVNDRLMLSEAEK 237

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSY 299
             Q R  R  M +GVT+I P + F+  D  I  DT IEP V  G   +IE  V I  +S 
Sbjct: 238 ALQQRINRYHMENGVTIIDPSSTFIGTDVKIGIDTTIEPGVRIGGHTTIEEDVWIGQYSE 297

Query: 300 LEG--VH--------------IGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG 343
           +    +H              +G+   +GPFA++R  + +   V++GNF EVKKA IK+G
Sbjct: 298 INNSTIHSNANIKQSVINDSIVGENXXVGPFAQLRPGSNLGSEVKVGNFVEVKKADIKDG 357

Query: 344 SKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQG 403
           +K++HLSY+GD+ +G+  NIG G+IT NYDG +K+KT + ++AFIG N++LIAP+T+G  
Sbjct: 358 AKVSHLSYIGDAEIGERTNIGCGSITVNYDGANKFKTIVGKDAFIGCNTNLIAPVTVGNH 417

Query: 404 TYVASGSIITQDTPENSLVFARSRQIVKE 432
           T +A+GS IT + PE+SL  AR+RQ+ KE
Sbjct: 418 TLIAAGSTITDNIPEDSLALARARQVNKE 446


>gi|283836153|ref|ZP_06355894.1| hypothetical protein CIT292_10578 [Citrobacter youngae ATCC 29220]
 gi|291068346|gb|EFE06455.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Citrobacter youngae ATCC 29220]
          Length = 456

 Score =  316 bits (809), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 168/452 (37%), Positives = 269/452 (59%), Gaps = 22/452 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++     G  +V LV G+G + + +    
Sbjct: 9   VILAAGKGTRMYSDLPKVLHTLAGKPMVQHVIDAANELGATHVHLVYGHGGDLLKQTLKD 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HA+  A        +D++++YGDVPL+S+ TL++  +   QG 
Sbjct: 69  GNLN--WVLQAEQLGTGHAMQQAAPFFSDD-EDILMLYGDVPLISTDTLRRLREAKPQG- 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    D+P GYGR+  +N  +  I E  DATDE+R+I   N+G++  +G  +  WL
Sbjct: 125 GIGLLTVKLDDPSGYGRITRENGNVTGIVEHKDATDEQRQIQEINTGILIANGADLKRWL 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQSRYR 246
            ++  N V  EYY+TDII  A  +G+ IA++   +  E  G NNR +LS +E ++QS   
Sbjct: 185 SKLTNNNVQGEYYITDIIAMAYQEGREIAAVHPARISETEGVNNRLQLSRLERVYQSEQA 244

Query: 247 RQMMISGV------------TMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV-- 292
            +++++GV            T+I    V +  + II+ +  +   V  G G  I+N V  
Sbjct: 245 EKLLLAGVMLRDPARFDLRGTLIHGRDVEIDTNVIIEGNVTVGDRVKIGAGCIIKNSVIG 304

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              ++  +S +E  H+     IGPFAR+R    +++   +GNF E+KKA + +GSK  HL
Sbjct: 305 DGCELSPYSVVEDAHLEAACTIGPFARLRPGAELQEGAHVGNFVEMKKARLGKGSKAGHL 364

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+G G  +A+G
Sbjct: 365 TYLGDAEIGDNVNIGAGTITCNYDGANKFKTIIGDDVFVGSDTQLVAPVTVGNGATIAAG 424

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + +T+D  +N LV +R  Q+ K+     ++KK
Sbjct: 425 TTVTRDVADNELVLSRVPQVHKQGWQRPVKKK 456


>gi|289826256|ref|ZP_06545368.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
          Length = 451

 Score =  315 bits (808), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 171/452 (37%), Positives = 267/452 (59%), Gaps = 22/452 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++     G   V LV G+G E + +    
Sbjct: 4   VILAAGKGTRMYSDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTLKD 63

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HA+  A        +D++++YGDVPL+S  TL++  D   QG 
Sbjct: 64  DKLN--WVLQAEQLGTGHAMQQAAPFFSDD-EDILMLYGDVPLISVETLQRLRDAKPQG- 119

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    D+P GYGR+  +N ++  I E  DATDE+R+I   N+G++  +G  +  WL
Sbjct: 120 GIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIANGADLKRWL 179

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQSRYR 246
            ++  N    EYY+TDII  A  +G+ IA++   +  E  G NNR +LS +E I+Q+   
Sbjct: 180 SKLTNNNAQGEYYITDIIALAYQEGREIAAVHPARISETDGVNNRLQLSRLERIYQAEQA 239

Query: 247 RQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG------CGVSIENYV-- 292
            ++++SGV +  P       T++   D  I  + +IE +V  G       G  I+N V  
Sbjct: 240 EKLLLSGVMLRDPARFDLRGTLYCGMDVEIDANVIIEGYVTLGHRVKIGAGCIIKNSVIG 299

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +I  +S +E  H+     IGPFAR+R    +     +GNF E+KKA + +GSK  HL
Sbjct: 300 DDCEISPYSVVEDAHLEAACTIGPFARLRPGAELLAGAHVGNFVEMKKARLGKGSKAGHL 359

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+G+G  +A+G
Sbjct: 360 TYLGDAEIGDNVNIGAGTITCNYDGANKFKTVIGDDVFVGSDTQLVAPVTVGKGATIAAG 419

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + +T++  +N LV +R  Q+ K+     ++KK
Sbjct: 420 TTVTRNVADNELVLSRVPQVHKQGWQRPVKKK 451


>gi|117619655|ref|YP_858677.1| UDP-N-acetylglucosamine pyrophosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|166226076|sp|A0KQX6|GLMU_AERHH RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|117561062|gb|ABK38010.1| UDP-N-acetylglucosamine pyrophosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 453

 Score =  315 bits (808), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 176/458 (38%), Positives = 268/458 (58%), Gaps = 34/458 (7%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT-RINF 66
           ++LAAG+G RM+SS  KVL  +A KPM+SHV+ET    G E + LV G+GAE +  RI  
Sbjct: 6   VILAAGKGTRMRSSLPKVLHPVANKPMVSHVIETARKVGAEQLHLVYGHGAELLKERIQA 65

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTA----QDAIKPGYDDVIIMYGDVPLVSSHTLKKAMD- 121
                + + +Q  Q GT HAV  A    QD      DDV+++YGD PL+   TL++ +  
Sbjct: 66  S---DLNWVLQAQQLGTGHAVAQAIPFWQDE-----DDVLVLYGDTPLIQPETLQRLLAA 117

Query: 122 KIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
           K + G ++  V    DNP GYGR++  N +++ I E+ DA  E+  I   N+G++  +G 
Sbjct: 118 KASDGMALLTVVL--DNPTGYGRIVRSNGQVVGIVEQKDANAEQLAIREVNTGVLVANGG 175

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENI 240
            +  WL ++       E+YLTD+I  A  D   IA++   +  EV G NNR +L+ +E  
Sbjct: 176 QLRSWLSRLDNKNAQGEFYLTDVIAMAHADNCPIAAVHPDDAMEVEGANNRVQLAQLERS 235

Query: 241 WQSRYRRQMMISGVTMIAP------------ETVFLSHDTIIQPDTVIEPHVFFGCGVSI 288
           +Q     ++MI+G T+I P            E V +  + II+   V+  HV  G G  +
Sbjct: 236 YQKMQAERLMIAGATLIDPARFDLRGTLEIGEEVVIDVNVIIEGKVVLGNHVRIGAGSVL 295

Query: 289 ENYV-----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG 343
           ++ V     +++ +S +EG  I  +  +GPF R+R  T +E++  +GNF E+KKA +  G
Sbjct: 296 KDCVIGDHSEVKPYSVIEGAQIADQCSVGPFTRLRPGTVLEQDAHVGNFVEMKKARLGVG 355

Query: 344 SKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQG 403
           SK  HL+Y+GD+ VG  VNIGAGTITCNYDG +K++T I ++ F+GS++ L+AP+ IG+G
Sbjct: 356 SKCGHLTYLGDAEVGAKVNIGAGTITCNYDGVNKFQTIIEDDVFVGSDTQLVAPVRIGKG 415

Query: 404 TYVASGSIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
             + +GS IT+D  EN LV  R  Q   ++ A  ++KK
Sbjct: 416 ATLGAGSTITKDVAENELVITRVPQRHIQNWARPVKKK 453


>gi|295401985|ref|ZP_06811947.1| UDP-N-acetylglucosamine pyrophosphorylase [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294975987|gb|EFG51603.1| UDP-N-acetylglucosamine pyrophosphorylase [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 459

 Score =  315 bits (808), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 190/461 (41%), Positives = 273/461 (59%), Gaps = 30/461 (6%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI-T 62
           KR A++LAAG+G RMKS   KVL  + GKPM+ HV++ +   GIE +  V+G+GAE++ T
Sbjct: 3   KRYAVILAAGQGTRMKSKQYKVLHPVCGKPMVQHVVDQVLQLGIEKLITVVGFGAEQVKT 62

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDV-IIMYGDVPLVSSHTLKKAMD 121
           ++        EY  Q  Q GTAHAV+ A   +  G D V +++ GD PL+++ T++  +D
Sbjct: 63  QLGDQS----EYAFQQEQLGTAHAVMQAASHLH-GKDGVTLVVCGDTPLITAETMQALLD 117

Query: 122 K-IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIA-IREENDATDEERKIHYCNSGLMAID 179
             +A      V+   ADNP GYGR++  ++  +A I E  DA+++ER I   N+G    D
Sbjct: 118 HHLATKAKATVLTAIADNPAGYGRIVRDSHGNVAKIVEHKDASEQERAIKEINTGTYCFD 177

Query: 180 GLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIE 238
              + + L  +  N V  EYYLTD+IE  + +G  I++ +    +E  G N+R  L+  E
Sbjct: 178 NKSLFEALTHVSNNNVQGEYYLTDVIEILKSNGGIISAYEAPSFEETIGVNDRAALAEAE 237

Query: 239 NIWQSRYRRQMMISGVTMIAPETVFLS------HDTIIQPDTVIEPHVFFG--CGVS--- 287
            I ++R  R+ M++GVT+I P   ++S       DT+I P TVIE     G  C +    
Sbjct: 238 KIMRARICRKHMLNGVTIIDPAHTYISAEAQIGRDTVIYPGTVIEGKTVIGEDCIIGPNS 297

Query: 288 ------IENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIK 341
                 I N   IR  S      IG    IGPFA IR  + I   VRIGNF EVKK+   
Sbjct: 298 EIKDCLIGNGTTIR-HSVAHDSEIGNDVTIGPFAHIRPLSKIADEVRIGNFVEVKKSVFG 356

Query: 342 EGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIG 401
           +GSK +HLSY+GD+ +G +VN+G G+IT NYDG +K+ T I + AFIG N +LIAP+T+G
Sbjct: 357 KGSKASHLSYIGDAEIGADVNLGCGSITVNYDGKNKHMTKIEDGAFIGCNVNLIAPVTVG 416

Query: 402 QGTYVASGSIITQDTPENSLVFARSRQIVKED--GALSMRK 440
           +G YVA+GS IT D P N+L  AR+RQ+ KE+    LS++K
Sbjct: 417 KGAYVAAGSTITDDVPANALSIARARQVNKENYVDRLSIKK 457


>gi|315635174|ref|ZP_07890452.1| UDP-N-acetylglucosamine diphosphorylase [Aggregatibacter segnis
           ATCC 33393]
 gi|315476136|gb|EFU66890.1| UDP-N-acetylglucosamine diphosphorylase [Aggregatibacter segnis
           ATCC 33393]
          Length = 455

 Score =  315 bits (808), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 170/443 (38%), Positives = 264/443 (59%), Gaps = 30/443 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT-RINF 66
           ++LAAG+G RM S   KVL  IAGKPM+ HV++T    G  N+ LV G+G + +  R+  
Sbjct: 9   VILAAGKGTRMYSDLPKVLHPIAGKPMVKHVIDTAKQLGARNIHLVYGHGGDLMQQRLAA 68

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAMDKI 123
            P   V + +Q  Q GT HA+  A     P + D   ++++YGD P+++  TL+K +D  
Sbjct: 69  EP---VNWVLQTEQLGTGHAMQQA----APFFADDENILMVYGDGPMITPETLQKLIDAK 121

Query: 124 AQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
            +   +AV+    DNP GYGR+L +N +++ I E+ DA+ E+R+I   N+G++  DG   
Sbjct: 122 PEN-GVAVLTVVLDNPTGYGRILRENGKVVGIVEQKDASPEQREIREINTGVLVADGASF 180

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQ 242
             WL Q+  N    EYY+TD+I  A  DG+++ ++  ++  EV G NNR +L+ +E  +Q
Sbjct: 181 KKWLAQLDNNNAQGEYYITDVIGLANRDGRAVVAVQAEDFMEVEGINNRQQLARMERYFQ 240

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFF--------------GCGVS- 287
            +   ++M++GV ++ PE   L  +     D  I+ +V                GC ++ 
Sbjct: 241 RKQADKLMLAGVMLLDPERFDLRGNLTHGKDVEIDVNVILNGEVRLGNRVKIGAGCVLTN 300

Query: 288 --IENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
             I + V+I+ +S LE   +G    IGPF+R+R    + +N  +GNF E+KKA I +GSK
Sbjct: 301 CDIGDDVEIKPYSVLEDAIVGANAAIGPFSRLRPGAELAENTHVGNFVEIKKAQIGKGSK 360

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
           +NHL+YVGD+ +G+N NIGAG ITCNYDG +K+KT I +N F+GS+S LIAP+TI  G  
Sbjct: 361 VNHLTYVGDAEIGQNCNIGAGVITCNYDGANKFKTTIGDNVFVGSDSQLIAPVTIESGAT 420

Query: 406 VASGSIITQDTPENSLVFARSRQ 428
           + +GS I ++  ++ LV  R  Q
Sbjct: 421 IGAGSTIRRNVKQDELVTTRVPQ 443


>gi|188993185|ref|YP_001905195.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine diphosphorylase [Xanthomonas
           campestris pv. campestris str. B100]
 gi|254798822|sp|B0RWB8|GLMU_XANCB RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|167734945|emb|CAP53157.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine diphosphorylase [Xanthomonas
           campestris pv. campestris]
          Length = 454

 Score =  315 bits (807), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 177/445 (39%), Positives = 257/445 (57%), Gaps = 26/445 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG G RM+S+  KVLQ +AG+PM++HV+ T        + +V G+G  ++ +  F 
Sbjct: 8   VILAAGEGKRMRSALPKVLQPLAGQPMLAHVIATARELQPAAIHVVHGHGGAQV-QAAFA 66

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               +++  Q  Q GT HAV  A  A+ P    V+++YGDVPL+ S +L++ +    +  
Sbjct: 67  DQPDLQWAEQRQQLGTGHAVQQALHAV-PDAATVLVLYGDVPLIRSESLRELLHAPGR-- 123

Query: 128 SIAVVGFNADNPKGYGRLLIKNNE--IIAIREENDATDEERKIHYCNSGLMAIDGLYIMD 185
            IAV+  +  NP GYGR+ ++N E  + AI E+ DA DE+R+I   N+G++  +   +  
Sbjct: 124 -IAVLVADLANPTGYGRI-VRNPEGKVAAIVEQKDADDEQRRIRTINTGILTAESTALRR 181

Query: 186 WLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSR 244
           WL  +  +    E+YLTD+  +A  D      + V + Q+V G N+ ++L+ +E  WQ R
Sbjct: 182 WLGGLSNDNAQGEFYLTDVFARAAADYTPADMVQVSDPQDVEGANDPWQLAQLERAWQLR 241

Query: 245 YRRQMMISGVTMIAPETV------FLSHDTIIQPDTVIEPHVFFGCGVSIENYV------ 292
             R + + GV M  P  V       + HD  +  D ++E  V  G GV I  +V      
Sbjct: 242 AARALCLQGVRMADPARVEQRGRVQVGHDVQLDIDVILEGEVTLGDGVVIGPFVRLRDVQ 301

Query: 293 -----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKIN 347
                Q+RA   LEGV       IGPFAR+R  T +   V IGNF E KK  +  GSK N
Sbjct: 302 LAAGTQVRAHCDLEGVVTEGAVQIGPFARLRPGTVLADGVHIGNFVETKKVVMGAGSKAN 361

Query: 348 HLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVA 407
           HL+Y+GD+VVG  VNIGAGTITCNYDG +K +T I + AF+GSNS+L+API IG G  + 
Sbjct: 362 HLTYLGDAVVGSKVNIGAGTITCNYDGVNKSQTTIGDGAFVGSNSALVAPIEIGTGATIG 421

Query: 408 SGSIITQDTPENSLVFARSRQIVKE 432
           +GS+IT+D P + L  AR RQ V E
Sbjct: 422 AGSVITRDAPPHQLSVARPRQTVIE 446


>gi|56415730|ref|YP_152805.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197364658|ref|YP_002144295.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|81361376|sp|Q5PKV8|GLMU_SALPA RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|254798797|sp|B5BIN3|GLMU_SALPK RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|56129987|gb|AAV79493.1| UDP-N-acetylglucosamine pyrophosphorylase [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|197096135|emb|CAR61731.1| UDP-N-acetylglucosamine pyrophosphorylase [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
          Length = 456

 Score =  315 bits (807), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 171/452 (37%), Positives = 267/452 (59%), Gaps = 22/452 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++     G   V LV G+G E + +    
Sbjct: 9   VILAAGKGTRMYSDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTLKD 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HA+  A        +D++++YGDVPL+S  TL++  D   QG 
Sbjct: 69  DKLN--WVLQAEQLGTGHAMQQAAPFFSDD-EDILMLYGDVPLISVETLQRLRDAKPQG- 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    D+P GYGR+  +N ++  I E  DATDE+R+I   N+G++  +G  +  WL
Sbjct: 125 GIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIANGADLKRWL 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQSRYR 246
            ++  N    EYY+TDII  A  +G+ IA++   +  E  G NNR +LS +E I+Q+   
Sbjct: 185 SKLTNNNAQGEYYITDIIALAYQEGREIAAVHPARISETDGVNNRLQLSRLERIYQAEQA 244

Query: 247 RQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG------CGVSIENYV-- 292
            ++++SGV +  P       T+    D  I  + +IE +V  G       G  I+N V  
Sbjct: 245 EKLLLSGVMLRDPARFDLRGTLHCGMDVEIDANVIIEGYVTLGHRVKIGAGCIIKNSVIG 304

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +I  +S +E  H+     IGPFAR+R    +     +GNF E+KKA + +GSK  HL
Sbjct: 305 DDCEISPYSVVEDAHLEAACTIGPFARLRPGAELLAGAHVGNFVEMKKARLGKGSKAGHL 364

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G NVNIGAGTITCNYDG +K+KT I+++ F+GS++ L+AP+T+G+G  +A+G
Sbjct: 365 TYLGDAEIGDNVNIGAGTITCNYDGANKFKTVIDDDVFVGSDTQLVAPVTVGKGATIAAG 424

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + +T++  +N LV +R  Q+ K+     ++KK
Sbjct: 425 TTVTRNVADNELVLSRVPQVHKQGWQRPVKKK 456


>gi|329122557|ref|ZP_08251139.1| UDP-N-acetylglucosamine diphosphorylase [Haemophilus aegyptius ATCC
           11116]
 gi|327473140|gb|EGF18565.1| UDP-N-acetylglucosamine diphosphorylase [Haemophilus aegyptius ATCC
           11116]
          Length = 456

 Score =  315 bits (807), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 173/447 (38%), Positives = 263/447 (58%), Gaps = 23/447 (5%)

Query: 1   MKRKRL-AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAE 59
           M +K L A++LAAG+G RM S   KVL  IAGKPM+ HV++T    G EN+ L+ G+G +
Sbjct: 1   MTKKALSAVILAAGKGTRMYSDLPKVLHTIAGKPMVKHVIDTAHQLGSENIHLIYGHGGD 60

Query: 60  EITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKA 119
            + R +      V + +Q  Q GTAHAV  A    K   ++++++YGD PL++  TL+K 
Sbjct: 61  -LMRTHLANE-QVNWVLQTEQLGTAHAVQQAAPFFKDN-ENIVVLYGDAPLITKETLEKL 117

Query: 120 MDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAID 179
           +++  +   IA++  N DNP GYGR++ +N  ++AI E+ DA  ++  I   N+G+M  D
Sbjct: 118 IEEKPEN-GIALLTVNLDNPTGYGRIIRENGNVVAIVEQKDANADQLNIKEVNTGVMVSD 176

Query: 180 GLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIE 238
           G     WL ++  N    EYYLTD+I  A  D   + ++   +  EV G NNR +L+ +E
Sbjct: 177 GASFKKWLARVGNNNAQGEYYLTDLIALANQDNCQVVAVQATDVMEVEGANNRLQLAALE 236

Query: 239 NIWQSRYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG--------C 284
              Q++   ++++ GV +  P       T+    D  I  + +IE +V  G        C
Sbjct: 237 RYLQNKQASKLLLEGVMIYDPARFDLRGTLEHGKDVEIDVNVIIEGNVKLGDRVKIGAGC 296

Query: 285 ---GVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIK 341
               V I N V+I+ +S LE   +G+K  IGPF+R+R    +     +GNF E+KK+T+ 
Sbjct: 297 VLKNVVIGNDVEIKPYSVLEDSIVGEKAAIGPFSRLRPGAELAAETHVGNFVEIKKSTVG 356

Query: 342 EGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIG 401
           +GSK+NHL+YVGDS +G N NIGAG ITCNYDG +K+KT I  + F+GS++ L+AP+ + 
Sbjct: 357 KGSKVNHLTYVGDSEIGSNCNIGAGVITCNYDGANKFKTIIGNDVFVGSDTQLVAPVKVA 416

Query: 402 QGTYVASGSIITQDTPENSLVFARSRQ 428
            G  + +G+ IT+D  EN LV  R  Q
Sbjct: 417 NGATIGAGTTITRDVGENELVITRVAQ 443


>gi|312109197|ref|YP_003987513.1| UDP-N-acetylglucosamine pyrophosphorylase [Geobacillus sp. Y4.1MC1]
 gi|311214298|gb|ADP72902.1| UDP-N-acetylglucosamine pyrophosphorylase [Geobacillus sp. Y4.1MC1]
          Length = 459

 Score =  315 bits (807), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 189/460 (41%), Positives = 270/460 (58%), Gaps = 28/460 (6%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR 63
           KR A++LAAG+G RMKS   KVL  + GKPM+ HV++ +   GIE +  V+G+GAE++  
Sbjct: 3   KRYAVILAAGQGTRMKSKQYKVLHPVCGKPMVQHVVDQVLQLGIEKLITVVGFGAEQV-- 60

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDV-IIMYGDVPLVSSHTLKKAMDK 122
                    EY  Q  Q GTAHAV+ A   +  G D V +++ GD PL+++ T++  +D 
Sbjct: 61  -KMQLGDQSEYAFQQEQLGTAHAVMQAASHLH-GKDGVTLVVCGDTPLITAETMQALLDH 118

Query: 123 -IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIA-IREENDATDEERKIHYCNSGLMAIDG 180
            +A      V+   ADNP GYGR++  ++  +A I E  DA+++ER I   N+G    D 
Sbjct: 119 HLATKAKATVLTAIADNPAGYGRIVRDSHGNVAKIVEHKDASEQERAIKEINTGTYCFDN 178

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIEN 239
             + + L  +  N V  EYYLTD+IE  + +G  I++ +    +E  G N+R  L+  E 
Sbjct: 179 KSLFEALTHVSNNNVQGEYYLTDVIEILKSNGGIISAYEAPSFEETIGVNDRAALAEAEK 238

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLS------HDTIIQPDTVIEPHVFFG--CGVS---- 287
           I ++R  R+ M++GVT+I P   ++S       DT+I P TVIE     G  C +     
Sbjct: 239 IMRARICRKHMLNGVTIIDPAHTYISAEAQIGRDTVIYPGTVIEGKTVIGEDCIIGPNSE 298

Query: 288 -----IENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKE 342
                I N   IR  S      IG    IGPFA IR  + I   VRIGNF EVKK+   +
Sbjct: 299 IKDCLIGNGTTIR-HSVAHDSEIGNDVTIGPFAHIRPLSKIADEVRIGNFVEVKKSVFGK 357

Query: 343 GSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQ 402
           GSK +HLSY+GD+ +G +VN+G G+IT NYDG +K+ T I + AFIG N +LIAP+T+G+
Sbjct: 358 GSKASHLSYIGDAEIGADVNLGCGSITVNYDGKNKHMTKIEDGAFIGCNVNLIAPVTVGK 417

Query: 403 GTYVASGSIITQDTPENSLVFARSRQIVKED--GALSMRK 440
           G YVA+GS IT D P N+L  AR+RQ+ KE+    LS++K
Sbjct: 418 GAYVAAGSTITDDVPANALSIARARQVNKENYVDRLSIKK 457


>gi|229845632|ref|ZP_04465757.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Haemophilus influenzae 6P18H1]
 gi|229811432|gb|EEP47136.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Haemophilus influenzae 6P18H1]
 gi|301169358|emb|CBW28958.1| fused N-acetyl glucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate acetyl
           transferase [Haemophilus influenzae 10810]
          Length = 456

 Score =  315 bits (807), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 175/449 (38%), Positives = 265/449 (59%), Gaps = 27/449 (6%)

Query: 1   MKRKRL-AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAE 59
           M +K L A++LAAG+G RM S   KVL  IAGKPM+ HV++T    G EN+ L+ G+G +
Sbjct: 1   MTKKALSAVILAAGKGTRMYSDLPKVLHTIAGKPMVKHVIDTAHQLGAENIHLIYGHGGD 60

Query: 60  EITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKA 119
            + R +      V + +Q  Q GTAHAV  A    K   ++++++YGD PL++  TL+K 
Sbjct: 61  -LMRTHLANE-QVNWVLQTEQLGTAHAVQQAAPFFKDN-ENIVVLYGDAPLITKETLEKL 117

Query: 120 MDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAID 179
           +++  +   IA++  N DNP GYGR++ +N  ++AI E+ DA  ++  I   N+G+M  D
Sbjct: 118 IEEKPEN-GIALLTVNLDNPTGYGRIIRENGNVVAIVEQKDANADQLNIKEVNTGVMVSD 176

Query: 180 GLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDG---KSIASIDVKEQEVCGCNNRYELSL 236
           G     WL ++  N    EYYLTD+I  A  D     ++ +IDV E E  G NNR +L+ 
Sbjct: 177 GASFKKWLARVGNNNAQGEYYLTDLIALANQDNCQVVAVQAIDVMEVE--GANNRLQLAA 234

Query: 237 IENIWQSRYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFG------- 283
           +E  +Q++   ++++ GV +  P    L        D  I  + +IE +V  G       
Sbjct: 235 LERYFQNKQASKLLLEGVMIYDPARFDLRGALEHGKDVEIDVNVIIEGNVKLGDRVKIGA 294

Query: 284 -C---GVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKAT 339
            C    V I N V+++ +S LE   +G+K  IGPF+R+R    +     +GNF E+KK+T
Sbjct: 295 GCVLKNVVIGNDVELKPYSVLEDSIVGEKAAIGPFSRLRPGAKLAAETHVGNFVEIKKST 354

Query: 340 IKEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPIT 399
           + +GSK+NHL+YVGDS +G N NIGAG ITCNYDG +K+KT I  + F+GS++ L+AP+ 
Sbjct: 355 VGKGSKVNHLTYVGDSEIGSNCNIGAGVITCNYDGANKFKTIIGNDVFVGSDTQLVAPVK 414

Query: 400 IGQGTYVASGSIITQDTPENSLVFARSRQ 428
           +  G  + +G+ IT+D  EN LV  R  Q
Sbjct: 415 VANGATIGAGTTITRDVGENELVITRVAQ 443


>gi|145301170|ref|YP_001144011.1| UDP-N-acetylglucosamine pyrophosphorylase [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142853942|gb|ABO92263.1| UDP-N-acetylglucosamine pyrophosphorylase [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 453

 Score =  315 bits (807), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 171/453 (37%), Positives = 265/453 (58%), Gaps = 24/453 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM+S   KVL  +A KPM+SHV++T    G E + LV G+GAE +      
Sbjct: 6   VILAAGKGTRMRSVLPKVLHPVANKPMVSHVIDTARQVGAEQLHLVYGHGAELLKERILA 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMD-KIAQG 126
           P L+  + +Q  Q GT HAV  A    K   DDV+++YGD PL+   TL++ +  K+ +G
Sbjct: 66  PDLN--WVLQAQQLGTGHAVAQAIPFWKD-EDDVLVLYGDTPLIQPETLQRLLAAKVDKG 122

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
            ++  V    DNP GYGR++ +N +++ I E+ DA  E+  I   N+G++  +G  +  W
Sbjct: 123 MALLTVVL--DNPTGYGRIVRENGQVVGIVEQKDANAEQLTIREVNTGVLVANGADLRGW 180

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSRY 245
           L ++  N    E YLTD+I  A  DG  IA++      EV G NNR +L+ +E  +Q   
Sbjct: 181 LSRLDNNNAQGELYLTDVIAMAHADGCPIAAVHPDSAMEVEGANNRVQLAALERSYQKMQ 240

Query: 246 RRQMMISGVTMIAP------------ETVFLSHDTIIQPDTVIEPHVFFGCG-----VSI 288
             ++MI+G T++ P            E V +  + II+    +  HV  G G       I
Sbjct: 241 AEKLMIAGATLLDPARFDLRGTLEIGEEVVIDVNVIIEGKVTLGNHVRIGAGSVLKDCVI 300

Query: 289 ENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
            ++ +++ +S +EG  +     +GPFAR+R    +E++  +GNF E+KK+ +  GSK  H
Sbjct: 301 GDHTEVKPYSIIEGAQVADLCSVGPFARLRPGAVLEQDAHVGNFVEMKKSRLGVGSKCGH 360

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           L+Y+GD+ VG  VNIGAGTITCNYDG +K++T I ++ F+GS++ L+AP+ IG+G  + +
Sbjct: 361 LTYLGDAEVGAKVNIGAGTITCNYDGVNKFQTIIEDDVFVGSDTQLVAPVRIGKGATLGA 420

Query: 409 GSIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           GS IT+D  EN LV  R  Q   ++ A  ++KK
Sbjct: 421 GSTITKDVAENELVITRVPQRHIKNWARPVKKK 453


>gi|194367280|ref|YP_002029890.1| UDP-N-acetylglucosamine pyrophosphorylase [Stenotrophomonas
           maltophilia R551-3]
 gi|254798805|sp|B4SJR6|GLMU_STRM5 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|194350084|gb|ACF53207.1| UDP-N-acetylglucosamine pyrophosphorylase [Stenotrophomonas
           maltophilia R551-3]
          Length = 455

 Score =  315 bits (807), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 179/442 (40%), Positives = 259/442 (58%), Gaps = 28/442 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVAL--VLGYGAEEITRIN 65
           I+LAAG G RMKS   KVLQ IAG+PM++HV+   AA  +E  A+  V G+G E + R +
Sbjct: 8   IILAAGAGKRMKSVLPKVLQPIAGQPMLAHVIA--AARELEPAAIHVVYGHGGEAV-RQH 64

Query: 66  FPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQ 125
           F     +++  Q  Q GT HAV  A   + P    V+++YGDVPL+ + TL+   D +AQ
Sbjct: 65  FAGQPDLQWAEQAQQLGTGHAVAQAMPQV-PDAAQVLVLYGDVPLIRAQTLR---DLLAQ 120

Query: 126 GYSIAVVGFNADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
              +AV+    D+P GYGR+L     ++ +I E+ DA D++ ++   N+G++A +   + 
Sbjct: 121 PGRLAVLVAEMDDPTGYGRVLRDAEGKVGSIVEQKDANDDQLRVRTINTGIIAAESTALR 180

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLD-GKSIASIDVKEQEVCGCNNRYELSLIENIWQS 243
            WL Q+  +    EYYLTD+   A  +   +  ++    QE  G N+ ++LS +E  WQ 
Sbjct: 181 RWLSQLSNSNAQGEYYLTDVFAFAAHEYTPAEMALVADAQEAEGANDPWQLSQLERAWQR 240

Query: 244 RYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGVSIENY------ 291
           R  R +   G  +  P       TV + +D +I  D V+E ++  G GV+I  +      
Sbjct: 241 RAVRALCAQGARVRDPARLDIRGTVSVGNDVLIDVDVVLEGNIVLGDGVTIGPFNRLKDV 300

Query: 292 -----VQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
                 ++RA   LEGV       +GPFAR+R  T +   V +GNF E KK T+  GSK 
Sbjct: 301 NLGPGTEVRAHCDLEGVITEGAAQVGPFARLRPGTVLADGVHVGNFVETKKVTLGVGSKA 360

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
           NHL+Y+GD+V+G  VNIGAGTITCNYDG +K  T I +NAFIGSNSSL+AP+TIG    +
Sbjct: 361 NHLTYLGDAVIGSKVNIGAGTITCNYDGVNKSTTTIGDNAFIGSNSSLVAPVTIGDSATI 420

Query: 407 ASGSIITQDTPENSLVFARSRQ 428
           A+GS+IT+D P+  L  AR+RQ
Sbjct: 421 AAGSVITRDAPDGKLTLARARQ 442


>gi|68249220|ref|YP_248332.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Haemophilus influenzae 86-028NP]
 gi|81336376|sp|Q4QMS5|GLMU_HAEI8 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|68057419|gb|AAX87672.1| bifunctional GlmU protein [Haemophilus influenzae 86-028NP]
          Length = 456

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 173/447 (38%), Positives = 263/447 (58%), Gaps = 23/447 (5%)

Query: 1   MKRKRL-AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAE 59
           M +K L A++LAAG+G RM S   KVL  IAGKPM+ HV++     G EN+ L+ G+G +
Sbjct: 1   MTKKALSAVILAAGKGTRMYSDLPKVLHTIAGKPMVKHVIDIAHQLGSENIHLIYGHGGD 60

Query: 60  EITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKA 119
            + R +      V + +Q  Q GTAHAV  A    K   ++++++YGD PL++  TL+K 
Sbjct: 61  -LMRTHLANE-QVNWVLQTEQLGTAHAVQQAAPFFKDN-ENIVVLYGDAPLITKETLEKL 117

Query: 120 MDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAID 179
           ++   +   IA++  N DNP GYGR++ +N  ++AI E+ DA  E+  I   N+G+M  D
Sbjct: 118 IEAKPEN-GIALLTVNLDNPTGYGRIIRENGNVVAIVEQKDANAEQLNIKEVNTGVMVSD 176

Query: 180 GLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIE 238
           G     WL ++  N    EYYLTD+I  A  D   + ++   +  EV G NNR +L+ +E
Sbjct: 177 GASFKKWLARVGNNNAQGEYYLTDLIALANQDNCQVVAVQATDVMEVEGANNRLQLAALE 236

Query: 239 NIWQSRYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG--------C 284
             +Q++   ++++ GV +  P       T+    D  I  + +IE +V  G        C
Sbjct: 237 RYFQNKQASKLLLEGVMIYDPARFDLRGTLEHGKDVEIDVNVIIEGNVKLGDCVKIGAGC 296

Query: 285 ---GVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIK 341
               V I N V+I+ +S LE   +G+K  IGPF+R+R    +     +GNF E+KK+T+ 
Sbjct: 297 VLKNVVIGNDVEIKPYSVLEDSIVGEKAAIGPFSRLRPGAELAAETHVGNFVEIKKSTVG 356

Query: 342 EGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIG 401
           +GSK+NHL+YVGDS +G N NIGAG ITCNYDG +K+KT I ++ F+GS++ L+AP+ + 
Sbjct: 357 KGSKVNHLTYVGDSEIGSNCNIGAGVITCNYDGANKFKTIIGDDVFVGSDTQLVAPVKVA 416

Query: 402 QGTYVASGSIITQDTPENSLVFARSRQ 428
            G  + +G+ IT+D  EN LV  R  Q
Sbjct: 417 NGATIGAGTTITRDVGENELVITRVAQ 443


>gi|169794292|ref|YP_001712085.1| bifunctional UDP-N-acetylglucosamine
           pyrophosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Acinetobacter baumannii AYE]
 gi|301347404|ref|ZP_07228145.1| bifunctional UDP-N-acetylglucosamine
           pyrophosphorylase/glucosamine-1-phosphate [Acinetobacter
           baumannii AB056]
 gi|301512462|ref|ZP_07237699.1| bifunctional UDP-N-acetylglucosamine
           pyrophosphorylase/glucosamine-1-phosphate [Acinetobacter
           baumannii AB058]
 gi|301596505|ref|ZP_07241513.1| bifunctional UDP-N-acetylglucosamine
           pyrophosphorylase/glucosamine-1-phosphate [Acinetobacter
           baumannii AB059]
 gi|332850096|ref|ZP_08432483.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Acinetobacter baumannii 6013150]
 gi|332871456|ref|ZP_08439973.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Acinetobacter baumannii 6013113]
 gi|254798609|sp|B0V9X1|GLMU_ACIBY RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|169147219|emb|CAM85078.1| bifunctional protein [Includes: UDP-N-acetylglucosamine
           pyrophosphorylase (N-acetylglucosamine-1-phosphate
           uridyltransferase); Glucosamine-1-phosphate
           N-acetyltransferase ] [Acinetobacter baumannii AYE]
 gi|332730945|gb|EGJ62251.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Acinetobacter baumannii 6013150]
 gi|332731493|gb|EGJ62783.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Acinetobacter baumannii 6013113]
          Length = 454

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 179/453 (39%), Positives = 267/453 (58%), Gaps = 22/453 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM+S   KVLQ +AG+P++ HV++T      EN+  + G+G + + +  F 
Sbjct: 6   IILAAGKGTRMRSQLPKVLQPLAGRPLLGHVIKTAKQLLAENIITIYGHGGDHVKK-TFA 64

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
              ++++  Q  Q GT HAV      + P     +I+YGDVPLV   TL++ ++ ++   
Sbjct: 65  QE-NIQWVEQAEQLGTGHAVQMTLPVL-PKDGISLILYGDVPLVRQTTLEQLIE-VSNKT 121

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++  + DNP GYGR++ ++ +I AI E  DAT+ +R+I   N+G+  +    + +WL
Sbjct: 122 GIGMITLHVDNPTGYGRIVRQDGKIQAIVEHKDATEAQRQIQEINTGIYCVSNAKLHEWL 181

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRYR 246
            ++       EYYLTDI+  A  DG  IASI  +   EV G N+R +L+ +E  +Q +  
Sbjct: 182 PKLSNENAQGEYYLTDIVAMAVADGLEIASIQPELAFEVEGVNDRLQLAALEREFQKQQA 241

Query: 247 RQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPH------VFFGCGVSIENYV-- 292
           +++M  GVT   P       TV + HD  I  + +IE +      V  G G  ++N    
Sbjct: 242 KELMQQGVTFADPARFDLRGTVKVGHDVRIDVNVIIEGNCELGDFVEIGAGCILKNTTIA 301

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +++A+S  +G  +G+ T IGPFAR+R    +   V IGNF EVK  TI  GSK NH 
Sbjct: 302 AGTKVQAYSVFDGAVVGENTQIGPFARLRPGAKLANEVHIGNFVEVKNTTIGLGSKANHF 361

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G   NIGAGTITCNYDG +K+KT I +  FIGSNSSL+AP+TIG G  V +G
Sbjct: 362 TYLGDAEIGAESNIGAGTITCNYDGANKHKTTIGDAVFIGSNSSLVAPVTIGNGATVGAG 421

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           S+IT+D  E SL F R++QI K +     + KK
Sbjct: 422 SVITKDVAEQSLSFERAQQISKANYQRPQKLKK 454


>gi|145635667|ref|ZP_01791363.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate [Haemophilus
           influenzae PittAA]
 gi|145267062|gb|EDK07070.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate [Haemophilus
           influenzae PittAA]
          Length = 456

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 173/447 (38%), Positives = 262/447 (58%), Gaps = 23/447 (5%)

Query: 1   MKRKRL-AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAE 59
           M +K L A++LAAG+G RM S   KVL  IAGKPM+ HV++T    G EN+ L+ G+G +
Sbjct: 1   MTKKALSAVILAAGKGTRMYSDLPKVLHTIAGKPMVKHVIDTAHQLGSENIHLIYGHGGD 60

Query: 60  EITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKA 119
            +   ++     V + +Q  Q GTAHAV  A    K   ++++++YGD PL++  TL+K 
Sbjct: 61  LMR--SYLANEQVNWVLQTEQLGTAHAVQQAAPFFKDN-ENIVVLYGDAPLITKETLEKL 117

Query: 120 MDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAID 179
           + K      IA++  N DNP GYGR++ +N  ++AI E+ DA  ++  I   N+G+M  D
Sbjct: 118 I-KAKPENGIALLTVNLDNPTGYGRIIRENGNVVAIVEQKDANADQLNIKEVNTGVMVSD 176

Query: 180 GLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIE 238
           G     WL ++  N    EYYLTD+I  A  D   + ++   +  EV G NNR +L+ +E
Sbjct: 177 GASFKKWLARVGNNNAQGEYYLTDLIALANQDNCQVIAVQATDVMEVEGANNRLQLAALE 236

Query: 239 NIWQSRYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG--------C 284
             +Q++   ++++ GV +  P       T+    D  I  + +IE  V  G        C
Sbjct: 237 RYFQNKQASKLLLEGVMIYDPARFDLRGTLEHGKDVEIDVNVIIEGSVKLGDRVKIGAGC 296

Query: 285 ---GVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIK 341
               V I N V+I+ +S LE   +G+K  IGPF+R+R    +     +GNF E+KK+T+ 
Sbjct: 297 VLKNVVIGNDVEIKPYSVLEDSVVGEKAAIGPFSRLRPGAELAAETHVGNFVEIKKSTVG 356

Query: 342 EGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIG 401
           +GSK+NHL+YVGDS +G N NIGAG ITCNYDG +K+KT I ++ F+GS++ L+AP+ + 
Sbjct: 357 KGSKVNHLTYVGDSEIGSNCNIGAGVITCNYDGANKFKTIIGDDVFVGSDTQLVAPVKVA 416

Query: 402 QGTYVASGSIITQDTPENSLVFARSRQ 428
            G  + +G+ IT+D  EN LV  R  Q
Sbjct: 417 SGATIGAGTTITRDVGENELVITRVAQ 443


>gi|145633890|ref|ZP_01789611.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate [Haemophilus
           influenzae 3655]
 gi|144985262|gb|EDJ92105.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate [Haemophilus
           influenzae 3655]
          Length = 456

 Score =  315 bits (806), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 172/447 (38%), Positives = 262/447 (58%), Gaps = 23/447 (5%)

Query: 1   MKRKRL-AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAE 59
           M +K L A++LAAG+G RM S   KVL  IAGKPM+ HV++T    G EN+ L+ G+G +
Sbjct: 1   MTKKALSAVILAAGKGTRMYSDLPKVLHTIAGKPMVKHVIDTAHQLGAENIHLIYGHGGD 60

Query: 60  EITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKA 119
            +          V + +Q  Q GTAHAV  A    K   ++++++YGD PL++  TL+K 
Sbjct: 61  LMC--THLANEQVNWVLQTEQLGTAHAVQQAVPFFKDN-ENIVVLYGDAPLITKETLEKL 117

Query: 120 MDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAID 179
           ++   +   IA++  N DNP GYGR++ +N  ++AI E+ DA  ++  I   N+G+M  D
Sbjct: 118 IEAKPEN-GIALLTVNLDNPTGYGRIIRENGNVVAIVEQKDANADQLNIKEVNTGVMVSD 176

Query: 180 GLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIE 238
           G     WL ++  N    EYYLTD+I  A  D   + ++   +  EV G NNR +L+ +E
Sbjct: 177 GASFKKWLARVGNNNAQGEYYLTDLIALANQDNCQVVAVQATDVMEVEGANNRLQLAALE 236

Query: 239 NIWQSRYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG--------C 284
             +Q++   ++++ GV +  P       T+    D  I  + +IE +V  G        C
Sbjct: 237 RYFQNKQASKLLLEGVMIYDPARFDLRGTLEHGKDVEIDVNVIIEGNVKLGDRVKIGAGC 296

Query: 285 ---GVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIK 341
               V I N V+I+ +S LE   +G+K  IGPF+R+R    +     +GNF E+KK+T+ 
Sbjct: 297 VLKNVVIGNDVEIKPYSVLEDSVVGEKAAIGPFSRLRPGAELAAETHVGNFVEIKKSTVG 356

Query: 342 EGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIG 401
           +GSK+NHL+YVGDS +G N NIGAG ITCNYDG +K+KT I ++ F+GS++ L+AP+ + 
Sbjct: 357 KGSKVNHLTYVGDSEIGSNCNIGAGVITCNYDGANKFKTIIGDDVFVGSDTQLVAPVKVA 416

Query: 402 QGTYVASGSIITQDTPENSLVFARSRQ 428
            G  + +G+ IT+D  EN LV  R  Q
Sbjct: 417 NGATIGAGTTITRDVGENELVITRVAQ 443


>gi|197116491|ref|YP_002136918.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Geobacter bemidjiensis Bem]
 gi|197085851|gb|ACH37122.1| glucosamine-1-phosphate N-acetyltransferase and
           N-acetylglucosamine-1-phosphate uridylyltransferase
           [Geobacter bemidjiensis Bem]
          Length = 458

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 179/461 (38%), Positives = 268/461 (58%), Gaps = 23/461 (4%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M  K  AIVLAAG G RMKS   KV+  +AG PMI   +    A+G+E   LV+G+  E+
Sbjct: 1   MGNKISAIVLAAGMGTRMKSDLVKVMHLVAGVPMIQWPVAAAFASGVERCVLVVGHQQEK 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           +  + F     V + +Q  Q GT HAV  A   + PG D V+I+ GD PL+ + +L   +
Sbjct: 61  VREL-FAGRGEVSFALQSEQLGTGHAVRCAMTELDPGADTVLILCGDTPLLEAQSLAGML 119

Query: 121 DKIAQGYS-IAVVGFNADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNSGLMAI 178
               +  + I V+     NP GYGR++     ++ AI EE DAT++ER I   N+G+  I
Sbjct: 120 KAHRETKACITVMTATLGNPFGYGRIVKDATGKVSAITEEKDATEKERLIDEVNAGVYCI 179

Query: 179 DGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLI 237
           D  ++   +  IK +    EYYLTD++ +A   G S  S  V + +E+ G N+R +++  
Sbjct: 180 DRAFLEKAIATIKNDNAQGEYYLTDVVRQAAQHGLSCLSYKVADPREISGVNDRAQMAEA 239

Query: 238 ENIWQSRYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFG--C----- 284
             + + R  R++M+SGVTMI PETV++        D+++ P   IE +   G  C     
Sbjct: 240 ARVLRGRINRELMLSGVTMIDPETVYIDRGVRIGRDSVVYPGATIEGNTVIGERCVIGQG 299

Query: 285 ----GVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATI 340
                 SI + V ++A S LE   +G +  IGP A +R  T +  +V+IGNF E KK  +
Sbjct: 300 SLIQNCSIADDVVVKAGSVLEDSKVGPEAAIGPMAHLRAGTELSAHVKIGNFVETKKTFM 359

Query: 341 KEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITI 400
            EGSK +HL+Y+GD+ +G++VNIG GTITCNYDG  K+KT I +  F+GS+  L+AP+T+
Sbjct: 360 GEGSKASHLTYLGDATIGRDVNIGCGTITCNYDGVKKHKTVIEDGVFVGSDVQLVAPVTV 419

Query: 401 GQGTYVASGSIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           G+ + +A+G+ +T+D P +SL  ARS Q+ KE     +RKK
Sbjct: 420 GRNSLIAAGTTVTKDIPADSLAIARSPQVNKE--GYMLRKK 458


>gi|328471193|gb|EGF42095.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Vibrio parahaemolyticus 10329]
          Length = 453

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 167/443 (37%), Positives = 261/443 (58%), Gaps = 28/443 (6%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG+G RM S+  KVL  +AGKPM+ HV++T    G +N+ LV G+G +++     
Sbjct: 5   AVILAAGKGTRMHSNMPKVLHTLAGKPMVKHVIDTCTGLGAQNIHLVFGHGGDQMQTTLA 64

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAMDKI 123
             T  V + +Q  Q GT HAV    D   P ++D   ++++YGDVPL+S  T++  +D  
Sbjct: 65  DET--VNWVLQADQLGTGHAV----DQASPRFEDDEKILVLYGDVPLISPETIENLLDAQ 118

Query: 124 AQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
             G  IA++    DNP GYGR++ KN  ++AI E+ DA++E+++I   N+G+M   G  +
Sbjct: 119 PTG-GIALLTVMLDNPTGYGRIIRKNGPVVAIVEQKDASEEQKQIKEINTGVMVATGGDL 177

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQ 242
             WL  +  N    EYYLTD+I  A  +G+++ ++  V   EV G N+R +L+ +E  +Q
Sbjct: 178 KRWLSGLNNNNAQGEYYLTDVIAAAHDEGRAVEAVHPVNAIEVEGVNDRAQLARLERAFQ 237

Query: 243 SRYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGV---------- 286
           S   ++++  GV +  P    L        D  I  + +IE +V  G  V          
Sbjct: 238 SMQAQKLLEQGVMLRDPARFDLRGELQCGMDCEIDANVIIEGNVSLGDNVIIGTGCVLKD 297

Query: 287 -SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
             I++   +R +S +EG  +G++  +GPF R+R    +  +  +GNF EVK A I EGSK
Sbjct: 298 CEIDDNTIVRPYSVIEGATVGEECTVGPFTRLRPGAELRNDAHVGNFVEVKNARIGEGSK 357

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
            NHL+Y+GD+ +G+  NIGAGTITCNYDG +K+KT I  + F+GS+S L+AP+TI  G  
Sbjct: 358 ANHLTYLGDAEIGQRTNIGAGTITCNYDGANKFKTIIGNDVFVGSDSQLVAPVTIADGAT 417

Query: 406 VASGSIITQDTPENSLVFARSRQ 428
           + +G+ +T+D  E  LV  R ++
Sbjct: 418 IGAGTTLTKDVEEGELVITRVKE 440


>gi|242241584|ref|ZP_04796029.1| UDP-N-acetylglucosamine pyrophosphorylase [Staphylococcus
           epidermidis W23144]
 gi|242234965|gb|EES37276.1| UDP-N-acetylglucosamine pyrophosphorylase [Staphylococcus
           epidermidis W23144]
          Length = 451

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 178/449 (39%), Positives = 264/449 (58%), Gaps = 24/449 (5%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR 63
           +R AI+LAAG+G RMKS   KVL ++AGKPM+ HV+  +  AG++ +  ++G+GAE +  
Sbjct: 2   QRHAIILAAGKGTRMKSKKYKVLHEVAGKPMVEHVLNNVKQAGVDQIVTIIGHGAESVKD 61

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKI 123
                +L   Y  QD Q GTAHAV  A + +       +++ GD PL++  TL+  +   
Sbjct: 62  TLGNQSL---YSFQDKQLGTAHAVKMAHEHLADKEGTTLVVCGDTPLITYQTLQSLIAHH 118

Query: 124 AQGYS-IAVVGFNADNPKGYGRLLIKNNEIIA-IREENDATDEERKIHYCNSGLMAIDGL 181
               S + V+  +  NP GYGR++  +N I+  I EE DA + ER I   +SG+ A +  
Sbjct: 119 ESTQSQVTVLSASTINPYGYGRIIRNHNGILERIVEEKDADESERAIKEISSGIFAFNNR 178

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ--EVCGCNNRYELSLIEN 239
            + + L Q+K +    EYYL D++     DG   A +   E   E+ G N+R  LS  E 
Sbjct: 179 VLFEKLEQVKNDNAQGEYYLPDVLSLILKDGGK-AEVYCTEDFDEIIGVNDRLMLSEAEK 237

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSY 299
             Q R  R  M +GVT+I P + F+  D  I  DT IEP V  G   +IE  V I  +S 
Sbjct: 238 ALQQRINRYHMENGVTIIDPSSTFIGTDVKIGIDTTIEPGVRIGGHTTIEEDVWIGQYSE 297

Query: 300 LEG--VH--------------IGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG 343
           +    +H              +G+ T +GPFA++R  + +   V++GNF EVKKA IK+G
Sbjct: 298 INNSTIHSNANIKQSVINDSIVGENTTVGPFAQLRPGSNLGSEVKVGNFVEVKKADIKDG 357

Query: 344 SKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQG 403
           +K++HLSY+GD+ +G+  NIG G+IT NYDG +K+KT + ++AFIG N++LIAP+T+G  
Sbjct: 358 AKVSHLSYIGDAEIGERTNIGCGSITVNYDGANKFKTIVGKDAFIGCNTNLIAPVTVGNH 417

Query: 404 TYVASGSIITQDTPENSLVFARSRQIVKE 432
           T +A+GS IT + PE+SL  AR+RQ+ KE
Sbjct: 418 TLIAAGSTITDNIPEDSLALARARQVNKE 446


>gi|28899841|ref|NP_799446.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Vibrio parahaemolyticus RIMD 2210633]
 gi|153839884|ref|ZP_01992551.1| UDP-N-acetylglucosamine pyrophosphorylase [Vibrio parahaemolyticus
           AQ3810]
 gi|260361993|ref|ZP_05774998.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Vibrio parahaemolyticus K5030]
 gi|260876520|ref|ZP_05888875.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Vibrio parahaemolyticus AN-5034]
 gi|260897423|ref|ZP_05905919.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Vibrio parahaemolyticus Peru-466]
 gi|260901308|ref|ZP_05909703.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Vibrio parahaemolyticus AQ4037]
 gi|81726599|sp|Q87KB0|GLMU_VIBPA RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|28808093|dbj|BAC61330.1| UDP-N-acetylglucosamine pyrophosphorylase [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|149746592|gb|EDM57580.1| UDP-N-acetylglucosamine pyrophosphorylase [Vibrio parahaemolyticus
           AQ3810]
 gi|308087880|gb|EFO37575.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Vibrio parahaemolyticus Peru-466]
 gi|308090387|gb|EFO40082.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Vibrio parahaemolyticus AN-5034]
 gi|308109856|gb|EFO47396.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Vibrio parahaemolyticus AQ4037]
 gi|308114156|gb|EFO51696.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Vibrio parahaemolyticus K5030]
          Length = 453

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 167/443 (37%), Positives = 261/443 (58%), Gaps = 28/443 (6%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG+G RM S+  KVL  +AGKPM+ HV++T    G +N+ LV G+G +++     
Sbjct: 5   AVILAAGKGTRMHSNMPKVLHTLAGKPMVKHVIDTCTGLGAQNIHLVFGHGGDQMQTTLA 64

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAMDKI 123
             T  V + +Q  Q GT HAV    D   P ++D   ++++YGDVPL+S  T++  +D  
Sbjct: 65  DET--VNWILQADQLGTGHAV----DQASPRFEDDEKILVLYGDVPLISPETIENLLDAQ 118

Query: 124 AQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
             G  IA++    DNP GYGR++ KN  ++AI E+ DA++E+++I   N+G+M   G  +
Sbjct: 119 PTG-GIALLTVMLDNPTGYGRIIRKNGPVVAIVEQKDASEEQKQIKEINTGVMVATGGDL 177

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQ 242
             WL  +  N    EYYLTD+I  A  +G+++ ++  V   EV G N+R +L+ +E  +Q
Sbjct: 178 KRWLSGLNNNNAQGEYYLTDVIAAAHDEGRAVEAVHPVNAIEVEGVNDRAQLARLERAFQ 237

Query: 243 SRYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGV---------- 286
           S   ++++  GV +  P    L        D  I  + +IE +V  G  V          
Sbjct: 238 SMQAQKLLEQGVMLRDPARFDLRGELQCGMDCEIDANVIIEGNVSLGDNVIIGTGCVLKD 297

Query: 287 -SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
             I++   +R +S +EG  +G++  +GPF R+R    +  +  +GNF EVK A I EGSK
Sbjct: 298 CEIDDNTIVRPYSVIEGATVGEECTVGPFTRLRPGAELRNDAHVGNFVEVKNARIGEGSK 357

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
            NHL+Y+GD+ +G+  NIGAGTITCNYDG +K+KT I  + F+GS+S L+AP+TI  G  
Sbjct: 358 ANHLTYLGDAEIGQRTNIGAGTITCNYDGANKFKTIIGNDVFVGSDSQLVAPVTIADGAT 417

Query: 406 VASGSIITQDTPENSLVFARSRQ 428
           + +G+ +T+D  E  LV  R ++
Sbjct: 418 IGAGTTLTKDVEEGELVITRVKE 440


>gi|184159910|ref|YP_001848249.1| N-acetylglucosamine-1-phosphate uridyltransferase [Acinetobacter
           baumannii ACICU]
 gi|260557844|ref|ZP_05830057.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Acinetobacter baumannii ATCC 19606]
 gi|332873346|ref|ZP_08441300.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Acinetobacter baumannii 6014059]
 gi|254798607|sp|B2I2B5|GLMU_ACIBC RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|183211504|gb|ACC58902.1| N-acetylglucosamine-1-phosphate uridyltransferase [Acinetobacter
           baumannii ACICU]
 gi|260408635|gb|EEX01940.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Acinetobacter baumannii ATCC 19606]
 gi|322509827|gb|ADX05281.1| glmU [Acinetobacter baumannii 1656-2]
 gi|323519836|gb|ADX94217.1| N-acetylglucosamine-1-phosphate uridyltransferase [Acinetobacter
           baumannii TCDC-AB0715]
 gi|332738409|gb|EGJ69282.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Acinetobacter baumannii 6014059]
          Length = 454

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 181/454 (39%), Positives = 268/454 (59%), Gaps = 24/454 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM+S   KVLQ +AG+P++ HV++T      EN+  + G+G + + +  F 
Sbjct: 6   IILAAGKGTRMRSQLPKVLQPLAGRPLLGHVIKTAKQLLAENIITIYGHGGDHVKK-TFA 64

Query: 68  PTLSVEYYIQDCQQGTAHAV-LTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQG 126
              ++++  Q  Q GT HAV +T     K G    +I+YGDVPLV   TL++ ++ ++  
Sbjct: 65  QE-NIQWVEQAEQLGTGHAVQMTLPVLPKDGIS--LILYGDVPLVRQTTLEQLIE-VSNK 120

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
             I ++  + DNP GYGR++ ++ +I AI E  DAT+ +R+I   N+G+  +    + +W
Sbjct: 121 TGIGMITLHVDNPTGYGRIVRQDGKIQAIVEHKDATEAQRQIQEINTGIYCVSNAKLHEW 180

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRY 245
           L ++       EYYLTDI+  A  DG  IASI  +   EV G N+R +L+ +E  +Q + 
Sbjct: 181 LPKLSNENAQGEYYLTDIVAMAVADGLEIASIQPELAFEVEGVNDRLQLAALEREFQKQQ 240

Query: 246 RRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIE------PHVFFGCGVSIENYV- 292
            +++M  GVT   P       TV + HD  I  + +IE        V  G G  ++N   
Sbjct: 241 AKELMQQGVTFADPARFDLRGTVKVGHDVRIDVNVIIEGDCELGDFVEIGAGCILKNTTI 300

Query: 293 ----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
               +++A+S  +G  +G+ T IGPFAR+R    +   V IGNF EVK  TI  GSK NH
Sbjct: 301 AAGTKVQAYSVFDGAVVGENTQIGPFARLRPGAKLANEVHIGNFVEVKNTTIGLGSKANH 360

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
            +Y+GD+ +G   NIGAGTITCNYDG +K+KT I +  FIGSNSSL+AP+TIG G  V +
Sbjct: 361 FTYLGDAEIGAESNIGAGTITCNYDGANKHKTTIGDAVFIGSNSSLVAPVTIGNGATVGA 420

Query: 409 GSIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           GS+IT+D  E SL F R++QI K +     + KK
Sbjct: 421 GSVITKDVAEQSLSFERAQQISKANYQRPQKLKK 454


>gi|167854750|ref|ZP_02477529.1| periplasmic negative regulator of sigmaE [Haemophilus parasuis
           29755]
 gi|167854164|gb|EDS25399.1| periplasmic negative regulator of sigmaE [Haemophilus parasuis
           29755]
          Length = 453

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 171/443 (38%), Positives = 258/443 (58%), Gaps = 30/443 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT-RINF 66
           ++LAAG+G RM S   KVL  IAGKPMI HV++T      + + L+ G+G + +  R++ 
Sbjct: 7   VILAAGKGTRMYSDLPKVLHPIAGKPMIKHVIDTAKQLSAKQIHLIYGHGGDLLQQRLSV 66

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAMDKI 123
            P   V + +Q  Q GT HA+  A     P + D   ++++YGD PL+++ TL+K +   
Sbjct: 67  EP---VNWVLQAEQLGTGHAMQQA----APFFADDENILMLYGDAPLITATTLEKLIAAK 119

Query: 124 AQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
            +   IA++    DNP GYGR++ +N  ++AI E+ DA  E+ KI   N+G+M   G   
Sbjct: 120 PEN-GIALLTVVLDNPTGYGRIIRENGSVVAIVEQKDANPEQLKIQEINTGVMVASGASF 178

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQ 242
             WL Q+  N    EYY+TD+I  A  DG  + ++      EV G NNR +L+ +E  +Q
Sbjct: 179 KKWLSQLDNNNAQGEYYITDVIAMANRDGYKVEAVQATNLMEVEGANNRLQLAALERYYQ 238

Query: 243 SRYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGVSIE------- 289
                +++++GVT+I P       TV    D +I  + ++E  +  G  V I        
Sbjct: 239 KIQAEKLLLAGVTIIDPARFDLRGTVTHGKDVVIDVNVILEGSIQLGNNVKIGAGSVLKN 298

Query: 290 ----NYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
               + V+I+ +S LE   IG+   +GPFAR+R  T +     +GNF E+KK+TI EGSK
Sbjct: 299 VVLGDNVEIKPYSVLEDSVIGESADVGPFARLRPGTELAAKAHVGNFVEIKKSTIGEGSK 358

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
           + HL+Y+GDS +G NVNIGAGTITCNYDG +K+KT I +N F+GS++ L+AP+T+  G  
Sbjct: 359 VGHLTYIGDSEIGANVNIGAGTITCNYDGANKFKTIIGDNVFVGSDTQLVAPVTVASGAT 418

Query: 406 VASGSIITQDTPENSLVFARSRQ 428
           + +GS IT+D   + LV  R  Q
Sbjct: 419 IGAGSTITKDVAADELVITRVPQ 441


>gi|21230033|ref|NP_635950.1| UDP-N-acetylglucosamine pyrophosphorylase [Xanthomonas campestris
           pv. campestris str. ATCC 33913]
 gi|66769973|ref|YP_244735.1| UDP-N-acetylglucosamine pyrophosphorylase [Xanthomonas campestris
           pv. campestris str. 8004]
 gi|81304074|sp|Q4UQF8|GLMU_XANC8 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|81796761|sp|Q8PCZ1|GLMU_XANCP RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|21111553|gb|AAM39874.1| UDP-N-acetylglucosamine pyrophosphorylase [Xanthomonas campestris
           pv. campestris str. ATCC 33913]
 gi|66575305|gb|AAY50715.1| UDP-N-acetylglucosamine pyrophosphorylase [Xanthomonas campestris
           pv. campestris str. 8004]
          Length = 454

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 177/445 (39%), Positives = 256/445 (57%), Gaps = 26/445 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG G RM+S+  KVLQ +AG+PM++HV+ T        + +V G+G  ++ +  F 
Sbjct: 8   VILAAGEGKRMRSALPKVLQPLAGQPMLAHVIATARELQPAAIHVVHGHGGAQV-QAAFA 66

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               +++  Q  Q GT HAV  A  A+ P    V+++YGDVPL+ S +L++ +    +  
Sbjct: 67  GQPDLQWAEQRQQLGTGHAVQQALHAV-PDAATVLVLYGDVPLIRSESLRELLHAPGR-- 123

Query: 128 SIAVVGFNADNPKGYGRLLIKNNE--IIAIREENDATDEERKIHYCNSGLMAIDGLYIMD 185
            IAV+  +  NP GYGR+ ++N E  + AI E+ DA DE+R+I   N+G++  +   +  
Sbjct: 124 -IAVLVADLANPSGYGRI-VRNPEGKVAAIVEQKDADDEQRRIRTINTGILTAESTALRR 181

Query: 186 WLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSR 244
           WL  +  +    E+YLTD+   A  D      + V + Q+V G N+ ++L+ +E  WQ R
Sbjct: 182 WLGGLSNDNAQGEFYLTDVFASAAADYTPADMVQVSDPQDVEGANDPWQLAQLERAWQLR 241

Query: 245 YRRQMMISGVTMIAPETV------FLSHDTIIQPDTVIEPHVFFGCGVSIENYV------ 292
             R + + GV M  P  V       + HD  +  D ++E  V  G GV I  +V      
Sbjct: 242 AARALCLQGVRMADPARVEQRGRVQVGHDVQLDIDVILEGEVTLGDGVVIGPFVRLRDVQ 301

Query: 293 -----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKIN 347
                Q+RA   LEGV       IGPFAR+R  T +   V IGNF E KK  +  GSK N
Sbjct: 302 LAAGTQVRAHCDLEGVVTEGAVQIGPFARLRPGTVLADGVHIGNFVETKKVVMGAGSKAN 361

Query: 348 HLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVA 407
           HL+Y+GD+VVG  VNIGAGTITCNYDG +K +T I + AF+GSNS+L+API IG G  + 
Sbjct: 362 HLTYLGDAVVGSKVNIGAGTITCNYDGVNKSQTTIGDGAFVGSNSALVAPIEIGTGATIG 421

Query: 408 SGSIITQDTPENSLVFARSRQIVKE 432
           +GS+IT+D P + L  AR RQ V E
Sbjct: 422 AGSVITRDAPPHQLSVARPRQTVIE 446


>gi|218711021|ref|YP_002418642.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Vibrio splendidus LGP32]
 gi|218324040|emb|CAV20402.1| UDP-N-acetylglucosamine pyrophosphorylase [Vibrio splendidus LGP32]
          Length = 458

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 171/445 (38%), Positives = 263/445 (59%), Gaps = 32/445 (7%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG+G RM S++ KVL  +AGKPM+ HV++T    G +N+ LV G+G +++     
Sbjct: 10  AVILAAGKGTRMYSNTPKVLHTLAGKPMVKHVIDTCNGLGAQNINLVYGHGGDQMK---- 65

Query: 67  PPTL---SVEYYIQDCQQGTAHAVLTAQDAIKPGYDD--VIIMYGDVPLVSSHTLKKAMD 121
             TL   SV + +Q  Q GT HAV  A        DD  V+++YGDVPL+S  T++  +D
Sbjct: 66  -ATLAEESVNWALQAEQLGTGHAVDQASAHFA---DDEKVLVLYGDVPLISPQTIENLLD 121

Query: 122 KIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
               G  IA++    DNP GYGR++ +N  ++AI E+ DATDE++ I   N+G+M   G 
Sbjct: 122 AQPNG-GIALLTVVLDNPMGYGRIIRRNGPVVAIVEQKDATDEQKLIKEINTGVMVATGG 180

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENI 240
            +  WL  +  +    EYYLTD+I  A  +G+++ ++  V   EV G N+R +L+ +E  
Sbjct: 181 DLKRWLSGLSNDNAQGEYYLTDVIAAAHDEGRAVEAVHPVSPIEVEGVNDRSQLARLERA 240

Query: 241 WQSRYRRQMMISGVTMIAPE------------TVFLSHDTIIQPDTVIEPHVFFGCGV-- 286
           +Q+    +++  GV +  P              V +  + II+    I  +V  G G   
Sbjct: 241 YQAEQADKLLKQGVMLRDPSRFDLRGELQCGMDVEIDTNVIIEGSVSIGDNVVIGAGCVL 300

Query: 287 ---SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG 343
               I++   +R +S +EG  +G+   +GPF R+R    +  N  +GNF EVK   + EG
Sbjct: 301 KDCEIDDNTIVRPYSVIEGATVGEDCTVGPFTRLRPGADMRNNSHVGNFVEVKNTRLGEG 360

Query: 344 SKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQG 403
           SK NHL+Y+GD+ +G+ VN+GAG ITCNYDG +K+KT I ++ F+GS+S LIAP+TIG G
Sbjct: 361 SKANHLTYLGDAEIGQRVNVGAGAITCNYDGANKFKTIIGDDVFVGSDSQLIAPVTIGNG 420

Query: 404 TYVASGSIITQDTPENSLVFARSRQ 428
             V +GS +T+D  EN LV +R+++
Sbjct: 421 ATVGAGSTVTRDVSENELVISRAKE 445


>gi|119776774|ref|YP_929514.1| UDP-N-acetylglucosamine diphosphorylase [Shewanella amazonensis
           SB2B]
 gi|166226122|sp|A1SBT8|GLMU_SHEAM RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|119769274|gb|ABM01845.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase [Shewanella
           amazonensis SB2B]
          Length = 454

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 169/440 (38%), Positives = 257/440 (58%), Gaps = 24/440 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI-TRINF 66
           ++LAAG+G RM+S   KVL  +A KPM+ HV++T      +N+ LV GYG E +  ++  
Sbjct: 6   VILAAGKGTRMRSDLPKVLHSVAHKPMVQHVIDTARELNADNINLVYGYGGELLKAKLGE 65

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQG 126
            P   + + +Q  Q GT HAV  A D I    D V+++YGDVPL    TL+ A+    Q 
Sbjct: 66  QP---LNFVLQAEQLGTGHAVAQAIDHIND-EDTVLVLYGDVPLTRKETLE-ALLAARQP 120

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
             +AV+  + DNP GYGR++ +  +++ I E+ DA+ E+ KI+  NSG+MA+ G  +  W
Sbjct: 121 DGVAVLTVHLDNPTGYGRMVREGGKVVGIVEQKDASPEQLKINEINSGIMALPGKRLKAW 180

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRY 245
           L +++ N    E+YLTD+I  A  DG +I +       E  G NNR +L+ +E  +Q+R 
Sbjct: 181 LGRLENNNAQGEFYLTDVIAMAHADGVAIDTAHPANPIETEGANNRVQLAALERAYQARR 240

Query: 246 RRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV------------- 292
             ++M++G  +  P  + +  D  +  D +I+ +V F   V + N V             
Sbjct: 241 AEELMLAGANLRDPARIDIRGDVTVGMDVMIDVNVIFEGTVKLGNNVTIGAGAILIDCDI 300

Query: 293 ----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
                I+ +S +EG  +G     GPFAR+R    + K+  IGNF E+KKA + EGSK  H
Sbjct: 301 ADNADIKPYSIIEGAKLGDSASAGPFARLRPGAELHKDAHIGNFVEMKKAVLGEGSKAGH 360

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           L+Y+GD+ +GK VNIGAGTITCNYDG +K+ T I +N F+GS++ L+AP+ I +G  + +
Sbjct: 361 LAYLGDAEIGKGVNIGAGTITCNYDGANKHLTVIEDNVFVGSDTQLVAPVVIRKGATLGA 420

Query: 409 GSIITQDTPENSLVFARSRQ 428
           GS +T +  EN LV  R +Q
Sbjct: 421 GSTVTHEVGENELVITRVKQ 440


>gi|161616982|ref|YP_001590947.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|168234449|ref|ZP_02659507.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168263244|ref|ZP_02685217.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|194444740|ref|YP_002043108.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194469132|ref|ZP_03075116.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|197264819|ref|ZP_03164893.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|198246217|ref|YP_002217807.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200387825|ref|ZP_03214437.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|207859085|ref|YP_002245736.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|189041292|sp|A9MXA3|GLMU_SALPB RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|254798792|sp|B5FN29|GLMU_SALDC RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|254798793|sp|B5QUS1|GLMU_SALEP RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|254798796|sp|B4SYC8|GLMU_SALNS RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|161366346|gb|ABX70114.1| hypothetical protein SPAB_04803 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403403|gb|ACF63625.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194455496|gb|EDX44335.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|197243074|gb|EDY25694.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197940733|gb|ACH78066.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199604923|gb|EDZ03468.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205331628|gb|EDZ18392.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205348299|gb|EDZ34930.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|206710888|emb|CAR35252.1| UDP-N-acetylglucosamine pyrophosphorylase [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|322716836|gb|EFZ08407.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 456

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 171/452 (37%), Positives = 266/452 (58%), Gaps = 22/452 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++     G   V LV G+G E + +    
Sbjct: 9   VILAAGKGTRMYSDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTLKD 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HA+  A        +D++++YGDVPL+S  TL++  D   QG 
Sbjct: 69  DKLN--WVLQAEQLGTGHAMQQAAPFFSDD-EDILMLYGDVPLISVETLQRLRDAKPQG- 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    D+P GYGR+  +N ++  I E  DATDE+R+I   N+G++  +G  +  WL
Sbjct: 125 GIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIANGADLKRWL 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQSRYR 246
            ++  N    EYY+TDII  A  +G+ IA++   +  E  G NNR +LS +E I+Q+   
Sbjct: 185 SKLTNNNAQGEYYITDIIALAYQEGREIAAVHPARISETDGVNNRLQLSRLERIYQAEQA 244

Query: 247 RQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG------CGVSIENYV-- 292
            ++++SGV +  P       T+    D  I  + +IE +V  G       G  I+N V  
Sbjct: 245 EKLLLSGVMLRDPARFDLRGTLHCGMDVEIDANVIIEGYVTLGHRVKIGAGCIIKNSVIG 304

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +I  +S +E  H+     IGPFAR+R    +     +GNF E+KKA + +GSK  HL
Sbjct: 305 DDCEISPYSVVEDAHLEAACTIGPFARLRPGAELLAGAHVGNFVEMKKARLGKGSKAGHL 364

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+G+G  +A+G
Sbjct: 365 TYLGDAEIGDNVNIGAGTITCNYDGANKFKTVIGDDVFVGSDTQLVAPVTVGKGATIAAG 424

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + +T++  +N LV +R  Q+ K+     ++KK
Sbjct: 425 TTVTRNVADNELVLSRVPQVHKQGWQRPVKKK 456


>gi|148827819|ref|YP_001292572.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Haemophilus influenzae PittGG]
 gi|166226101|sp|A5UHD3|GLMU_HAEIG RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|148719061|gb|ABR00189.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate [Haemophilus
           influenzae PittGG]
          Length = 456

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 172/447 (38%), Positives = 263/447 (58%), Gaps = 23/447 (5%)

Query: 1   MKRKRL-AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAE 59
           M +K L A++LAAG+G RM S   KVL  IAGKPM+ HV++T    G EN+ L+ G+G +
Sbjct: 1   MTKKALSAVILAAGKGTRMYSDLPKVLHTIAGKPMVKHVIDTAHQLGAENIHLIYGHGGD 60

Query: 60  EITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKA 119
            + R +      V + +Q  Q GTAHAV  +    K   ++++++YGD PL++  TL+K 
Sbjct: 61  -LMRSHLANE-QVNWVLQTEQLGTAHAVQQSAPFFKDN-ENIVVLYGDAPLITKETLEKL 117

Query: 120 MDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAID 179
           ++   +   IA++  N DNP GYGR++ +N  ++AI E+ DA  ++  I   N+G+M  D
Sbjct: 118 IEAKPEN-GIALLTVNLDNPTGYGRIIRENGNVVAIVEQKDANADQLNIKEVNTGVMVSD 176

Query: 180 GLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIE 238
           G     WL ++  N    EYYLTD+I  A  D   + ++   +  EV G NNR +L+ +E
Sbjct: 177 GASFKKWLARVGNNNAQGEYYLTDLIALANQDNCQVVAVQATDVMEVEGANNRLQLAALE 236

Query: 239 NIWQSRYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG--------C 284
              Q++   ++++ GV +  P       T+    D  I  + +IE +V  G        C
Sbjct: 237 RYLQNKQASKLLLEGVMIYDPARFDLRGTLEHGKDVEIDVNVIIEGNVKLGDRVKIGAGC 296

Query: 285 ---GVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIK 341
               V I N V+I+ +S LE   +G+K  IGPF+R+R    +     +GNF E+KK+T+ 
Sbjct: 297 VLKNVVIGNDVEIKPYSVLEDSVVGEKAAIGPFSRLRPGAELAAETHVGNFVEIKKSTVG 356

Query: 342 EGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIG 401
           +GSK+NHL+YVGDS +G N NIGAG ITCNYDG +K+KT I ++ F+GS++ L+AP+ + 
Sbjct: 357 KGSKVNHLTYVGDSEIGSNCNIGAGVITCNYDGANKFKTIIGDDVFVGSDTQLVAPVKVA 416

Query: 402 QGTYVASGSIITQDTPENSLVFARSRQ 428
            G  + +G+ IT+D  EN LV  R  Q
Sbjct: 417 NGATIGAGTTITRDVGENELVITRVAQ 443


>gi|205354555|ref|YP_002228356.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|254798794|sp|B5RFW6|GLMU_SALG2 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|205274336|emb|CAR39360.1| UDP-N-acetylglucosamine pyrophosphorylase [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|326629690|gb|EGE36033.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 456

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 171/452 (37%), Positives = 266/452 (58%), Gaps = 22/452 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++     G   V LV G+G E + +    
Sbjct: 9   VILAAGKGTRMYSDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTLKD 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HA+  A        +D++++YGDVPL+S  TL++  D   QG 
Sbjct: 69  DKLN--WVLQAEQLGTGHAMQKAAPFFSDD-EDILMLYGDVPLISVETLQRLRDAKPQG- 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    D+P GYGR+  +N ++  I E  DATDE+R+I   N+G++  +G  +  WL
Sbjct: 125 GIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIANGADLKRWL 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQSRYR 246
            ++  N    EYY+TDII  A  +G+ IA++   +  E  G NNR +LS +E I+Q+   
Sbjct: 185 SKLTNNNAQGEYYITDIIALAYQEGREIAAVYPARISETDGVNNRLQLSRLERIYQAEQA 244

Query: 247 RQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG------CGVSIENYV-- 292
            ++++SGV +  P       T+    D  I  + +IE +V  G       G  I+N V  
Sbjct: 245 EKLLLSGVMLRDPARFDLRGTLHCGMDVEIDANVIIEGYVTLGHRVKIGAGCIIKNSVIG 304

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +I  +S +E  H+     IGPFAR+R    +     +GNF E+KKA + +GSK  HL
Sbjct: 305 DDCEISPYSVVEDAHLEAACTIGPFARLRPGAELLAGAHVGNFVEMKKARLGKGSKAGHL 364

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+G+G  +A+G
Sbjct: 365 TYLGDAEIGDNVNIGAGTITCNYDGANKFKTVIGDDVFVGSDTQLVAPVTVGKGATIAAG 424

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + +T++  +N LV +R  Q+ K+     ++KK
Sbjct: 425 TTVTRNVADNELVLSRVPQVHKQGWQRPVKKK 456


>gi|90408323|ref|ZP_01216487.1| UDP-N-acetylglucosamine pyrophosphorylase [Psychromonas sp. CNPT3]
 gi|90310554|gb|EAS38675.1| UDP-N-acetylglucosamine pyrophosphorylase [Psychromonas sp. CNPT3]
          Length = 453

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 174/440 (39%), Positives = 263/440 (59%), Gaps = 24/440 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL KIA KPM+ HV++T+   G  ++ L+ G+G E++      
Sbjct: 6   VILAAGKGTRMCSRLPKVLHKIADKPMVQHVIDTVKEVGATHIHLIYGHGGEQMKTAISA 65

Query: 68  PTLSVEYYIQDCQQ-GTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQG 126
             L   ++I+  +Q GT HA+  A    +   + ++++YGDVPL+S+ TL+K +    +G
Sbjct: 66  SNL---HWIEQTEQLGTGHAMQIAMPHFQED-EKILMVYGDVPLLSAKTLQKLIAAQPEG 121

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
             IA++    D+P GYGR+  K  +II I E+ DA+ E+ KI+  N+G++  D   +  W
Sbjct: 122 -GIALLTNYLDDPTGYGRIERKQGDIIGIVEQKDASKEQLKINEVNTGILVADASDLRRW 180

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRY 245
           L  +  +  + E+Y+TDII  A   G  I ++      EV G NNR +L+ +E  +Q   
Sbjct: 181 LPLLSNDNAAGEFYITDIIAMAHQQGAMINAVHPSHAFEVEGVNNRLQLANLERAYQRNV 240

Query: 246 RRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGVSI----------- 288
             Q+++SGV +  P    L        D  I  + +I+  V  G GVSI           
Sbjct: 241 AEQLLLSGVMLRDPARFDLRGELSCGQDVDIDINVIIKGKVTLGDGVSIGANCILINCHI 300

Query: 289 ENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
            + V+I A S +E   IG  + IGPFARIR  T ++KNV IGNF E+KK+T+ +G+K  H
Sbjct: 301 ADNVEISANSIIEDSQIGDASTIGPFARIRPGTVLKKNVHIGNFVEIKKSTLGDGTKCGH 360

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           L+Y+GDS+VG NVN+GAG ITCNYDG +K++THI ++ FIGS+  LIAP++IG G    +
Sbjct: 361 LTYLGDSIVGSNVNVGAGVITCNYDGANKFQTHIGDDVFIGSDCQLIAPLSIGNGATTGA 420

Query: 409 GSIITQDTPENSLVFARSRQ 428
           G+ +  D PEN+L  +RS+Q
Sbjct: 421 GTTVVSDVPENALAISRSKQ 440


>gi|62182345|ref|YP_218762.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|75479650|sp|Q57HY1|GLMU_SALCH RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|62129978|gb|AAX67681.1| N-acetyl glucosamine-1-phosphate uridyltransferase and
           glucosamine-1-phosphate acetyl transferase [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
          Length = 456

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 171/452 (37%), Positives = 266/452 (58%), Gaps = 22/452 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++     G   V LV G+G E + +    
Sbjct: 9   VILAAGKGTRMYSDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTLKD 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HA+  A        +D++++YGDVPL+S  TL++  D   QG 
Sbjct: 69  DKLN--WVLQAEQLGTGHAMQQAAPFFSDD-EDILMLYGDVPLISVETLQRLRDAKPQG- 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    D+P GYGR+  +N ++  I E  DATDE+R+I   N+G++  +G  +  WL
Sbjct: 125 GIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIANGADLKRWL 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQSRYR 246
            ++  N    EYY+TDII  A  +G+ IA++   +  E  G NNR +LS +E I+Q+   
Sbjct: 185 SKMTNNNAQGEYYITDIIALAYQEGREIAAVHPARISETDGVNNRLQLSRLERIYQAEQA 244

Query: 247 RQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG------CGVSIENYV-- 292
            ++++SGV +  P       T+    D  I  + +IE +V  G       G  I+N V  
Sbjct: 245 EKLLLSGVMLRDPARFDLRGTLHCGMDVEIDANVIIEGYVTLGHRVKIGAGCIIKNSVIG 304

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +I  +S +E  H+     IGPFAR+R    +     +GNF E+KKA + +GSK  HL
Sbjct: 305 DDCEISPYSVVEDAHLEAACTIGPFARLRPGAELLAGAHVGNFVEMKKARLGKGSKAGHL 364

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+G+G  +A+G
Sbjct: 365 TYLGDAEIGDNVNIGAGTITCNYDGANKFKTVIGDDVFVGSDTQLVAPVTVGKGATIAAG 424

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + +T++  +N LV +R  Q+ K+     ++KK
Sbjct: 425 TTVTRNVADNELVLSRVPQVHKQGWQRPVKKK 456


>gi|16767146|ref|NP_462761.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|167995196|ref|ZP_02576286.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168245248|ref|ZP_02670180.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168464805|ref|ZP_02698697.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|194451026|ref|YP_002047891.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|81521142|sp|Q8ZKX0|GLMU_SALTY RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|254798795|sp|B4TAW9|GLMU_SALHS RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|16422436|gb|AAL22720.1| N-acetyl glucosamine-1-phosphate uridyltransferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|194409330|gb|ACF69549.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|195632226|gb|EDX50710.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|205327084|gb|EDZ13848.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205336006|gb|EDZ22770.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|261249002|emb|CBG26860.1| UDP-n-acetylglucosamine pyrophosphorylase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. D23580]
 gi|267996148|gb|ACY91033.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301160394|emb|CBW19920.1| UDP-N-acetylglucosamine pyrophosphorylase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. SL1344]
 gi|312914993|dbj|BAJ38967.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321222158|gb|EFX47231.1| N-acetylglucosamine-1-phosphate uridyltransferase /
           Glucosamine-1-phosphate N-acetyltransferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           TN061786]
 gi|323132224|gb|ADX19654.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|332990711|gb|AEF09694.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 456

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 171/452 (37%), Positives = 266/452 (58%), Gaps = 22/452 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++     G   V LV G+G E + +    
Sbjct: 9   VILAAGKGTRMYSDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTLKD 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HA+  A        +D++++YGDVPL+S  TL++  D   QG 
Sbjct: 69  DKLN--WVLQAEQLGTGHAMQQAAPFFSDD-EDILMLYGDVPLISVETLQRLRDAKPQG- 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    D+P GYGR+  +N ++  I E  DATDE+R+I   N+G++  +G  +  WL
Sbjct: 125 GIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIANGADMKRWL 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQSRYR 246
            ++  N    EYY+TDII  A  +G+ IA++   +  E  G NNR +LS +E I+Q+   
Sbjct: 185 SKLTNNNAQGEYYITDIIALAYQEGREIAAVHPARISETDGVNNRLQLSRLERIYQAEQA 244

Query: 247 RQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG------CGVSIENYV-- 292
            ++++SGV +  P       T+    D  I  + +IE +V  G       G  I+N V  
Sbjct: 245 EKLLLSGVMLRDPARFDLRGTLHCGMDVEIDANVIIEGYVTLGHRVKIGAGCIIKNSVIG 304

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +I  +S +E  H+     IGPFAR+R    +     +GNF E+KKA + +GSK  HL
Sbjct: 305 DDCEISPYSVVEDAHLEAACTIGPFARLRPGAELLAGAHVGNFVEMKKARLGKGSKAGHL 364

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+G+G  +A+G
Sbjct: 365 TYLGDAEIGDNVNIGAGTITCNYDGANKFKTVIGDDVFVGSDTQLVAPVTVGKGATIAAG 424

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + +T++  +N LV +R  Q+ K+     ++KK
Sbjct: 425 TTVTRNVADNELVLSRVPQVHKQGWQRPVKKK 456


>gi|237729041|ref|ZP_04559522.1| glucosamine-1-phosphate N-acetyltransferase [Citrobacter sp. 30_2]
 gi|226909663|gb|EEH95581.1| glucosamine-1-phosphate N-acetyltransferase [Citrobacter sp. 30_2]
          Length = 456

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 167/452 (36%), Positives = 270/452 (59%), Gaps = 22/452 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++     G  +V LV G+G + + +    
Sbjct: 9   VILAAGKGTRMYSDLPKVLHTLAGKPMVQHVIDAANELGATHVHLVYGHGGDLLKQTLKD 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HA+  A        +D++++YGDVPL+S+ TL++  +   QG 
Sbjct: 69  GNLN--WVLQAEQLGTGHAMQQAAPFFSDD-EDILMLYGDVPLISTDTLRRLREAKPQG- 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    D+P GYGR+   N ++  I E  DATDE+R+I   N+G++  +G  +  WL
Sbjct: 125 GIGLLTVKLDDPSGYGRITRDNGKVTGIVEHKDATDEQRQIQEINTGILIANGADMKRWL 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQSRYR 246
            ++  N V  EYY+TDII  A  +G+ IA++   +  E  G NNR +LS +E ++QS   
Sbjct: 185 SKLTNNNVQGEYYITDIIAMAYQEGREIAAVHPARISETEGVNNRLQLSRLERVYQSEQA 244

Query: 247 RQMMISGV------------TMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV-- 292
            +++++GV            T+I    V +  + II+ +  +   V  G G  I+N V  
Sbjct: 245 EKLLLAGVMLRDPARFDLRGTLIHGRDVEIDTNVIIEGNVTVGDRVKIGAGCIIKNSVIG 304

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              ++  +S +E  H+     IGPFAR+R    +++   +GNF E+KKA + +GSK  HL
Sbjct: 305 EGCELSPYSVVEDAHLEAACTIGPFARLRPGAELQEGAHVGNFVEMKKARLGKGSKAGHL 364

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+G+G  +A+G
Sbjct: 365 TYLGDAEIGDNVNIGAGTITCNYDGANKFKTIIGDDVFVGSDTQLVAPVTVGKGATIAAG 424

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + +T++  +N LV +R  Q+ K+     ++KK
Sbjct: 425 TTVTRNVADNELVLSRVPQVHKQGWQRPVKKK 456


>gi|168823205|ref|ZP_02835205.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205340517|gb|EDZ27281.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320088287|emb|CBY98048.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
          Length = 456

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 171/452 (37%), Positives = 266/452 (58%), Gaps = 22/452 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++     G   V LV G+G E + +    
Sbjct: 9   VILAAGKGTRMYSDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQALKD 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HA+  A        +D++++YGDVPL+S  TL++  D   QG 
Sbjct: 69  DKLN--WVLQAEQLGTGHAMQQAAPFFSDD-EDILMLYGDVPLISVETLQRLRDAKPQG- 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    D+P GYGR+  +N ++  I E  DATDE+R+I   N+G++  +G  +  WL
Sbjct: 125 GIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIANGADLKRWL 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQSRYR 246
            ++  N    EYY+TDII  A  +G+ IA++   +  E  G NNR +LS +E I+Q+   
Sbjct: 185 SKLTNNNAQGEYYITDIIALAYQEGREIAAVHPARISETDGVNNRLQLSRLERIYQAEQA 244

Query: 247 RQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG------CGVSIENYV-- 292
            ++++SGV +  P       T+    D  I  + +IE +V  G       G  I+N V  
Sbjct: 245 EKLLLSGVMLRDPARFDLRGTLHCGMDVEIDANVIIEGYVTLGHRVKIGAGCIIKNSVIG 304

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +I  +S +E  H+     IGPFAR+R    +     +GNF E+KKA + +GSK  HL
Sbjct: 305 DDCEISPYSVVEDAHLEAACTIGPFARLRPGAELLAGAHVGNFVEMKKARLGKGSKAGHL 364

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+G+G  +A+G
Sbjct: 365 TYLGDAEIGDNVNIGAGTITCNYDGANKFKTVIGDDVFVGSDTQLVAPVTVGKGATIAAG 424

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + +T++  +N LV +R  Q+ K+     ++KK
Sbjct: 425 TTVTRNVADNELVLSRVPQVHKQGWQRPVKKK 456


>gi|145629684|ref|ZP_01785481.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Haemophilus influenzae 22.1-21]
 gi|144978195|gb|EDJ87968.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Haemophilus influenzae 22.1-21]
          Length = 456

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 170/447 (38%), Positives = 262/447 (58%), Gaps = 23/447 (5%)

Query: 1   MKRKRL-AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAE 59
           M +K L A++LAAG+G RM S   KVL  IAGKPM+ HV++T    G EN+ L+ G+G +
Sbjct: 1   MAKKALSAVILAAGKGTRMYSDLPKVLHTIAGKPMVKHVIDTAHQLGSENIHLIYGHGGD 60

Query: 60  EITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKA 119
            +   ++     V + +Q  Q GTAHAV  A    K   ++++++YGD PL++  TL+K 
Sbjct: 61  LMR--SYLANEQVNWVLQTEQLGTAHAVQQAAPFFKDN-ENIVVLYGDAPLITKETLEKL 117

Query: 120 MDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAID 179
           ++   +   IA++  N DNP GYGR++ KN  ++AI E+ DA  ++  I   N+G+M  D
Sbjct: 118 IEAKPEN-GIALLTVNLDNPTGYGRIIRKNGNVVAIVEQKDANADQLNIKEVNTGVMVSD 176

Query: 180 GLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIE 238
           G     WL ++  N    EYYLTD+I  A  D   + ++   +  EV G NNR +L+ +E
Sbjct: 177 GAGFKKWLARVGNNNAQGEYYLTDLIALANQDNCQVVAVQATDVMEVEGANNRLQLAALE 236

Query: 239 NIWQSRYRRQMMISGVTMIAP------------ETVFLSHDTIIQPDTVIEPHVFFGCG- 285
             +Q++   ++++ GV +  P            + V +  + II+    +   V  G G 
Sbjct: 237 RYFQNKQASKLLLEGVMIYDPARFDLRGTLEHGKDVEIDVNVIIKGSVKLGDRVKIGAGC 296

Query: 286 ----VSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIK 341
               V I N V+I+ +S LE   +G+K  IGPF+R+R    +     +GNF E+KK+ + 
Sbjct: 297 VLKNVVIGNDVEIKPYSVLEDSVVGEKAAIGPFSRLRPGAELAAETHVGNFVEIKKSIVG 356

Query: 342 EGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIG 401
           +GSK+NHL+YVGDS +G N NIGAG ITCNYDG +K+KT I ++ F+GS++ L+AP+ + 
Sbjct: 357 KGSKVNHLTYVGDSEIGSNCNIGAGVITCNYDGANKFKTIIGDDVFVGSDTQLVAPVKVA 416

Query: 402 QGTYVASGSIITQDTPENSLVFARSRQ 428
            G  + +G+ IT+D  EN LV  R  Q
Sbjct: 417 SGATIGAGTTITRDVGENELVITRVAQ 443


>gi|119471624|ref|ZP_01614009.1| bifunctional: N-acetyl glucosamine-1-phosphate uridyltransferase
           (N-terminal); glucosamine-1-phosphate acetyl transferase
           [Alteromonadales bacterium TW-7]
 gi|119445403|gb|EAW26690.1| bifunctional: N-acetyl glucosamine-1-phosphate uridyltransferase
           (N-terminal); glucosamine-1-phosphate acetyl transferase
           [Alteromonadales bacterium TW-7]
          Length = 452

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 172/439 (39%), Positives = 256/439 (58%), Gaps = 22/439 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM+S+  KVL K+AGKPM+ HV++   A G     LV G+G E + +    
Sbjct: 6   VILAAGKGTRMRSALPKVLHKVAGKPMVQHVIDNAKALGATTTNLVYGHGGELLQQ--QL 63

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               V++ +Q  Q GT HAV  A   I    D V+++YGDVPL    TL++ +  +    
Sbjct: 64  ADNDVKWVLQAEQLGTGHAVAQANPHINDD-DTVLVLYGDVPLTKQSTLERLL-AVTPKN 121

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            +AV+  N  NP GYGR+L +N +++ I E+ DA+ E+  I+  N+G+MA++G  +  WL
Sbjct: 122 GLAVLTVNLVNPNGYGRMLRENGKLVGIVEQKDASAEQLLINEVNTGIMAVNGKLLKTWL 181

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSRYR 246
             +  N    EYYLTDI+  A  +G  I S       EV G NNR +L+ +E  +Q+   
Sbjct: 182 GNLSNNNAQGEYYLTDIVAMAHSEGVEITSAQPDHAMEVEGANNRVQLAGLERAYQAWQA 241

Query: 247 RQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQI------------ 294
            ++M++G T+  P  + +  +     D +I+ +V F   V++ N V I            
Sbjct: 242 EELMLNGATLADPARIDVRGNVKTGEDVLIDINVIFEGNVTLGNNVHIGPNCVLKNCTIG 301

Query: 295 -----RAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
                +A + +E   +  K  +GP+AR+R    +E++  IGNF E+KK  + +GSK NHL
Sbjct: 302 DNVVIKANTLIEDASVAAKCTLGPYARLRPGAVMEEDSHIGNFVEMKKTRLGKGSKANHL 361

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           SY+GD+ +G+ VNIGAGTITCNYDG +K KT I +NAFIGSNSSL+AP+ IG    V +G
Sbjct: 362 SYLGDAEIGEKVNIGAGTITCNYDGVNKAKTIIGDNAFIGSNSSLVAPVNIGSTATVGAG 421

Query: 410 SIITQDTPENSLVFARSRQ 428
           S+IT    +  L  ARS+Q
Sbjct: 422 SVITSTVEDEQLAIARSKQ 440


>gi|224585657|ref|YP_002639456.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238913115|ref|ZP_04656952.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|224470185|gb|ACN48015.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
          Length = 451

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 171/452 (37%), Positives = 266/452 (58%), Gaps = 22/452 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++     G   V LV G+G E + +    
Sbjct: 4   VILAAGKGTRMYSDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTLKD 63

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HA+  A        +D++++YGDVPL+S  TL++  D   QG 
Sbjct: 64  DKLN--WVLQAEQLGTGHAMQQAAPFFSDD-EDILMLYGDVPLISVETLQRLRDAKPQG- 119

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    D+P GYGR+  +N ++  I E  DATDE+R+I   N+G++  +G  +  WL
Sbjct: 120 GIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIANGADLKRWL 179

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQSRYR 246
            ++  N    EYY+TDII  A  +G+ IA++   +  E  G NNR +LS +E I+Q+   
Sbjct: 180 SKLTNNNAQGEYYITDIIALAYQEGREIAAVHPARISETDGVNNRLQLSRLERIYQAEQA 239

Query: 247 RQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG------CGVSIENYV-- 292
            ++++SGV +  P       T+    D  I  + +IE +V  G       G  I+N V  
Sbjct: 240 EKLLLSGVMLRDPARFDLRGTLHCGMDVEIDANVIIEGYVTLGHRVKIGAGCIIKNSVIG 299

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +I  +S +E  H+     IGPFAR+R    +     +GNF E+KKA + +GSK  HL
Sbjct: 300 DDCEISPYSVVEDAHLEAACTIGPFARLRPGAELLAGAHVGNFVEMKKARLGKGSKAGHL 359

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+G+G  +A+G
Sbjct: 360 TYLGDAEIGDNVNIGAGTITCNYDGANKFKTVIGDDVFVGSDTQLVAPVTVGKGATIAAG 419

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + +T++  +N LV +R  Q+ K+     ++KK
Sbjct: 420 TTVTRNVADNELVLSRVPQVHKQGWQRPVKKK 451


>gi|325577276|ref|ZP_08147760.1| UDP-N-acetylglucosamine diphosphorylase [Haemophilus parainfluenzae
           ATCC 33392]
 gi|325160858|gb|EGC72979.1| UDP-N-acetylglucosamine diphosphorylase [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 456

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 176/449 (39%), Positives = 268/449 (59%), Gaps = 27/449 (6%)

Query: 1   MKRKRLAIV-LAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAE 59
           M  K L++V LAAG+G RM S   KVL K+AGKPM+ HV++T    G ENV L+ G+G E
Sbjct: 1   MTNKALSVVILAAGKGTRMYSDLPKVLHKVAGKPMVKHVIDTANQLGAENVHLIYGHGGE 60

Query: 60  EITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD--VIIMYGDVPLVSSHTLK 117
            + R       S  +  Q  Q GT HA+   Q A+    DD  V+++YGD P+++  TL+
Sbjct: 61  -LMRERLA-NESANWVFQAEQLGTGHAM---QQAMPFFRDDENVLMVYGDGPMITPETLQ 115

Query: 118 KAMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMA 177
           K +D   +   IAV+    DNP GYGR++ +N +++ I E+ DAT E+ KI   N+G++ 
Sbjct: 116 KLIDAKPEN-GIAVLTVVLDNPTGYGRIVRENGKVVGIVEQKDATPEQLKIQEINTGVLV 174

Query: 178 IDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSL 236
            DG     WL ++  N    E+Y+TD+I  A  DG  I ++   +  EV G NNR +L+ 
Sbjct: 175 SDGASFKKWLARLDNNNAQGEFYITDVIGLAHQDGCPIVAVQATDFMEVEGVNNRLQLAK 234

Query: 237 IENIWQSRYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG------- 283
           +E  +Q +   +++++GV +I PE      T+    D  I  + ++E +V  G       
Sbjct: 235 MERYYQRKQAEKLLLAGVMLIDPERFDLRGTLEHGKDVEIDVNVIVEGNVRLGDRVKIGA 294

Query: 284 -C---GVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKAT 339
            C    V+I + V+I+ +S LE   IG+K  IGPF+R+R    +     +GNF E+KK+T
Sbjct: 295 GCVLKNVTIGDDVEIKPYSVLEDAIIGEKAAIGPFSRLRPGAELAAETHVGNFVEIKKST 354

Query: 340 IKEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPIT 399
           + +GSK+NHL+YVGD+ +G+N NIGAG ITCNYDG +K+KT I  + F+GS++ L+AP+T
Sbjct: 355 VGKGSKVNHLTYVGDTEIGENCNIGAGVITCNYDGANKFKTIIGNDVFVGSDTQLVAPVT 414

Query: 400 IGQGTYVASGSIITQDTPENSLVFARSRQ 428
           +  G  + +GS IT++  ++ LV  R  Q
Sbjct: 415 VADGATIGAGSTITKNVEKDELVITRVPQ 443


>gi|52783907|ref|YP_089736.1| GcaD [Bacillus licheniformis ATCC 14580]
 gi|52346409|gb|AAU39043.1| GcaD [Bacillus licheniformis ATCC 14580]
          Length = 466

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 178/457 (38%), Positives = 266/457 (58%), Gaps = 22/457 (4%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR 63
           KR A+VLAAG+G RMKS   KVL  + GKPM+ HV++      +E +  ++G+GAE++ +
Sbjct: 13  KRFAVVLAAGQGTRMKSKLYKVLHPVCGKPMVEHVVDEARKLSLEKLVTIVGHGAEDVKK 72

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM-DK 122
                +   EY +Q  Q GTAHAV  A+  +       I++ GD PL+++ T++  + + 
Sbjct: 73  QLGEKS---EYALQAEQLGTAHAVKQAKSILGSEKGTTIVICGDTPLLTAETMEAMLTEH 129

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLI-KNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
             +   + ++   A++P GYGR++  +N ++  I E  DAT+EER +   N+G    D  
Sbjct: 130 QKKAAKVTILTAVAEDPTGYGRIIRNENGDVAKIVEHKDATEEERLVKEINTGTYCFDNE 189

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASID-VKEQEVCGCNNRYELSLIENI 240
            +   + Q+  + V  EYYL D+IE  +  G+++A+   V  QE  G N+R  LS  E  
Sbjct: 190 ALFQTIEQVSNDNVQGEYYLPDVIEILKNQGETVAAYQTVNFQETLGVNDRVALSQAEIY 249

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
            + R  ++ M +GV++I P+  ++S + +I  DTVI P       V I     I   S L
Sbjct: 250 MKQRINKRHMQNGVSLIDPDNTYISPEAVIGRDTVIYPGTVIKGRVVIGEDAVIGQNSEL 309

Query: 301 EGVHIGKKTII----------------GPFARIRQETTIEKNVRIGNFCEVKKATIKEGS 344
           E   +G +T+I                GPFA IR ++ I   VRIGNF EVKK+   + S
Sbjct: 310 ENSTVGSRTVIKQSVIVDSEVGDDVTIGPFAHIRPDSKIGNEVRIGNFVEVKKSEFGDRS 369

Query: 345 KINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGT 404
           K +HLSY+GD+ +G +VN+G G+IT NYDG HK+KT I   AFIG NS+L+AP+TIG+G 
Sbjct: 370 KASHLSYIGDAEIGTDVNLGCGSITVNYDGKHKFKTKIENGAFIGCNSNLVAPVTIGEGA 429

Query: 405 YVASGSIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           YVA+GS IT D P  +L  AR+RQ+ KED A ++ KK
Sbjct: 430 YVAAGSTITDDVPGRALSIARARQVNKEDYAENIHKK 466


>gi|118594195|ref|ZP_01551542.1| UDP-N-acetylglucosamine pyrophosphorylase [Methylophilales
           bacterium HTCC2181]
 gi|118439973|gb|EAV46600.1| UDP-N-acetylglucosamine pyrophosphorylase [Methylophilales
           bacterium HTCC2181]
          Length = 450

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 170/439 (38%), Positives = 262/439 (59%), Gaps = 24/439 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KV+  +A KP++ HV+ET      E   ++ GY  + + +    
Sbjct: 6   VILAAGKGTRMHSELPKVIHSLANKPLLQHVLETSQRLNPETTTIITGYKTDLVKK--SI 63

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
              ++ + +Q+ Q GT HAVL +   +    D  +I+YGDVPL+ +  L++ ++K+ +G 
Sbjct: 64  TNHNISWCLQEKQLGTGHAVLQSTSHLSA--DKTLILYGDVPLIDALDLQQLLNKVDEG- 120

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            +A++  N   P+GYGR++    EII I EE D   EE+KI   N+G++A +   ++ WL
Sbjct: 121 -LAILTCNKTKPEGYGRIVRHKEEIIKIVEEKDCNKEEKKITEINTGIIACNTKNLIAWL 179

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIAS-IDVKEQEVCGCNNRYELSLIENIWQSRYR 246
            QI  N    EYYLTDI+E A  DG  + S +  KE  V G N++ +L+ IE   Q    
Sbjct: 180 GQITNNNSQNEYYLTDIVEFAVKDGLPVHSQLAQKEISVFGVNSKEDLAEIERGLQMSKA 239

Query: 247 RQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGVSIENYVQIR----- 295
           + +M  GVT++ P  + +        D  I    + E  V  G  V ++ Y  ++     
Sbjct: 240 KLLMSQGVTLLDPSRIDIRGELKCGTDVTIDVGCIFEGSVTLGANVHLKPYCVLKDCEIK 299

Query: 296 ------AFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
                 A+S+++   +G  + IGP+AR+R  T++  NV IGNF E+K +++ +GSKINHL
Sbjct: 300 DGTIVEAYSHIDSSIVGSSSRIGPYARLRPGTSLANNVHIGNFVEIKNSSVNQGSKINHL 359

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           SY+GDS +G+NVNIGAGTITCNYDG  K+KT I +N FIGS+S LIAP+ +G+G  + +G
Sbjct: 360 SYIGDSEIGQNVNIGAGTITCNYDGVKKHKTIIEDNVFIGSSSQLIAPVIVGKGATIGAG 419

Query: 410 SIITQDTPENSLVFARSRQ 428
           S IT++ PE+ L  +RS+Q
Sbjct: 420 STITKNAPEDQLTLSRSQQ 438


>gi|330831703|ref|YP_004394655.1| glucosamine-1-phosphate N-acetyltransferase [Aeromonas veronii
           B565]
 gi|328806839|gb|AEB52038.1| Glucosamine-1-phosphate N-acetyltransferase [Aeromonas veronii
           B565]
          Length = 453

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 171/453 (37%), Positives = 267/453 (58%), Gaps = 24/453 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT-RINF 66
           ++LAAG+G RM+S   KVL  +A KPM+SHV++T    G E + LV G+GAE +  RI  
Sbjct: 6   VILAAGKGTRMRSVLPKVLHPVANKPMVSHVIDTARQVGAEQLHLVYGHGAELLKERI-- 63

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQG 126
                V + +Q  Q GT HAV  A    K   DDV+++YGD PL+   TL++ +   A+ 
Sbjct: 64  -VAADVNWVLQAQQLGTGHAVAQAIPFWKD-VDDVLVLYGDTPLIQPETLQRLLAAKAEN 121

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
             +A++    DNP GYGR++ +N +++ I E+ DA  E+  I   N+G++  +G  +  W
Sbjct: 122 -GMALLTVVLDNPTGYGRIVRENGQVVGIVEQKDANAEQLAIREVNTGVLVANGGQLRQW 180

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDV-KEQEVCGCNNRYELSLIENIWQSRY 245
           L ++       E+YLTD+I  A  DG  IA++   +  EV G NNR +L+ +E  +Q   
Sbjct: 181 LSRLDNKNAQGEFYLTDVIAMAHGDGCPIAAVHPERAAEVEGANNRVQLAALERSYQQMQ 240

Query: 246 RRQMMISGVTMIAP------------ETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV- 292
             ++MI+G T+I P            E V +  + II+    +  HV  G G  +++ V 
Sbjct: 241 AEKLMIAGATLIDPARFDLRGTLEIGEEVVIDVNVIIEGKVTLGNHVRIGAGAVLKDCVI 300

Query: 293 ----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
               +++ +S +EG  +  +  +GPFAR+R    +E++  +GNF E+KKA +  GSK  H
Sbjct: 301 GDHTEVKPYSIVEGAQVADQCSVGPFARLRPGAVLEQDAHVGNFVEMKKARLGVGSKCGH 360

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           L+Y+GD+ +G  VNIGAGTITCNYDG +K++T I ++ F+GS++ L+AP+ IG+G  + +
Sbjct: 361 LTYLGDAEIGAGVNIGAGTITCNYDGVNKFQTIIEDDVFVGSDTQLVAPVRIGKGATLGA 420

Query: 409 GSIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           GS IT+D  EN LV  R  Q   ++ A  ++KK
Sbjct: 421 GSTITKDVAENELVITRVPQRHIKNWARPVKKK 453


>gi|228476221|ref|ZP_04060924.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Staphylococcus hominis SK119]
 gi|228269706|gb|EEK11205.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Staphylococcus hominis SK119]
          Length = 451

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 176/448 (39%), Positives = 264/448 (58%), Gaps = 22/448 (4%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR 63
           +R AI+LAAG+G RMKS   KVL ++AGKPM+ HV+  +  AG+  +  ++G+GAE++  
Sbjct: 2   QRNAIILAAGKGTRMKSKKYKVLHEVAGKPMVEHVLTNVKKAGVNQIVTIVGHGAEQVKD 61

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKI 123
                +L   Y  Q+ Q GTAHAV  A++ +       +++ GD PL++S TL++ +   
Sbjct: 62  TLGNQSL---YSYQNEQLGTAHAVKMAEEHLHTQEGTTLVVCGDTPLITSETLQRLIAHH 118

Query: 124 AQGYS-IAVVGFNADNPKGYGRLL-IKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
            +  + + V+   A  P GYGR++  +N+ +  I EE DAT+ ++ I+  +SG+ A D  
Sbjct: 119 EETQAQVTVLSATAQTPFGYGRIVRDQNHHLNRIVEEKDATNAQKDINEISSGIFAFDNK 178

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLD-GKSIASIDVKEQEVCGCNNRYELSLIENI 240
            + + L Q+K +    EYYL D++     D GK+         E+ G N+R  LS  E  
Sbjct: 179 TLFEKLKQVKNDNAQGEYYLPDVVTLILEDNGKAEVYHTDDFDEIMGVNDRIMLSHAEKA 238

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHV------FFGCGVSIENYVQI 294
            Q R     M +GVT+I P T F+  D  I  DTVIEP V      F G    +  Y +I
Sbjct: 239 LQHRINHHHMRNGVTIIDPNTTFIGSDVEIGMDTVIEPGVRINGKTFIGEDTHVGQYSEI 298

Query: 295 RAF----------SYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGS 344
                        S +    +G KT +GPFA++R  + +   V++GNF EVKKA +K+G+
Sbjct: 299 NNSRIGNKVNIIQSVINDSSVGNKTKVGPFAQLRPGSNLGTEVKVGNFVEVKKAELKDGA 358

Query: 345 KINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGT 404
           K++HLSY+GD+ VG+  NIG G+IT NYDG +K+KT I ++AFIG N++LIAP+T+G G 
Sbjct: 359 KVSHLSYIGDAEVGERTNIGCGSITVNYDGVNKFKTVIGKDAFIGCNTNLIAPVTVGDGA 418

Query: 405 YVASGSIITQDTPENSLVFARSRQIVKE 432
            +A+GS IT D P+ SL  AR+RQ+ KE
Sbjct: 419 LIAAGSTITDDIPKESLALARARQVTKE 446


>gi|145639390|ref|ZP_01794995.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate [Haemophilus
           influenzae PittII]
 gi|145271437|gb|EDK11349.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate [Haemophilus
           influenzae PittII]
          Length = 456

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 172/447 (38%), Positives = 262/447 (58%), Gaps = 23/447 (5%)

Query: 1   MKRKRL-AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAE 59
           M +K L A++LAAG+G RM S   KVL  IAGKPM+ HV++T    G EN+ L+ G+G +
Sbjct: 1   MTKKALSAVILAAGKGTRMYSDLPKVLHTIAGKPMVKHVVDTAHQLGSENIHLIYGHGGD 60

Query: 60  EITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKA 119
            +   ++     V + +Q  Q GTAHAV  A    K   ++++++YGD PL++  TL+K 
Sbjct: 61  LMR--SYLANEQVNWVLQTEQLGTAHAVQQAAPFFKDN-ENIVVLYGDAPLITKETLEKL 117

Query: 120 MDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAID 179
           ++   +   IA++  N DNP GYGR++ +N  ++AI E+ DA  ++  I   N+G+M  D
Sbjct: 118 IEAKPEN-GIALLTVNLDNPTGYGRIIRENGNVVAIVEQKDANADQLNIKEVNTGVMVSD 176

Query: 180 GLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIE 238
           G     WL ++  N    EYYLTD+I  A  D   + ++   +  EV G NNR +L+ +E
Sbjct: 177 GAGFKKWLARVGNNNAQGEYYLTDLIALANQDNCQVIAVQATDVMEVEGANNRLQLAALE 236

Query: 239 NIWQSRYRRQMMISGVTMIAP------ETVFLSHDTIIQPDTVIEPHVFFG--------C 284
             +Q++   ++++ GV +  P       T+    D  I  + +IE  V  G        C
Sbjct: 237 RYFQNKQASKLLLEGVMIYDPVRFDLRGTLEHGKDVEIDVNVIIEGSVKLGDRVKIGAGC 296

Query: 285 ---GVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIK 341
               V I N V+I+ +S LE   +G+K  IGPF+R+R    +     +GNF E+KK+T+ 
Sbjct: 297 VLKNVVIGNDVEIKPYSVLEDSVVGEKAAIGPFSRLRPGAELAAETHVGNFVEIKKSTVG 356

Query: 342 EGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIG 401
           +GSK+NHL+YVGDS +G N NIGAG ITCNYDG +K+KT I  + F+GS++ L+AP+ + 
Sbjct: 357 KGSKVNHLTYVGDSEIGSNCNIGAGVITCNYDGANKFKTIIGNDVFVGSDTQLVAPVKVA 416

Query: 402 QGTYVASGSIITQDTPENSLVFARSRQ 428
            G  + +G+ IT+D  EN LV  R  Q
Sbjct: 417 SGATIGAGTTITRDVGENELVITRVAQ 443


>gi|314937294|ref|ZP_07844636.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Staphylococcus hominis subsp.
           hominis C80]
 gi|313654590|gb|EFS18340.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Staphylococcus hominis subsp.
           hominis C80]
          Length = 451

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 176/448 (39%), Positives = 264/448 (58%), Gaps = 22/448 (4%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR 63
           +R AI+LAAG+G RMKS   KVL ++AGKPM+ HV+  +  AG+  +  ++G+GAE++  
Sbjct: 2   QRNAIILAAGKGTRMKSKKYKVLHEVAGKPMVEHVLTNVKKAGVNQIVTIVGHGAEQVKD 61

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKI 123
                +L   Y  Q+ Q GTAHAV  A++ +       +++ GD PL++S TL++ +   
Sbjct: 62  TLGNQSL---YSYQNEQLGTAHAVKMAEEHLHTQEGTTLVVCGDTPLITSETLQRLIAHH 118

Query: 124 AQGYS-IAVVGFNADNPKGYGRLL-IKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
            +  + + V+   A  P GYGR++  +N+ +  I EE DAT+ ++ I+  +SG+ A D  
Sbjct: 119 EETQAQVTVLSATAQTPFGYGRIVRDQNHHLNRIVEEKDATNAQKDINEISSGIFAFDNK 178

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLD-GKSIASIDVKEQEVCGCNNRYELSLIENI 240
            + + L Q+K +    EYYL D++     D GK+         E+ G N+R  LS  E  
Sbjct: 179 TLFEKLKQVKNDNAQGEYYLPDVVTLILEDNGKAEVYHTDDFDEIMGVNDRIMLSHAEKA 238

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHV------FFGCGVSIENYVQI 294
            Q R     M +GVT+I P T F+  D  I  DTVIEP V      F G    +  Y +I
Sbjct: 239 LQHRINHHHMRNGVTIIDPNTTFIGSDVEIGMDTVIEPGVRINGKTFIGEDTHVGQYSEI 298

Query: 295 RAF----------SYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGS 344
                        S +    +G KT +GPFA++R  + +   V++GNF EVKKA +K+G+
Sbjct: 299 NNSRIGNKVNIIQSVINDSSVGNKTKVGPFAQLRPGSNLGTEVKVGNFVEVKKAELKDGA 358

Query: 345 KINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGT 404
           K++HLSY+GD+ VG+  NIG G+IT NYDG +K+KT I ++AFIG N++LIAP+T+G G 
Sbjct: 359 KVSHLSYIGDAEVGERTNIGCGSITVNYDGVNKFKTVIGKDAFIGCNTNLIAPVTVGDGA 418

Query: 405 YVASGSIITQDTPENSLVFARSRQIVKE 432
            +A+GS IT D P+ SL  AR+RQ+ KE
Sbjct: 419 LIAAGSTITDDIPKESLALARARQVTKE 446


>gi|89092243|ref|ZP_01165197.1| bifunctional: N-acetyl glucosamine-1-phosphate
           uridyltransferase(N-terminal); glucosamine-1-phosphate
           acetyl transferase [Oceanospirillum sp. MED92]
 gi|89083331|gb|EAR62549.1| bifunctional: N-acetyl glucosamine-1-phosphate
           uridyltransferase(N-terminal); glucosamine-1-phosphate
           acetyl transferase [Oceanospirillum sp. MED92]
          Length = 455

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 171/442 (38%), Positives = 275/442 (62%), Gaps = 27/442 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RMKS+  KVL K+ GKPM+ HV++T +     N  +V+G+GA+++      
Sbjct: 6   VILAAGQGSRMKSNLPKVLHKVGGKPMVQHVIDTASELNGVNTHVVIGHGADKLRDELAG 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVI-IMYGDVPLVSSHTLKKAMDKIAQG 126
            TL+  + +Q  Q+GT HAV  A  ++    D V+ ++YGDVPL  + T+++ M +IA  
Sbjct: 66  QTLN--FALQAEQKGTGHAVAQAMPSV--AEDSVVLVLYGDVPLTKAETMQQ-MVEIAAT 120

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNE--IIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
             +A++  N  +P GYGR+ ++N +  ++AI E  DAT E+ KI+  N+G++A+   ++ 
Sbjct: 121 GDLALLTVNLKDPTGYGRI-VRNEQSRVVAIVEHKDATAEQHKINEVNTGILAVKSSHLN 179

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVK-EQEVCGCNNRYELSLIENIWQS 243
           +WL ++       EYYLTDII  A   G +I++I  + E+EV G NNR +L+ +E  +Q+
Sbjct: 180 EWLPKLSSENAQGEYYLTDIIAMAADQGLTISAIQPEAEEEVQGVNNRVQLAELERWYQA 239

Query: 244 RYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGVSIENY------ 291
           +    +M++G T+  P+       V +  D +I  + V+E  +  G  V IE        
Sbjct: 240 QQAEWLMVNGATLADPKRIDVRGNVKIGQDLLIDVNVVLEGEIELGDNVVIEPNCYLKNC 299

Query: 292 -----VQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
                 +I+A + +E   + +   IGPFAR+R  T +    ++GNF E KKA + EGSKI
Sbjct: 300 TIAAGTRIKANTVIEDATVAEACDIGPFARLRPGTQLAAKAKVGNFVETKKAIVGEGSKI 359

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
           NHLSYVGD+++GK+VN+GAGTITCNYDG +K  T I++NAFIGSN++L+AP+ +G+   V
Sbjct: 360 NHLSYVGDAILGKDVNVGAGTITCNYDGVNKSLTEIDDNAFIGSNTALVAPVKVGKMATV 419

Query: 407 ASGSIITQDTPENSLVFARSRQ 428
            +GS I++   +++L   R++Q
Sbjct: 420 GAGSTISKSVSDDALAVTRAKQ 441


>gi|260583188|ref|ZP_05850967.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Haemophilus influenzae NT127]
 gi|260093745|gb|EEW77654.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Haemophilus influenzae NT127]
          Length = 456

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 171/447 (38%), Positives = 262/447 (58%), Gaps = 23/447 (5%)

Query: 1   MKRKRL-AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAE 59
           M +K L A++LAAG+G RM S   KVL  IAGKPM+ HV++T    G EN+ L+ G+G +
Sbjct: 1   MTKKALSAVILAAGKGTRMYSDLPKVLHTIAGKPMVKHVIDTAHQLGSENIHLIYGHGGD 60

Query: 60  EITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKA 119
            +   ++     V + +Q  Q GTAHAV  A    K   ++++++YGD PL++  TL+K 
Sbjct: 61  LMR--SYLANEQVNWVLQTEQLGTAHAVQQAAPFFKDN-ENIVVLYGDAPLITKETLEKL 117

Query: 120 MDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAID 179
           + K      IA++  N DNP GYGR++ +N  ++AI E+ DA  ++  I   N+G+M  D
Sbjct: 118 I-KAKPENGIALLTVNLDNPTGYGRIIRENGNVVAIVEQKDANADQLNIKEVNTGVMVSD 176

Query: 180 GLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIE 238
           G     WL ++  N    EYYLTD+I  A  D   + ++   +  EV G NNR +L+ +E
Sbjct: 177 GAGFKKWLARVGNNNAQGEYYLTDLIALANQDNCQVIAVQATDVMEVEGANNRLQLAALE 236

Query: 239 NIWQSRYRRQMMISGVTMIAP------------ETVFLSHDTIIQPDTVIEPHVFFGCG- 285
             +Q++   ++++ GV +  P            + V +  + II+    +   V  G G 
Sbjct: 237 RYFQNKQASKLLLEGVMIYDPARFDLRGTLEHGKDVEIDVNVIIKGSVKLGDRVKIGAGC 296

Query: 286 ----VSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIK 341
               V I N V+I+ +S LE   +G+K  IGPF+R+R    +     +GNF E+KK+T+ 
Sbjct: 297 VLKNVVIGNDVEIKPYSVLEDSVVGEKAAIGPFSRLRPGAELAAETHVGNFVEIKKSTVG 356

Query: 342 EGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIG 401
           +GSK+NHL+YVGDS +G N NIGAG ITCNYDG +K+KT I ++ F+GS++ L+AP+ + 
Sbjct: 357 KGSKVNHLTYVGDSEIGSNCNIGAGVITCNYDGANKFKTIIGDDVFVGSDTQLVAPVKVA 416

Query: 402 QGTYVASGSIITQDTPENSLVFARSRQ 428
            G  + +G+ IT+D  EN LV  R  Q
Sbjct: 417 SGATIGAGTTITRDVGENELVITRVAQ 443


>gi|52078545|ref|YP_077336.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Bacillus licheniformis ATCC 14580]
 gi|94713417|sp|Q65PH1|GLMU_BACLD RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|52001756|gb|AAU21698.1| UDP-N-acetylglucosamine pyrophosphorylase [Bacillus licheniformis
           ATCC 14580]
          Length = 456

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 178/457 (38%), Positives = 266/457 (58%), Gaps = 22/457 (4%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR 63
           KR A+VLAAG+G RMKS   KVL  + GKPM+ HV++      +E +  ++G+GAE++ +
Sbjct: 3   KRFAVVLAAGQGTRMKSKLYKVLHPVCGKPMVEHVVDEARKLSLEKLVTIVGHGAEDVKK 62

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM-DK 122
                +   EY +Q  Q GTAHAV  A+  +       I++ GD PL+++ T++  + + 
Sbjct: 63  QLGEKS---EYALQAEQLGTAHAVKQAKSILGSEKGTTIVICGDTPLLTAETMEAMLTEH 119

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLI-KNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
             +   + ++   A++P GYGR++  +N ++  I E  DAT+EER +   N+G    D  
Sbjct: 120 QKKAAKVTILTAVAEDPTGYGRIIRNENGDVAKIVEHKDATEEERLVKEINTGTYCFDNE 179

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASID-VKEQEVCGCNNRYELSLIENI 240
            +   + Q+  + V  EYYL D+IE  +  G+++A+   V  QE  G N+R  LS  E  
Sbjct: 180 ALFQTIEQVSNDNVQGEYYLPDVIEILKNQGETVAAYQTVNFQETLGVNDRVALSQAEIY 239

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
            + R  ++ M +GV++I P+  ++S + +I  DTVI P       V I     I   S L
Sbjct: 240 MKQRINKRHMQNGVSLIDPDNTYISPEAVIGRDTVIYPGTVIKGRVVIGEDAVIGQNSEL 299

Query: 301 EGVHIGKKTII----------------GPFARIRQETTIEKNVRIGNFCEVKKATIKEGS 344
           E   +G +T+I                GPFA IR ++ I   VRIGNF EVKK+   + S
Sbjct: 300 ENSTVGSRTVIKQSVIVDSEVGDDVTIGPFAHIRPDSKIGNEVRIGNFVEVKKSEFGDRS 359

Query: 345 KINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGT 404
           K +HLSY+GD+ +G +VN+G G+IT NYDG HK+KT I   AFIG NS+L+AP+TIG+G 
Sbjct: 360 KASHLSYIGDAEIGTDVNLGCGSITVNYDGKHKFKTKIENGAFIGCNSNLVAPVTIGEGA 419

Query: 405 YVASGSIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           YVA+GS IT D P  +L  AR+RQ+ KED A ++ KK
Sbjct: 420 YVAAGSTITDDVPGRALSIARARQVNKEDYAENIHKK 456


>gi|219870479|ref|YP_002474854.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Haemophilus parasuis SH0165]
 gi|254798769|sp|B8F3K4|GLMU_HAEPS RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|219690683|gb|ACL31906.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Haemophilus parasuis SH0165]
          Length = 453

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 170/443 (38%), Positives = 258/443 (58%), Gaps = 30/443 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT-RINF 66
           ++LAAG+G RM S   KVL  IAGKPM+ HV++T      + + L+ G+G + +  R++ 
Sbjct: 7   VILAAGKGTRMYSDLPKVLHPIAGKPMVKHVIDTAKQLSAKQIHLIYGHGGDLLQQRLSA 66

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAMDKI 123
            P   V + +Q  Q GT HA+  A     P + D   ++++YGD PL+++ TL+K +   
Sbjct: 67  EP---VNWVLQAEQLGTGHAMQQA----APFFADDENILMLYGDAPLITATTLEKLIAAK 119

Query: 124 AQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
            +   IA++    DNP GYGR++ +N  ++AI E+ DA  E+ KI   N+G+M   G   
Sbjct: 120 PEN-GIALLTVVLDNPTGYGRIIRENGSVVAIVEQKDANPEQLKIQEINTGVMVASGASF 178

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQ 242
             WL Q+  N    EYY+TD+I  A  DG  + ++      EV G NNR +L+ +E  +Q
Sbjct: 179 KKWLSQLDNNNAQGEYYITDVIAMANRDGYKVEAVQATNLMEVEGANNRLQLAALERYYQ 238

Query: 243 SRYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGVSIE------- 289
                +++++GVT+I P       TV    D +I  + ++E  +  G  V I        
Sbjct: 239 KIQAEKLLLAGVTIIDPARFDLRGTVTHGKDVVIDVNVILEGSIQLGNNVKIGAGSVLKN 298

Query: 290 ----NYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
               + V+I+ +S LE   IG+   +GPFAR+R  T +     +GNF E+KK+TI EGSK
Sbjct: 299 VVLGDNVEIKPYSVLEDSVIGESADVGPFARLRPGTELAAKAHVGNFVEIKKSTIGEGSK 358

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
           + HL+Y+GDS +G NVNIGAGTITCNYDG +K+KT I +N F+GS++ L+AP+T+  G  
Sbjct: 359 VGHLTYIGDSEIGANVNIGAGTITCNYDGANKFKTIIGDNVFVGSDTQLVAPVTVASGAT 418

Query: 406 VASGSIITQDTPENSLVFARSRQ 428
           + +GS IT+D   + LV  R  Q
Sbjct: 419 IGAGSTITKDVAADELVITRVPQ 441


>gi|254229976|ref|ZP_04923377.1| UDP-N-acetylglucosamine pyrophosphorylase [Vibrio sp. Ex25]
 gi|262392806|ref|YP_003284660.1| N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           N-acetyltransferase [Vibrio sp. Ex25]
 gi|151937478|gb|EDN56335.1| UDP-N-acetylglucosamine pyrophosphorylase [Vibrio sp. Ex25]
 gi|262336400|gb|ACY50195.1| N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           N-acetyltransferase [Vibrio sp. Ex25]
          Length = 453

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 169/444 (38%), Positives = 262/444 (59%), Gaps = 30/444 (6%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI-TRIN 65
           A++LAAG+G RM S+  KVL  +AGKPM  HV++T    G +N+ LV G+G +++ T + 
Sbjct: 5   AVILAAGKGTRMHSNMPKVLHTLAGKPMAKHVIDTCTGLGAQNIHLVFGHGGDQMQTTLA 64

Query: 66  FPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAMDK 122
             P   V + +Q  Q GT HAV    D   P ++D   ++++YGDVPL+S+ T++  +D 
Sbjct: 65  EEP---VNWVLQADQLGTGHAV----DQASPRFEDDEKILVLYGDVPLISAETIENLLDA 117

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
              G  IA++    DNP GYGR++ KN  ++AI E+ DAT+E+++I   N+G+M   G  
Sbjct: 118 QPTG-GIALLTVMLDNPTGYGRIIRKNGPVVAIVEQKDATEEQKQIKEINTGVMVATGGD 176

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIW 241
           +  WL  +  N    EYYLTD+I  A  +G+++ ++  V   EV G N+R +L+ +E  +
Sbjct: 177 LKRWLSGLNNNNAQGEYYLTDVIAAAHDEGRAVEAVHPVNAIEVEGVNDRAQLARLERAF 236

Query: 242 QSRYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGV--------- 286
           QS   ++++  GV +  P    L        D  I  + +IE  V  G  V         
Sbjct: 237 QSMQAQKLLEQGVMLRDPARFDLRGELQCGMDCEIDVNVIIEGKVSLGDNVVIGAGCVLK 296

Query: 287 --SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGS 344
              I++   +R +S +EG  +G++  +GPF R+R    +  +  +GNF EVK A I EGS
Sbjct: 297 DCEIDDNTIVRPYSVIEGATVGEECTVGPFTRLRPGAEMRNDSHVGNFVEVKNARIGEGS 356

Query: 345 KINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGT 404
           K NHL+Y+GD+ +G+  NIGAGTITCNYDG +K+KT I  + F+GS+S L+AP+TI  G 
Sbjct: 357 KANHLTYLGDAEIGQRTNIGAGTITCNYDGANKFKTIIGNDVFVGSDSQLVAPVTIADGA 416

Query: 405 YVASGSIITQDTPENSLVFARSRQ 428
            + +G+ +T+D  E  LV  R ++
Sbjct: 417 TIGAGTTLTKDVEEGELVITRVKE 440


>gi|204928778|ref|ZP_03219977.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|204322211|gb|EDZ07409.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
          Length = 456

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 171/452 (37%), Positives = 265/452 (58%), Gaps = 22/452 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++     G   V LV G+G E + +    
Sbjct: 9   VILAAGKGTRMYSDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTLKD 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HA+  A        +D++++YGDVPL+S  TL++  D   QG 
Sbjct: 69  DKLN--WVLQAEQLGTGHAMQQAAPFFSDD-EDILMLYGDVPLISVETLQRLRDAKPQG- 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    D+P GYGR+  +N ++  I E  DATDE+R+I   N+G++  +G  +  WL
Sbjct: 125 GIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIANGADLKRWL 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQSRYR 246
            ++  N    EYY+TDII  A  +G+ IA++   +  E  G NNR +LS +E I+Q+   
Sbjct: 185 SKLTNNNAQGEYYITDIIALAYQEGREIAAVHPARISETDGVNNRLQLSRLERIYQAEQA 244

Query: 247 RQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFG------CGVSIENYV-- 292
            ++++SGV +  P    L        D  I  + +IE +V  G       G  I+N V  
Sbjct: 245 EKLLLSGVMLRDPARFDLRGNLAHGRDVEIDANVIIEGNVTLGHRVKIGAGCIIKNSVIG 304

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +I  +S +E  H+     IGPFAR+R    +     +GNF E+KKA + +GSK  HL
Sbjct: 305 DDCEISPYSVVEDAHLEAACTIGPFARLRPGAELLAGAHVGNFVEMKKARLGKGSKAGHL 364

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+G+G  +A+G
Sbjct: 365 TYLGDAEIGDNVNIGAGTITCNYDGANKFKTVIGDDVFVGSDTQLVAPVTVGKGATIAAG 424

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + +T++  +N LV +R  Q+ K+     ++KK
Sbjct: 425 TTVTRNVADNELVLSRVPQVHKQGWQRPVKKK 456


>gi|319775417|ref|YP_004137905.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Haemophilus influenzae F3047]
 gi|317450008|emb|CBY86221.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Haemophilus influenzae F3047]
          Length = 456

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 173/447 (38%), Positives = 261/447 (58%), Gaps = 23/447 (5%)

Query: 1   MKRKRL-AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAE 59
           M +K L A++LAAG+G RM S   KVL  IAGKPM+ HV++     G EN+ L+ G+G +
Sbjct: 1   MTKKALSAVILAAGKGTRMYSDLPKVLHTIAGKPMVKHVIDIAHQLGSENIHLIYGHGGD 60

Query: 60  EITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKA 119
            + R +      V + +Q  Q GTAHAV  A    K   ++++++YGD PL++  TL+K 
Sbjct: 61  -LMRTHLANE-QVNWVLQTEQLGTAHAVQQAAPFFKDN-ENIVVLYGDAPLITKETLEKL 117

Query: 120 MDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAID 179
           +D   +   IA++  N DNP GYGR++ +N  ++AI E+ DA  ++  I   N+G+M  D
Sbjct: 118 IDAKPEN-GIALLTVNLDNPTGYGRIIRENGNVVAIVEQKDANADQLNIKEVNTGVMVSD 176

Query: 180 GLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIE 238
           G     WL ++  N    EYYLTD+I  A  D   + ++   +  EV G NNR +L+ +E
Sbjct: 177 GASFKKWLARVGNNNAQGEYYLTDLIALANQDNCQVVAVQATDVMEVEGANNRLQLAALE 236

Query: 239 NIWQSRYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG--------C 284
              Q++   ++++ GV +  P       T+    D  I  + +IE +V  G        C
Sbjct: 237 RYLQNKQASKLLLEGVMIYDPARFDLRGTLEHGKDVEIDVNVIIEGNVKLGDRVKIGAGC 296

Query: 285 ---GVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIK 341
               V I N V+++ +S LE   +G+K  IGPF+R+R    +     IGNF E+KK+T+ 
Sbjct: 297 VLKNVVIGNDVELKPYSVLEDSIVGEKAAIGPFSRLRPGAELAAETHIGNFVEIKKSTVG 356

Query: 342 EGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIG 401
           +GSK+NHL+YVGDS +G N NIGAG ITCNYDG +K+KT I  + F+GS++ L+AP+ + 
Sbjct: 357 KGSKVNHLTYVGDSEIGSNCNIGAGVITCNYDGANKFKTIIGNDVFVGSDTQLVAPVKVA 416

Query: 402 QGTYVASGSIITQDTPENSLVFARSRQ 428
            G  + +G+ IT+D  EN LV  R  Q
Sbjct: 417 DGATIGAGTTITRDVGENELVITRVAQ 443


>gi|90023599|ref|YP_529426.1| UDP-N-acetylglucosamine pyrophosphorylase / glucosamine-1-phosphate
           N-acetyltransferase [Saccharophagus degradans 2-40]
 gi|109892120|sp|Q21DL5|GLMU_SACD2 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|89953199|gb|ABD83214.1| UDP-N-acetylglucosamine pyrophosphorylase / glucosamine-1-phosphate
           N-acetyltransferase [Saccharophagus degradans 2-40]
          Length = 451

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 172/439 (39%), Positives = 257/439 (58%), Gaps = 22/439 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM+S   KVL  +AGKP + HV++  A    + V +++G+GA+ +      
Sbjct: 5   IILAAGKGTRMRSDKPKVLHTLAGKPFLEHVLDRSAELNADKVHVIIGHGADMVRE--AL 62

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               V +  Q  Q GT HAVL     + P   D +I+YGDVPL  + TL +   K++   
Sbjct: 63  AGRDVNFVEQTEQLGTGHAVLQVLPHLNP-ESDTLILYGDVPLTKTDTLAELRAKVSDS- 120

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
           S+ ++  N  +P GYGR++  N  + AI E+ DA  E+ KI   N+G+MA+   ++  WL
Sbjct: 121 SMGLLTVNLADPNGYGRIVRTNGSVTAIVEQKDANPEQLKIDEVNTGVMAVKSAHLAKWL 180

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRYR 246
             +  +    EYYLTDII  +  D  +I +   K++ EV G NNR + + +E I+Q +  
Sbjct: 181 PALSNDNAQGEYYLTDIIAMSSADDIAIETAQPKDEYEVLGVNNRLQQAELERIFQRQVA 240

Query: 247 RQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGV-----------SIE 289
            ++M++G T++ P       ++ +  D +I  + V E  V  G  V           +I 
Sbjct: 241 EELMVAGATLLDPARLDCRGSIEVGRDCVIDVNCVFEGKVVLGNNVHIGPNCVISDSTIG 300

Query: 290 NYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
           +   I A S LE   + +   IGPFAR+R  + +    +IGNF E KKA I EGSK+NHL
Sbjct: 301 DGTVILANSILEESTLAENCNIGPFARLRPGSQLASKAKIGNFVETKKAVIGEGSKVNHL 360

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           SYVGD+ +G  VNIGAGTITCNYDG +K KT I + AFIGSNS+L+AP+T+G+   V +G
Sbjct: 361 SYVGDAEIGAGVNIGAGTITCNYDGVNKSKTTIEDGAFIGSNSALVAPVTVGKNATVGAG 420

Query: 410 SIITQDTPENSLVFARSRQ 428
           SI+T+++ E  L+ AR++Q
Sbjct: 421 SIVTKNSEEGDLIIARAKQ 439


>gi|212637892|ref|YP_002314412.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Anoxybacillus flavithermus WK1]
 gi|212559372|gb|ACJ32427.1| UDP-N-acetylglucosamine pyrophosphorylase [Anoxybacillus
           flavithermus WK1]
          Length = 468

 Score =  313 bits (802), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 187/462 (40%), Positives = 266/462 (57%), Gaps = 24/462 (5%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           +  +R AI+LAAG+G RM+S   KVL  + GKPM+ HV++ I+   ++ +  V+G+GAE 
Sbjct: 9   LTMRRYAIILAAGQGTRMRSKLYKVLHPVCGKPMVQHVVDAISTLHVDRLITVVGFGAE- 67

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
             R+        EY IQ+ Q GTAHAVL A   +       +++ GD PL++S T++  +
Sbjct: 68  --RVKEQLGSQSEYVIQEQQLGTAHAVLQAAPHLADKDGVTLVVCGDTPLITSETMEALL 125

Query: 121 DKIAQGYSIA-VVGFNADNPKGYGRLLI-KNNEIIAIREENDATDEERKIHYCNSGLMAI 178
               Q  + A ++   A++P GYGR++  ++  +  I E  DAT+EER I   N+G    
Sbjct: 126 QHHLQTKAKATILTALAEDPTGYGRIVRNEDGHVEKIVEHKDATEEERNIREINTGTYCF 185

Query: 179 DGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLI 237
           D   + + L ++  +    EYYL D+IE  +  G+ I++ +    +E  G N+R  L+  
Sbjct: 186 DNRALFEALTKVSNDNAQGEYYLPDVIEILKKQGEIISAYETPVFEETLGVNDRIALAQA 245

Query: 238 ENIWQSRYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG--CGVS-- 287
           E I ++R  R+ M +GVT+I PE       V +  DTII P T IE H   G  C +   
Sbjct: 246 EKIMRARIHRKHMANGVTIIDPEHTYIGPDVHIGQDTIIYPGTWIEGHTVIGENCIIGPN 305

Query: 288 -------IENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATI 340
                  I N   IR  S +    +G    IGPFA IR    I  +VRIGNF E+KKAT 
Sbjct: 306 SEVKNSRIGNDTLIR-HSVVHDSEVGSDVSIGPFAHIRPLCKIGDDVRIGNFVEIKKATF 364

Query: 341 KEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITI 400
            +GSK +HLSY+GD+ VG +VNIG GTIT NYDG +KY T I + AFIG NS+LIAP+T+
Sbjct: 365 GDGSKASHLSYIGDAEVGAHVNIGCGTITVNYDGVNKYVTKIEDGAFIGCNSNLIAPVTV 424

Query: 401 GQGTYVASGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           G G YVA+GS IT D P  +L  AR+RQ  KE+    ++ KK
Sbjct: 425 GSGAYVAAGSTITDDVPSEALAIARARQTNKENYVERLQAKK 466


>gi|167554161|ref|ZP_02347902.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205321578|gb|EDZ09417.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 456

 Score =  313 bits (802), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 171/452 (37%), Positives = 265/452 (58%), Gaps = 22/452 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++     G   V LV G+G E + +    
Sbjct: 9   VILAAGKGTRMYSDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTLKD 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HA+  A        +D++++YGDVPL+S  TL++  D   QG 
Sbjct: 69  DKLN--WVLQAEQLGTGHAMQQAAPFFSDD-EDILMLYGDVPLISVETLQRLRDAKPQG- 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    D+P GYGR+   N ++  I E  DATDE+R+I   N+G++  +G  +  WL
Sbjct: 125 GIGLLTVKLDDPSGYGRITRVNGKVTGIVEHKDATDEQRQIQEINTGILIANGADLKRWL 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQSRYR 246
            ++  N    EYY+TDII  A  +G+ IA++   +  E  G NNR +LS +E I+Q+   
Sbjct: 185 SKLTNNNAQGEYYITDIIALAYQEGREIAAVHPARISETDGVNNRLQLSRLERIYQAEQA 244

Query: 247 RQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG------CGVSIENYV-- 292
            ++++SGV +  P       T+    D  I  + +IE +V  G       G  I+N V  
Sbjct: 245 EKLLLSGVMLRDPARFDLRGTLHCGMDVEIDANVIIEGYVTLGHRVKIGAGCIIKNSVIG 304

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +I  +S +E  H+     IGPFAR+R    +     +GNF E+KKA + +GSK  HL
Sbjct: 305 DDCEISPYSVVEDAHLEAACTIGPFARLRPGAELLAGAHVGNFVEMKKARLGKGSKAGHL 364

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+G+G  +A+G
Sbjct: 365 TYLGDAEIGDNVNIGAGTITCNYDGANKFKTVIGDDVFVGSDTQLVAPVTVGKGATIAAG 424

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + +T++  +N LV +R  Q+ K+     ++KK
Sbjct: 425 TTVTRNVADNELVLSRVPQVHKQGWQRPVKKK 456


>gi|307265087|ref|ZP_07546647.1| UDP-N-acetylglucosamine pyrophosphorylase [Thermoanaerobacter
           wiegelii Rt8.B1]
 gi|306919885|gb|EFN50099.1| UDP-N-acetylglucosamine pyrophosphorylase [Thermoanaerobacter
           wiegelii Rt8.B1]
          Length = 457

 Score =  313 bits (802), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 183/456 (40%), Positives = 270/456 (59%), Gaps = 25/456 (5%)

Query: 6   LAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRIN 65
           + ++LAAG G RMKS   KV+ K+ GKPMI  V++ +   G + V +V+G+ AEE+  + 
Sbjct: 5   VTLILAAGLGKRMKSKHPKVVHKVCGKPMIEWVVDAVEEIGSKEVIVVVGHKAEEVKEV- 63

Query: 66  FPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMD-KIA 124
                 V+Y  Q+ Q GT HAV+ A+D + P   +V+I+ GD PL++S+TLK+ ++  I 
Sbjct: 64  --LKERVKYAYQEVQLGTGHAVMMAEDLL-PEEGNVLILTGDTPLITSNTLKELINFHIK 120

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNN-EIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
           +  S+ ++    ++P GYGR++   +  +I I E+ DA++EE+ IH  NS +  +D   +
Sbjct: 121 ERNSVTILSSVLEDPTGYGRIIRDGSGNVIKIVEDKDASEEEKSIHEINSAMYVMDIAKL 180

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKAR-LDGKSIASIDVKEQEVCGCNNRYELSLIENIWQ 242
              L  I  N    EYYLTD +E  + +DGK I +  V  +E+ G N+R +L   E I +
Sbjct: 181 KKALRMITNNNAQGEYYLTDAVEIIKDMDGK-IGAFTVPSEEITGVNSRVQLFEAEKIMR 239

Query: 243 SRYRRQMMISGVTMIAPETVFLSH------DTIIQPDTVIEPHVFFGCGVSIENYVQIR- 295
            R   + M +GVT++ P+T ++        DT++ P  VIE     G    I    +I  
Sbjct: 240 KRINYRHMENGVTIVDPDTTYIGAEVEIGADTVVLPGCVIEGKTKIGSDCEIGPNCRIVD 299

Query: 296 ---------AFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
                     +S +    I     IGPFA IR ET I+ NV+IG+F E+KK+ I EGSK+
Sbjct: 300 SEIGDGCSVTYSVILSSKIENNVKIGPFAHIRPETVIQSNVKIGDFVEIKKSIIDEGSKV 359

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
            HL+YVGD+ VGKNVN+G G+IT NYDG  K+KT I +N F+G N +L+AP+ IG   Y+
Sbjct: 360 PHLTYVGDAEVGKNVNMGCGSITVNYDGKQKHKTVIGDNVFVGCNVNLVAPVKIGNNAYI 419

Query: 407 ASGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           A+GS IT+D PE +L  ARSRQ  KE G +  R KK
Sbjct: 420 AAGSTITEDVPEGALAIARSRQTNKE-GWVQERIKK 454


>gi|168239775|ref|ZP_02664833.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|194734047|ref|YP_002116802.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|254798798|sp|B4TN27|GLMU_SALSV RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|194709549|gb|ACF88770.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197287570|gb|EDY26962.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
          Length = 456

 Score =  313 bits (802), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 171/452 (37%), Positives = 265/452 (58%), Gaps = 22/452 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++     G   V LV G+G E + +    
Sbjct: 9   VILAAGKGTRMYSDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTLKD 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HA+  A        +D++++YGDVPL+S  TL++  D   QG 
Sbjct: 69  DKLN--WVLQAEQLGTGHAMQQAAPFFSDD-EDILMLYGDVPLISVETLQRLRDAKPQG- 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    D+P GYGR+  +N ++  I E  DATDE+R+I   N+G++  +G  +  WL
Sbjct: 125 GIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIANGADLKRWL 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASID-VKEQEVCGCNNRYELSLIENIWQSRYR 246
            ++  N    EYY+TDII  A  +G+ IA++   +  E  G NNR +LS +E I+Q+   
Sbjct: 185 SKLTNNNAQGEYYITDIIALAYHEGREIAAVHPARISETDGVNNRLQLSRLERIYQAEQA 244

Query: 247 RQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFG------CGVSIENYV-- 292
            ++++SGV +  P    L        D  I  + +IE +V  G       G  I+N V  
Sbjct: 245 EKLLLSGVMLRDPARFDLRGNLAHGRDVEIDANVIIEGNVTLGHRVKIGAGCIIKNSVIG 304

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +I  +S +E  H+     IGPFAR+R    +     +GNF E+KKA + +GSK  HL
Sbjct: 305 DDCEISPYSVVEDAHLEAACTIGPFARLRPGAELLAGAHVGNFVEMKKARLGKGSKAGHL 364

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+G+G  +A+G
Sbjct: 365 TYLGDAEIGDNVNIGAGTITCNYDGANKFKTVIGDDVFVGSDTQLVAPVTVGKGATIAAG 424

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + +T++  +N LV +R  Q+ K+     ++KK
Sbjct: 425 TTVTRNVADNELVLSRVPQVHKQGWQRPVKKK 456


>gi|322835104|ref|YP_004215131.1| UDP-N-acetylglucosamine pyrophosphorylase [Rahnella sp. Y9602]
 gi|321170305|gb|ADW76004.1| UDP-N-acetylglucosamine pyrophosphorylase [Rahnella sp. Y9602]
          Length = 456

 Score =  313 bits (802), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 171/452 (37%), Positives = 265/452 (58%), Gaps = 22/452 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S+  KVL  +AGKPM+ HV++     G  NV LV G+G + + + N  
Sbjct: 9   VILAAGKGTRMYSNLPKVLHPLAGKPMVQHVIDAATQVGARNVHLVYGHGGDLLKK-NLA 67

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
            +  + + +Q  Q GT HA+  A        +DV+++YGDVPL+S  TL + +     G 
Sbjct: 68  GS-DLNWVLQAEQLGTGHAMQQAAPFFADD-EDVLMLYGDVPLISVDTLNELLKAKPDG- 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    D+P GYGR++ +N  +  I E+ DA++E+ KI   N+G++  +G     WL
Sbjct: 125 GIGLLTVVLDDPTGYGRIVRENGIVTGIIEQKDASEEQLKIQEINTGILVANGASFKRWL 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQSRYR 246
            Q+  N    EYY+TDII  A  +G  IA++   +  EV G NNR +LS +E ++QS   
Sbjct: 185 GQLNNNNAQGEYYITDIIAMAHAEGHLIATVHPARNSEVDGVNNRLQLSRLERVYQSEQA 244

Query: 247 RQMMISGVTMIAPETVFL----SH--DTIIQPDTVIEPHVFFG------CGVSIENYV-- 292
            ++++ GV ++ P    L    SH  D +I  + +IE HV  G       G  ++N V  
Sbjct: 245 ERLLLEGVMLMDPARFDLRGELSHGIDVLIDTNVIIEGHVKLGDRVKIGAGCVLKNCVIG 304

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              ++  +S  E   +     +GPFAR+R    + +   +GNF E+KKA + +GSK  HL
Sbjct: 305 DDCEVSPYSVFEDAVLESGCTVGPFARLRPGAELAEGAHVGNFVEIKKARLGKGSKAGHL 364

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           SY+GD+ +G NVNIGAGTITCNYDG +K+KT I  + F+GS+S L+AP+T+G    +A+G
Sbjct: 365 SYLGDADIGDNVNIGAGTITCNYDGVNKHKTIIGNDVFVGSDSQLVAPVTVGNNVTIAAG 424

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + +T+D P+N L+ +R  Q+ K D    ++KK
Sbjct: 425 TTVTRDVPDNGLLLSRVPQVHKPDWQKPVKKK 456


>gi|239502812|ref|ZP_04662122.1| bifunctional UDP-N-acetylglucosamine
           pyrophosphorylase/glucosamine-1-phosphate [Acinetobacter
           baumannii AB900]
          Length = 454

 Score =  313 bits (802), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 181/454 (39%), Positives = 267/454 (58%), Gaps = 24/454 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM+S   KVLQ +AG+P++ HV++T      EN+  + G+G + + +  F 
Sbjct: 6   IILAAGKGTRMRSQLPKVLQPLAGRPLLGHVIKTAKQLLAENIITIYGHGGDHVKK-TFA 64

Query: 68  PTLSVEYYIQDCQQGTAHAV-LTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQG 126
              ++++  Q  Q GT HAV +T     K G    +I+YGDVPLV   TL++ ++  +  
Sbjct: 65  QE-NIQWVEQAEQLGTGHAVQMTLPVLPKDGIS--LILYGDVPLVRQTTLEQLIEA-SNK 120

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
             I ++  + DNP GYGR++ ++ +I AI E  DAT+ +R+I   N+G+  +    + +W
Sbjct: 121 TGIGMITLHVDNPTGYGRIVRQDGKIQAIVEHKDATEAQRQIQEINTGIYCVSNAKLHEW 180

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRY 245
           L ++       EYYLTDI+  A  DG  IASI  +   EV G N+R +L+ +E  +Q + 
Sbjct: 181 LPKLSNENAQGEYYLTDIVAMAVADGLEIASIQPELAFEVEGVNDRLQLAALEREFQKQQ 240

Query: 246 RRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIE------PHVFFGCGVSIENYV- 292
            +++M  GVT   P       TV + HD  I  + +IE        V  G G  ++N   
Sbjct: 241 AKELMQQGVTFADPARFDLRGTVKVGHDVRIDVNVIIEGDCELGDFVEIGAGCILKNTTI 300

Query: 293 ----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
               +++A+S  +G  +G+ T IGPFAR+R    +   V IGNF EVK  TI  GSK NH
Sbjct: 301 AAGTKVQAYSVFDGAVVGENTQIGPFARLRPGAKLANEVHIGNFVEVKNTTIGLGSKANH 360

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
            +Y+GD+ +G   NIGAGTITCNYDG +K+KT I +  FIGSNSSL+AP+TIG G  V +
Sbjct: 361 FTYLGDAEIGAESNIGAGTITCNYDGANKHKTTIGDAVFIGSNSSLVAPVTIGNGATVGA 420

Query: 409 GSIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           GS+IT+D  E SL F R++QI K +     + KK
Sbjct: 421 GSVITKDVAEQSLSFERAQQISKANYQRPQKLKK 454


>gi|294339090|emb|CAZ87444.1| Bifunctional protein glmU [Includes: UDP-N-acetylglucosamine
           pyrophosphorylase (N-acetylglucosamine-1-phosphate
           uridyltransferase); Glucosamine-1-phosphate
           N-acetyltransferase ] [Thiomonas sp. 3As]
          Length = 463

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 171/453 (37%), Positives = 255/453 (56%), Gaps = 22/453 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           +VLAAG+G RM+S + KVLQ +AGKP++ HV++T+     E V +V G+GA+ +    F 
Sbjct: 14  VVLAAGKGTRMRSDAPKVLQPLAGKPLLGHVLDTVHHLSAERVVVVTGFGAQRVQEA-FA 72

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               + + +Q+ Q GT HAV  A   + PG    +++YGDVPL  + +L   + + AQ  
Sbjct: 73  HQAHLRFALQEPQLGTGHAVQQALPDL-PGDGVCLVLYGDVPLAPAASLAPLVAQ-AQTG 130

Query: 128 SIAVVGFNADNPKGYGRLL-IKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
           ++A++    D+P GYGR+L   +  +  I E  DAT  +R +  CN+G++      +  W
Sbjct: 131 ALALLTVELDDPTGYGRILRSADGAVQGIVEHKDATPAQRAVRECNTGILCAPLPALRRW 190

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSI-ASIDVKEQEVCGCNNRYELSLIENIWQSRY 245
           L Q++ +    EYYLTD++  A  DG  + AS      +V G N+R +L+ +E + Q R 
Sbjct: 191 LGQLRNDNAQGEYYLTDVVALAVADGVPVRASTVADADDVLGVNDRSQLAHLERVVQLRT 250

Query: 246 RRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIR---- 295
            R+++ +GVT+  P        +    D  I    V E  V    G  +  Y  +R    
Sbjct: 251 ARRLLDAGVTLADPSRIDVRGALHCGRDVFIDVGCVFEGEVHLADGARVGPYAVLRDVRV 310

Query: 296 -------AFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
                   F +L+G  IG   IIGPFAR+R  T +   V IGNF EVK  T+  GSK NH
Sbjct: 311 GAGTVVHPFCHLDGASIGAGAIIGPFARLRPATALADGVHIGNFVEVKNGTLGPGSKANH 370

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           LSYVGD+ VG  VNIGAGTI  NYDG +K++T I ++A  GSNS L+APITIG G  V +
Sbjct: 371 LSYVGDATVGSRVNIGAGTIVANYDGANKHRTVIEDDAHTGSNSVLVAPITIGAGATVGA 430

Query: 409 GSIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           GS ++++ P   L  AR++ +  +  +  ++KK
Sbjct: 431 GSTVSKNVPAGKLTVARAKAVTLDGWSRPVKKK 463


>gi|296135044|ref|YP_003642286.1| UDP-N-acetylglucosamine pyrophosphorylase [Thiomonas intermedia
           K12]
 gi|295795166|gb|ADG29956.1| UDP-N-acetylglucosamine pyrophosphorylase [Thiomonas intermedia
           K12]
          Length = 466

 Score =  313 bits (801), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 171/453 (37%), Positives = 254/453 (56%), Gaps = 22/453 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           +VLAAG+G RM+S + KVLQ +AGKP++ HV++T+     E V +V G+GA+ +    F 
Sbjct: 17  VVLAAGKGTRMRSDAPKVLQPLAGKPLLGHVLDTVHHLAAERVVVVTGFGAQRVQEA-FA 75

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               + + +Q+ Q GT HAV  A   + PG    +++YGDVPL  + +L   + + AQ  
Sbjct: 76  HQAHLRFALQEPQLGTGHAVQQALPDL-PGDGVCLVLYGDVPLAPAASLAPLVAQ-AQTG 133

Query: 128 SIAVVGFNADNPKGYGRLL-IKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
           ++A++    D+P GYGR+L   +  +  I E  DAT  +R +  CN+G++      +  W
Sbjct: 134 ALALLTVELDDPTGYGRILRSADGAVQGIVEHKDATPTQRAVRECNTGILCAPLPALRRW 193

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSI-ASIDVKEQEVCGCNNRYELSLIENIWQSRY 245
           L Q++ +    EYYLTD++  A  DG  + AS      +V G N+R +L+ +E + Q R 
Sbjct: 194 LGQLRNDNAQGEYYLTDVVALAVADGVPVRASTVADADDVLGVNDRSQLAHLERVVQLRT 253

Query: 246 RRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIR---- 295
            R+++ +GVT+  P        +    D  I    V E  V    G  +  Y  +R    
Sbjct: 254 ARRLLDAGVTLADPSRIDVRGALHCGRDVFIDVGCVFEGEVHLADGARVGPYAVLRDVRV 313

Query: 296 -------AFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
                   F +L+G  IG   IIGPFAR+R  T +   V IGNF EVK  T+  GSK NH
Sbjct: 314 GAGTVVHPFCHLDGASIGAGAIIGPFARLRPATALADGVHIGNFVEVKNGTLGPGSKANH 373

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           LSYVGD+ VG  VNIGAGTI  NYDG +K++T I ++A  GSNS L+APITIG G  V +
Sbjct: 374 LSYVGDATVGARVNIGAGTIVANYDGANKHRTVIEDDAHTGSNSVLVAPITIGAGATVGA 433

Query: 409 GSIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           GS ++++ P   L  AR++ +  +     ++KK
Sbjct: 434 GSTVSKNVPAGKLTVARAKAVTLDGWTRPVKKK 466


>gi|323496904|ref|ZP_08101932.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Vibrio sinaloensis DSM 21326]
 gi|323317978|gb|EGA70961.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Vibrio sinaloensis DSM 21326]
          Length = 453

 Score =  313 bits (801), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 166/443 (37%), Positives = 262/443 (59%), Gaps = 28/443 (6%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG+G RM S+  KVL  +AGKPM+ HV++T    G +N+ LV G+G +++     
Sbjct: 5   AVILAAGKGTRMYSNKPKVLHTLAGKPMVKHVIDTCNGLGAQNIHLVYGHGGDQMQA--E 62

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAMDKI 123
               SV + +Q  Q GT HAV    D   P ++D   ++++YGDVPL+S  T++  +D  
Sbjct: 63  LANESVNWTLQAEQLGTGHAV----DQASPQFEDDEKILVLYGDVPLISEETIEGLLDAK 118

Query: 124 AQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
            +G  IA++    DNP GYGR++ KN  ++AI E+ DAT+E++ I   N+G+M   G  +
Sbjct: 119 PEG-GIALLTVVMDNPMGYGRIVRKNGPVVAIVEQKDATEEQKLIKEINTGVMVARGADL 177

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQ 242
             WL  +  +    EYYLTD+I  A  +G+++ ++  V   EV G N+R +L+ +E  +Q
Sbjct: 178 RRWLSNLNNDNAQGEYYLTDVIAAAHNEGRAVEAVHPVNAIEVEGVNDRAQLARLERAFQ 237

Query: 243 SRYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGVSI-------- 288
           S   ++++  GV +  P    L        D  I  + +IE  V  G  V+I        
Sbjct: 238 SMQAQKLLEQGVMLRDPARFDLRGELQCGMDCEIDANVIIEGKVTLGDNVTIGAGCVLKD 297

Query: 289 ---ENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
              ++   +R +S +EG  +G++  +GPF R+R    +  +  +GNF EVK A + EGSK
Sbjct: 298 CEIDDNTLVRPYSVIEGATVGEECTVGPFTRLRPGAEMRNDSHVGNFVEVKNARLGEGSK 357

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
            NHL+Y+GD+ +G+  NIGAGTITCNYDG +K+KT I  + F+GS+S L+AP+TI  G  
Sbjct: 358 ANHLTYLGDADIGQRTNIGAGTITCNYDGANKFKTTIGNDVFVGSDSQLVAPVTIADGAT 417

Query: 406 VASGSIITQDTPENSLVFARSRQ 428
           + +G+ +T+D  E  LV  R+++
Sbjct: 418 IGAGTTLTKDVAEGELVITRTKE 440


>gi|84393418|ref|ZP_00992175.1| UDP-N-acetylglucosamine pyrophosphorylase [Vibrio splendidus 12B01]
 gi|84375934|gb|EAP92824.1| UDP-N-acetylglucosamine pyrophosphorylase [Vibrio splendidus 12B01]
          Length = 452

 Score =  313 bits (801), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 170/445 (38%), Positives = 263/445 (59%), Gaps = 32/445 (7%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG+G RM S++ KVL  +AGKPM+ HV++T    G +N+ LV G+G +++     
Sbjct: 5   AVILAAGKGTRMYSNTPKVLHTLAGKPMVKHVIDTCNGLGAQNINLVYGHGGDQMK---- 60

Query: 67  PPTL---SVEYYIQDCQQGTAHAVLTAQDAIKPGYDD--VIIMYGDVPLVSSHTLKKAMD 121
             TL   SV + +Q  Q GT HAV  A        DD  V+++YGDVPL+S  T++  +D
Sbjct: 61  -ATLAEESVNWALQAEQLGTGHAVDQASAHFA---DDEKVLVLYGDVPLISPQTIENLLD 116

Query: 122 KIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
               G  IA++    DNP GYGR++ +N  ++AI E+ DATDE++ I   N+G+M   G 
Sbjct: 117 AQPNG-GIALLTVVLDNPMGYGRIIRRNGPVVAIVEQKDATDEQKLIKEINTGVMVATGG 175

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENI 240
            +  WL  +  +    EYYLTD+I  A  +G+++ ++  V   EV G N+R +L+ +E  
Sbjct: 176 DLKRWLSGLSNDNAQGEYYLTDVIAAAHDEGRAVEAVHPVSPIEVEGVNDRSQLARLERA 235

Query: 241 WQSRYRRQMMISGVTMIAPE------------TVFLSHDTIIQPDTVIEPHVFFGCGV-- 286
           +Q+    +++  GV +  P              V +  + II+    I  +V  G G   
Sbjct: 236 YQAEQADKLLKQGVMLRDPSRFDLRGELQCGMDVEIDTNVIIEGSVSIGDNVVIGTGCVL 295

Query: 287 ---SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG 343
               I++   +R +S +EG  +G+   +GPF R+R    +  N  +GNF E+K   + EG
Sbjct: 296 KDCEIDDNTIVRPYSVIEGATVGEDCTVGPFTRLRPGADMRNNSHVGNFVEMKNTRLGEG 355

Query: 344 SKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQG 403
           SK NHL+Y+GD+ +G+ VN+GAG ITCNYDG +K+KT I ++ F+GS+S LIAP+TIG G
Sbjct: 356 SKANHLTYLGDAEIGQRVNVGAGAITCNYDGANKFKTIIGDDVFVGSDSQLIAPVTIGNG 415

Query: 404 TYVASGSIITQDTPENSLVFARSRQ 428
             V +GS +T+D  EN LV +R+++
Sbjct: 416 ATVGAGSTVTRDVAENELVISRAKE 440


>gi|157144363|ref|YP_001451682.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Citrobacter koseri ATCC BAA-895]
 gi|166226089|sp|A8ACN3|GLMU_CITK8 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|157081568|gb|ABV11246.1| hypothetical protein CKO_00067 [Citrobacter koseri ATCC BAA-895]
          Length = 456

 Score =  313 bits (801), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 169/452 (37%), Positives = 264/452 (58%), Gaps = 22/452 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGK M+ HV++     G   V LV G+G + +   N  
Sbjct: 9   VILAAGKGTRMYSDLPKVLHTLAGKAMVQHVIDAANELGASQVHLVYGHGGDLLK--NTL 66

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
              ++ + +Q  Q GT HA+  A        +D++++YGDVPL+S  TL++  D   QG 
Sbjct: 67  KNDNLNWVLQAEQLGTGHAMQQAAPFFSDD-EDILMLYGDVPLISVETLQRLRDAKPQG- 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    D+P GYGR+  +N ++  I E  DATDE+R+I   N+G++  +G  +  WL
Sbjct: 125 GIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIANGADMKRWL 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDV-KEQEVCGCNNRYELSLIENIWQSRYR 246
            ++  N    EYY+TDII  A  +G+ IA++   +  EV G NNR +LS +E ++QS   
Sbjct: 185 AKLTNNNAQGEYYITDIIALAYQEGREIAAVHPDRLSEVEGVNNRLQLSRLERVYQSEQA 244

Query: 247 RQMMISGVTMIAP------------ETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV-- 292
            +++++GV +  P              V +  + II+ +  +   V  G G  I+N V  
Sbjct: 245 EKLLLAGVMLRDPARFDLRGALTHGRDVEIDTNVIIKGNVTLGHRVKIGAGCVIKNSVIG 304

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
               I  +S +E  H+     IGPFAR+R    + +   +GNF E+KKA + +GSK  HL
Sbjct: 305 DDCDISPYSVVEDAHLEAACTIGPFARLRPGAELREGAHVGNFVEMKKARLGKGSKAGHL 364

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           SY+GD+ +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+G+G  +A+G
Sbjct: 365 SYLGDAEIGDNVNIGAGTITCNYDGANKFKTIIGDDVFVGSDTQLVAPVTVGKGATIAAG 424

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + +T+D  +N LV +R  Q+ K+      +KK
Sbjct: 425 TTVTRDVADNELVLSRVPQVHKQGWQRPAKKK 456


>gi|121999206|ref|YP_001003993.1| UDP-N-acetylglucosamine pyrophosphorylase [Halorhodospira halophila
           SL1]
 gi|166226102|sp|A1WZS9|GLMU_HALHL RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|121590611|gb|ABM63191.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase
           [Halorhodospira halophila SL1]
          Length = 473

 Score =  313 bits (801), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 164/448 (36%), Positives = 253/448 (56%), Gaps = 30/448 (6%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           M+     ++LAAG+G RM+S+  KVLQ +AG+P+++HV++T  A G E V +V G+G ++
Sbjct: 1   MRAPVAVVILAAGKGTRMRSAQPKVLQPLAGRPLLAHVLDTALALGPEQVHVVYGHGGDQ 60

Query: 61  IT--RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKK 118
           +     ++P    V +  Q  Q GT HAV  A   I P    V+++YGDVPLV+  TLK 
Sbjct: 61  VAAAHADYP----VYWVEQPRQLGTGHAVACALPQI-PDDHRVLVLYGDVPLVTPETLKP 115

Query: 119 AMDKIAQGYSIAVVGFNADNPKGYGRLLIKNN-EIIAIREENDATDEERKIHYCNSGLMA 177
            +     G  + ++     +P GYGR++  ++  ++AI EE DA  E+R++   N+GL+A
Sbjct: 116 LL----AGDGLELLAARVPDPTGYGRIIRDDDGAVVAIVEEKDADPEQRRVDEVNTGLLA 171

Query: 178 IDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSI-ASIDVKEQEVCGCNNRYELSL 236
                +  W+  +  +    EYYLTD +  AR DG  + A    +  E  G N+  +L+ 
Sbjct: 172 ASAGDLRRWMAALSADNAQGEYYLTDAVAAARADGTPVRARFTSEAGEASGINDLVQLAE 231

Query: 237 IENIWQSRYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGVS--- 287
           +E  +Q R+ R+++  G+ ++AP    L        D  +  D  +E  V  G GV    
Sbjct: 232 VEEAFQRRWARRLLQGGLRLVAPHRFTLRGAVRHGTDCAVDADCTLEGEVQLGHGVQVGQ 291

Query: 288 --------IENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKAT 339
                   IE+  Q+  ++ +E  HIG    +GPFA +R  T +E+  R+GNF E K A 
Sbjct: 292 GVILRDCVIEDGAQVGPYTVVEQAHIGAGCRVGPFAHLRPGTVLEEGARVGNFVETKAAR 351

Query: 340 IKEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPIT 399
           +  G+K NHL+YVGD+ VG   N+GAGTITCNYDG  K++T I E+AFIGS S L+AP+ 
Sbjct: 352 LGPGAKANHLTYVGDAEVGARANLGAGTITCNYDGAEKHRTQIGEDAFIGSGSQLVAPVQ 411

Query: 400 IGQGTYVASGSIITQDTPENSLVFARSR 427
           +G    + +G+ +T D P ++L   RSR
Sbjct: 412 VGARATIGAGTTLTSDAPADALTVGRSR 439


>gi|260774960|ref|ZP_05883860.1| N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           N-acetyltransferase [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260609050|gb|EEX35209.1| N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           N-acetyltransferase [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 453

 Score =  313 bits (801), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 171/443 (38%), Positives = 261/443 (58%), Gaps = 28/443 (6%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG+G RM S+  KVL  +AGKPM  HV++T +  G +N+ LV G+G +++     
Sbjct: 5   AVILAAGKGTRMYSNKPKVLHTLAGKPMAKHVIDTCSGLGAQNIHLVYGHGGDQMQA--E 62

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAMDKI 123
               SV + +Q  Q GT HAV    D   P ++D   ++++YGDVPL+S  T++  +D  
Sbjct: 63  LAEESVNWVLQADQLGTGHAV----DQASPQFEDDEKILVLYGDVPLISEETIESLLDAQ 118

Query: 124 AQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
             G  IA++    DNP GYGR++ KN  ++AI E+ DAT+E++ I   N+G+M   G  +
Sbjct: 119 PTG-GIALLTVVLDNPMGYGRIVRKNGPVVAIVEQKDATEEQKLIKEINTGVMVATGGDL 177

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQ 242
             WL  +  N    EYYLTD+I  A  +G+++ ++  V   EV G N+R +L+ +E  +Q
Sbjct: 178 KRWLSGLNNNNAQGEYYLTDVIAAAHDEGRAVEAVHPVNPIEVEGVNDRAQLARLERAFQ 237

Query: 243 SRYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGV---------- 286
           S   ++++  GV +  P    L        D  I  + +IE  V  G  V          
Sbjct: 238 SMQAQKLLEQGVMLRDPARFDLRGELQCGMDCEIDTNVIIEGKVTLGDNVIIGTGSVLKD 297

Query: 287 -SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
             I++   IR +S +EG  +G++  +GPF R+R    +  +  +GNF EVK A I EGSK
Sbjct: 298 CEIDDNSVIRPYSVIEGATVGEECTVGPFTRLRPGAEMRNDSHVGNFVEVKNARIGEGSK 357

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
            NHL+Y+GD+ +G+  NIGAGTITCNYDG +K+KT I  + FIGS+S L+AP+TI  G+ 
Sbjct: 358 ANHLTYLGDAEIGQRTNIGAGTITCNYDGANKFKTIIGNDVFIGSDSQLVAPVTIADGST 417

Query: 406 VASGSIITQDTPENSLVFARSRQ 428
           V +G+ +T+D  E  LV  R+++
Sbjct: 418 VGAGTTLTKDVAEGELVITRAKE 440


>gi|293391135|ref|ZP_06635469.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951669|gb|EFE01788.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 456

 Score =  313 bits (801), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 175/456 (38%), Positives = 261/456 (57%), Gaps = 30/456 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT-RINF 66
           ++LAAG+G RM S   KVL  IAGKPM+ HV++T    G  N+ LV G+G + I  R+  
Sbjct: 9   VILAAGKGTRMYSDLPKVLHPIAGKPMVKHVIDTAKQLGARNIHLVYGHGGDLIQQRLAG 68

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAMDKI 123
            P   V + +Q  Q GT HA+  A     P + D   ++++YGD PL++  TL+K +   
Sbjct: 69  EP---VNWVLQTEQLGTGHAMQQA----APFFADDENILMLYGDAPLITKDTLEKLI-AA 120

Query: 124 AQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
                IA++    DNP GYGR+L +N  ++ I E+ DA  E+  I   N+G+M  DG   
Sbjct: 121 KPDNGIALLTVVLDNPTGYGRILRENGNVVGIVEQKDANVEQLNIQEVNTGVMVSDGASF 180

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASID-VKEQEVCGCNNRYELSLIENIWQ 242
             WL Q+  N    EYY+TD+I  A  DG  +A++  V   EV G NNR +L+ +E  +Q
Sbjct: 181 KKWLAQLDNNNAQGEYYMTDVIALANRDGCQVAAVQAVDLMEVEGANNRLQLTTLEQYFQ 240

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFF--------------GCGVS- 287
            +  R+++++GV ++ P +  L  +     D  I+ +V                GC ++ 
Sbjct: 241 QKQARELLLAGVMLLDPNSFKLRGELTHGKDVEIDMNVILNGKVRLGNRVKIGAGCVLTN 300

Query: 288 --IENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
             I + V+I+ +S LE   +G    IGPF+R+R    + +N  +GNF E+KKA I +GSK
Sbjct: 301 CDIGDDVEIKPYSVLEEASVGANAAIGPFSRLRPGADLAENTHVGNFVEIKKAYIGKGSK 360

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
           +NHL+YVGD+ +GK+ NIGAG ITCNYDG +K+KT I +N F+GS+S L+AP+TI  G  
Sbjct: 361 VNHLTYVGDAEIGKDCNIGAGVITCNYDGANKFKTTIGDNVFVGSDSQLVAPVTIESGAT 420

Query: 406 VASGSIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + +GS I  D   + LV  R  Q   +D    ++KK
Sbjct: 421 IGAGSTIRYDVKRDELVTTRVPQKHVQDWERPVKKK 456


>gi|86147152|ref|ZP_01065468.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Vibrio sp. MED222]
 gi|85835036|gb|EAQ53178.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Vibrio sp. MED222]
          Length = 452

 Score =  313 bits (801), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 170/445 (38%), Positives = 263/445 (59%), Gaps = 32/445 (7%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG+G RM S++ KVL  +AGKPM+ HV++T    G +N+ LV G+G +++     
Sbjct: 5   AVILAAGKGTRMYSNTPKVLHTLAGKPMVKHVIDTCNGLGAQNINLVYGHGGDQMK---- 60

Query: 67  PPTL---SVEYYIQDCQQGTAHAVLTAQDAIKPGYDD--VIIMYGDVPLVSSHTLKKAMD 121
             TL   SV + +Q  Q GT HAV  A        DD  V+++YGDVPL+S  T++  +D
Sbjct: 61  -ATLAEESVNWALQAEQLGTGHAVDQASAHFA---DDEKVLVLYGDVPLISPETIENLLD 116

Query: 122 KIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
               G  IA++    DNP GYGR++ +N  ++AI E+ DATDE++ I   N+G+M   G 
Sbjct: 117 AQPNG-GIALLTVVLDNPMGYGRIIRRNGPVVAIVEQKDATDEQKLIKEINTGVMVATGG 175

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENI 240
            +  WL  +  +    EYYLTD+I  A  +G+++ ++  V   EV G N+R +L+ +E  
Sbjct: 176 DLKRWLSGLSNDNAQGEYYLTDVIAAAHDEGRAVEAVHPVSPIEVEGVNDRSQLARLERA 235

Query: 241 WQSRYRRQMMISGVTMIAPE------------TVFLSHDTIIQPDTVIEPHVFFGCGV-- 286
           +Q+    +++  GV +  P              V +  + II+    I  +V  G G   
Sbjct: 236 YQAEQADKLLKQGVMLRDPSRFDLRGELQCGMDVEIDTNVIIEGSVSIGDNVVIGTGCVL 295

Query: 287 ---SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG 343
               I++   +R +S +EG  +G+   +GPF R+R    +  N  +GNF E+K   + EG
Sbjct: 296 KDCEIDDNTIVRPYSVIEGATVGEDCTVGPFTRLRPGADMRNNSHVGNFVEMKNTRLGEG 355

Query: 344 SKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQG 403
           SK NHL+Y+GD+ +G+ VN+GAG ITCNYDG +K+KT I ++ F+GS+S LIAP+TIG G
Sbjct: 356 SKANHLTYLGDAEIGQRVNVGAGAITCNYDGANKFKTIIGDDVFVGSDSQLIAPVTIGNG 415

Query: 404 TYVASGSIITQDTPENSLVFARSRQ 428
             V +GS +T+D  EN LV +R+++
Sbjct: 416 ATVGAGSTVTRDVAENELVISRAKE 440


>gi|149911800|ref|ZP_01900404.1| UDP-N-acetylglucosamine pyrophosphorylase [Moritella sp. PE36]
 gi|149805146|gb|EDM65168.1| UDP-N-acetylglucosamine pyrophosphorylase [Moritella sp. PE36]
          Length = 454

 Score =  313 bits (801), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 174/440 (39%), Positives = 261/440 (59%), Gaps = 24/440 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI-TRINF 66
           ++LAAG+G RM+S   KVL  IA KPM+ HV++T+    + ++ LV G+GAE + +RI  
Sbjct: 6   VILAAGKGTRMRSDLPKVLHPIAKKPMVQHVIDTVKQLDVNDIHLVYGHGAELLKSRIKD 65

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQG 126
                +++ +Q  Q GT HAV  A D  K   + ++I+YGDVPL+S  TL        +G
Sbjct: 66  D---KLDWVLQAEQLGTGHAVQQAADQFKAD-EQILILYGDVPLISQETLTHLCQSQPEG 121

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
             I ++    DNP GYGR++   + ++ I E+ DA+ E+ KI+  NSG++  +G     W
Sbjct: 122 -GIGLLTVKLDNPMGYGRIVRDGDTVVGIVEQKDASAEQLKINEVNSGILVANGADFQHW 180

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQSRY 245
           L  +  N    EYYLTD+I  A   G++I ++  +   EV G NNR +L+ +E  +Q   
Sbjct: 181 LSLLDNNNAQGEYYLTDVIALAYKAGRTINAVHPIANIEVEGVNNRMQLAELERAYQQLQ 240

Query: 246 RRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGVSI-------ENYV 292
             ++M  GVTM+ P        V + +D     + +IE  V  G GV+I       + Y+
Sbjct: 241 AYKLMEQGVTMLDPRRFDLRGEVIVGNDVTFDINVIIEGKVTIGRGVTIGANCILKDCYI 300

Query: 293 ----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
               +I+  S +E   IG    +GPFAR+R  T +E +  +GNF E+KK T+ +GSK  H
Sbjct: 301 GDNSEIKPNSIIESATIGADCSVGPFARLRPNTILEDDAHVGNFVELKKTTLGKGSKAGH 360

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           L+Y+GDS++G+NVNIGAGTITCNYDG +K++T I + AFIGS+S LIAP+TIG+   + +
Sbjct: 361 LAYLGDSIIGENVNIGAGTITCNYDGVNKFQTVIEDGAFIGSDSQLIAPVTIGKNATIGA 420

Query: 409 GSIITQDTPENSLVFARSRQ 428
           GS I +D   + LV  R +Q
Sbjct: 421 GSTIARDVAADELVITRVKQ 440


>gi|15603671|ref|NP_246745.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Pasteurella multocida subsp.
           multocida str. Pm70]
 gi|81636473|sp|Q9CK29|GLMU_PASMU RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|12722227|gb|AAK03890.1| GlmU [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 458

 Score =  313 bits (801), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 181/451 (40%), Positives = 267/451 (59%), Gaps = 31/451 (6%)

Query: 1   MKRKRLAIV-LAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAE 59
           MK K L+IV LAAG+G RM S   KVL KIAGKPM+ HV++T+ +   +N+ LV G+G E
Sbjct: 1   MKEKALSIVILAAGKGTRMYSDLPKVLHKIAGKPMVKHVIDTVKSIHAKNIHLVYGHGGE 60

Query: 60  EI-TRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHT 115
            + TR+   P   V + +Q  Q GT HA+  A     P + D   ++++YGD PL+++ T
Sbjct: 61  VMQTRLQDEP---VNWVLQAEQLGTGHAMQQA----APFFADDENILMLYGDGPLITAET 113

Query: 116 LKKAMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGL 175
           L+  +    + + IA++    D+P GYGR++ +N  ++AI E+ DA  E+ KI   N+GL
Sbjct: 114 LQTLIAAKPE-HGIALLTVVLDDPTGYGRIVRENGNVVAIVEQKDANAEQLKIQEINTGL 172

Query: 176 MAIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYEL 234
           +  DG  +  WL Q+  N    EYY+TD+I  A  DG  + ++   +  EV G NNR +L
Sbjct: 173 LVADGKSLKKWLSQLTNNNAQGEYYITDVIALANQDGCQVVAVQASDFMEVEGVNNRQQL 232

Query: 235 SLIENIWQSRYRRQMMISGVTMIAPETV----FLSH--DTIIQPDTVIEPHVFFG----- 283
           + +E  +Q +    ++++GV +  PE       LSH  D  I  + +IE  V  G     
Sbjct: 233 ARLERYYQRKQADNLLLAGVALADPERFDLRGELSHGKDVEIDVNVIIEGKVSLGHRVKI 292

Query: 284 -CGVSIENY-----VQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKK 337
             G  ++N      V+I+ +S LE   +G+   IGPF+R+R  T +  N  IGNF E+KK
Sbjct: 293 GAGCVLKNCQIGDDVEIKPYSVLEEAIVGQAAQIGPFSRLRPGTALADNTHIGNFVEIKK 352

Query: 338 ATIKEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAP 397
           A I  GSK+NHLSYVGD+ VG   NIGAG ITCNYDG +K+KT I +N F+GS+  L+AP
Sbjct: 353 AHIGTGSKVNHLSYVGDAEVGMQCNIGAGVITCNYDGANKFKTIIGDNVFVGSDVQLVAP 412

Query: 398 ITIGQGTYVASGSIITQDTPENSLVFARSRQ 428
           +TI  G  + +G+ +T+D   + LV +R  Q
Sbjct: 413 VTIETGATIGAGTTVTKDVACDELVISRVPQ 443


>gi|294143103|ref|YP_003559081.1| UDP-N-acetylglucosamine pyrophosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Shewanella violacea DSS12]
 gi|293329572|dbj|BAJ04303.1| UDP-N-acetylglucosamine pyrophosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Shewanella violacea DSS12]
          Length = 454

 Score =  312 bits (800), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 170/439 (38%), Positives = 257/439 (58%), Gaps = 22/439 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM+S   KVL  IA K M+ HV++T    G + + LV GYGA+++  +   
Sbjct: 6   VILAAGKGTRMRSDLPKVLHPIAHKSMVQHVIDTAHNVGSDGIQLVYGYGADKLQSVLGE 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HAV  A   I    D V+I+YGDVPL+ + TL+ A+    +  
Sbjct: 66  QQLN--WVLQAEQLGTGHAVAQANKNINDD-DTVLILYGDVPLIQASTLE-ALLMAREDN 121

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            +A++  N  NP GYGR++ +  +++ I E+ DA  E+  I   N+G+MA  G  + DWL
Sbjct: 122 GLAILTVNLPNPTGYGRIVREEGKVVGIVEQKDANAEQLLIQEVNTGIMAAPGKKLKDWL 181

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRYR 246
            Q+  +    EYYLTDI+  A+ DG +I +   +   EV G NNR +L+ +E  +Q+R  
Sbjct: 182 GQLSSDNAQGEYYLTDIVAMAKKDGVAITTAQPESAVEVEGANNRVQLAQLERAYQAREA 241

Query: 247 RQMMISGVTMIAPE------------TVFLSHDTIIQPDTVIEPHVFFGCGV-----SIE 289
            ++M++G  +  P              V +  + IIQ    I  +V  G G       I 
Sbjct: 242 EKLMLAGANLRDPARIDIRGEVSVGMDVMIDINVIIQGKVTIGNNVTIGAGAILIDCEIG 301

Query: 290 NYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
           +  +I+ +S +E   +G K   GPFAR+R    ++ +  +GNF E+KKA + EGSK  HL
Sbjct: 302 DNAEIKPYSIVESAKVGVKASAGPFARLRPGAELKTDAHVGNFVEIKKAVLGEGSKAGHL 361

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+++G  VNIGAGTITCNYDG +K+ T I +N F+GS++ LIAP+TIG+G  + +G
Sbjct: 362 AYIGDALIGAGVNIGAGTITCNYDGANKHLTVIEDNVFVGSDTQLIAPVTIGKGATIGAG 421

Query: 410 SIITQDTPENSLVFARSRQ 428
           S IT +  EN LV  R +Q
Sbjct: 422 STITSNVAENELVITRVKQ 440


>gi|269962670|ref|ZP_06177015.1| UDP-N-acetylglucosamine pyrophosphorylase [Vibrio harveyi 1DA3]
 gi|269832593|gb|EEZ86707.1| UDP-N-acetylglucosamine pyrophosphorylase [Vibrio harveyi 1DA3]
          Length = 453

 Score =  312 bits (800), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 168/446 (37%), Positives = 264/446 (59%), Gaps = 34/446 (7%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG+G RM S+  KVL  +AGKPM  HV++T    G +N+ LV G+G +++ +   
Sbjct: 5   AVILAAGKGTRMYSNMPKVLHTLAGKPMAKHVIDTCTGLGAQNIHLVYGHGGDQMQQ--- 61

Query: 67  PPTLS---VEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAM 120
             TL+   V + +Q  Q GT HAV    D   P ++D   V+++YGDVPL+S+ T++  +
Sbjct: 62  --TLAEEPVNWVLQAEQLGTGHAV----DQASPKFEDDEKVLVLYGDVPLISAETIENLL 115

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
           D    G  IA++    DNP GYGR++ KN  ++AI E+ DA++E++ I  CN+G++   G
Sbjct: 116 DAQPTG-GIALLTVMLDNPMGYGRIIRKNGPVVAIVEQKDASEEQKLIKECNTGVLVATG 174

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIEN 239
             +  WL  +       EYYLTD+I  A  +G+++ ++  V   EV G N+R +L+ +E 
Sbjct: 175 GDLKRWLAGLNNENAQGEYYLTDVIAAAHDEGRAVEAVHPVNAIEVEGVNDRAQLARLER 234

Query: 240 IWQSRYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGV------- 286
            +QS   ++++  GV +  P    L        D  I  + +IE  V  G  V       
Sbjct: 235 AFQSMQAQKLLEQGVMLRDPARFDLRGELQCGMDCEIDANVIIEGKVSLGDNVVIGAGCV 294

Query: 287 ----SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKE 342
                I++   +R +S +EG  +G++  +GPF R+R    +  +  +GNF EVK A I E
Sbjct: 295 LKDCEIDDNTIVRPYSVIEGATVGEECTVGPFTRLRPGAEMRNDSHVGNFVEVKNARIGE 354

Query: 343 GSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQ 402
           GSK NHL+Y+GD+ +G+  NIGAGTITCNYDG +K+KT I  + F+GS+S LIAP+T+  
Sbjct: 355 GSKANHLTYLGDAEIGQRTNIGAGTITCNYDGANKFKTIIGNDVFVGSDSQLIAPVTVAD 414

Query: 403 GTYVASGSIITQDTPENSLVFARSRQ 428
           G  + +G+ +T+D  E  LV +R+++
Sbjct: 415 GATIGAGTTLTKDVAEGELVISRAKE 440


>gi|145631671|ref|ZP_01787434.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate [Haemophilus
           influenzae R3021]
 gi|144982694|gb|EDJ90230.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate [Haemophilus
           influenzae R3021]
          Length = 456

 Score =  312 bits (800), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 169/447 (37%), Positives = 262/447 (58%), Gaps = 23/447 (5%)

Query: 1   MKRKRL-AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAE 59
           M +K L A++LAAG+G RM S   KVL  IAGKPM+ HV++T    G EN+ L+ G+G +
Sbjct: 1   MTKKALSAVILAAGKGTRMYSDLPKVLHTIAGKPMVKHVIDTAHQLGSENIHLIYGHGGD 60

Query: 60  EITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKA 119
            +   ++     V + +Q  Q GTAHAV  A    K   ++++++YGD PL++  TL+K 
Sbjct: 61  LMR--SYLANEQVNWVLQTEQLGTAHAVQQAAPFFKDN-ENIVVLYGDAPLITKETLEKL 117

Query: 120 MDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAID 179
           ++   +   IA++  N DNP GYGR++ +N  ++AI E+ DA  ++  I   N+G+M  D
Sbjct: 118 IEAKPEN-GIALLTVNLDNPTGYGRIIRENGNVVAIVEQKDANADQLNIKEVNTGVMVSD 176

Query: 180 GLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIE 238
           G     WL ++  N    EYYLTD+I  A  D   + ++   +  EV G NNR +L+ +E
Sbjct: 177 GASFKKWLARVGNNNAQGEYYLTDLIALANQDNCQVIAVQATDVMEVEGANNRLQLAALE 236

Query: 239 NIWQSRYRRQMMISGVTMIAP------------ETVFLSHDTIIQPDTVIEPHVFFGCG- 285
             +Q++   ++++ GV +  P            + V +  + II+    +   V  G G 
Sbjct: 237 RYFQNKQASKLLLEGVMIYDPARFDLRGTLEHGKNVEIDVNVIIEGSVKLGDRVKIGVGC 296

Query: 286 ----VSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIK 341
               V I N V+I+ +S LE   +G+K  IGPF+R+R    +     +GNF E+KK+ + 
Sbjct: 297 VLKNVVIGNDVEIKPYSVLEDSVVGEKAAIGPFSRLRPGAELAAETHVGNFVEIKKSIVG 356

Query: 342 EGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIG 401
           +GSK+NHL+YVGDS +G N NIGAG ITCNYDG +K+KT I ++ F+GS++ L+AP+ + 
Sbjct: 357 KGSKVNHLTYVGDSEIGSNCNIGAGVITCNYDGANKFKTIIGDDVFVGSDTQLVAPVKVA 416

Query: 402 QGTYVASGSIITQDTPENSLVFARSRQ 428
            G  + +G+ IT+D  EN LV  R  Q
Sbjct: 417 SGATIGAGTTITRDVGENELVITRVAQ 443


>gi|260553347|ref|ZP_05825961.1| N-acetylglucosamine-1-phosphate uridyltransferase [Acinetobacter
           sp. RUH2624]
 gi|260405184|gb|EEW98682.1| N-acetylglucosamine-1-phosphate uridyltransferase [Acinetobacter
           sp. RUH2624]
          Length = 454

 Score =  312 bits (800), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 179/454 (39%), Positives = 268/454 (59%), Gaps = 24/454 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM+S   KVLQ +AG+P++ HV++T      EN+  + G+G + + +  F 
Sbjct: 6   IILAAGKGTRMRSQLPKVLQPLAGRPLLGHVIKTAKQLLAENIITIYGHGGDHVKQ-TFA 64

Query: 68  PTLSVEYYIQDCQQGTAHAV-LTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQG 126
              ++++  Q  Q GT HAV +T     K G    +I+YGDVPLV   TL++ ++ ++  
Sbjct: 65  QE-NIQWVEQAEQLGTGHAVQMTLPVLPKDGIS--LILYGDVPLVRQTTLEQLVE-VSSK 120

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
             I ++  + DNP GYGR++ ++ +I AI E  DATD +R+I   N+G+  +    + +W
Sbjct: 121 TGIGMITLHVDNPTGYGRIVRQDGKIQAIVEHKDATDAQRQIQEINTGIYCVSNAKLHEW 180

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRY 245
           L ++       EYYLTDI+  A  DG  IASI  +   EV G N+R +L+ +E  +Q + 
Sbjct: 181 LPKLSNENAQGEYYLTDIVAMAVADGLEIASIQPELAFEVEGVNDRLQLAALERDFQQQQ 240

Query: 246 RRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIE------PHVFFGCGVSIENY-- 291
            +++M  GVT   P       ++ + HD  I  + +IE        V  G G  ++N   
Sbjct: 241 AKELMQQGVTFADPARFDLRGSIKVGHDVRIDVNVIIEGDCELGDFVEIGAGCILKNTKI 300

Query: 292 ---VQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
               +++ +S  +G  +G+ T IGPFAR+R    +   V IGNF EVK  TI  GSK NH
Sbjct: 301 AAGTKVQPYSVFDGAIVGENTQIGPFARLRPGAKLANEVHIGNFVEVKNTTIGLGSKANH 360

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
            +Y+GD+ +G + NIGAGTITCNYDG +K+KT I +  FIGSNSSL+AP+TIG G  V +
Sbjct: 361 FTYLGDAEIGADSNIGAGTITCNYDGANKHKTTIGDAVFIGSNSSLVAPVTIGNGATVGA 420

Query: 409 GSIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           GS+IT+D  E SL F R++QI K +     + KK
Sbjct: 421 GSVITKDVAEQSLSFERAQQISKANYQRPQKVKK 454


>gi|322617225|gb|EFY14130.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322619087|gb|EFY15973.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322625154|gb|EFY21982.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322630205|gb|EFY26976.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322634370|gb|EFY31104.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322635254|gb|EFY31969.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322642869|gb|EFY39454.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322645073|gb|EFY41603.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322650421|gb|EFY46833.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322653614|gb|EFY49941.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322661558|gb|EFY57781.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322661640|gb|EFY57859.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322669802|gb|EFY65944.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322671995|gb|EFY68114.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322674994|gb|EFY71080.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322683684|gb|EFY79697.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322686071|gb|EFY82056.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323192012|gb|EFZ77249.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323200506|gb|EFZ85584.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202735|gb|EFZ87772.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323208312|gb|EFZ93253.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323211747|gb|EFZ96580.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323218609|gb|EGA03316.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323220010|gb|EGA04480.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323224781|gb|EGA09046.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323232511|gb|EGA16613.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323235286|gb|EGA19371.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323241074|gb|EGA25111.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323241377|gb|EGA25409.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323248607|gb|EGA32537.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323252094|gb|EGA35954.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323258602|gb|EGA42265.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323262366|gb|EGA45924.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323268203|gb|EGA51679.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323270617|gb|EGA54062.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 451

 Score =  312 bits (800), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 171/452 (37%), Positives = 265/452 (58%), Gaps = 22/452 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++     G   V LV G+G E + +    
Sbjct: 4   VILAAGKGTRMYSDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTLKD 63

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HA+  A        +D++++YGDVPL+S  TL++  D   QG 
Sbjct: 64  DKLN--WVLQAEQLGTGHAMQQAAPFFSDD-EDILMLYGDVPLISVETLQRLRDAKPQG- 119

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    D+P GYGR+  +N ++  I E  DATDE+R+I   N+G++  +G  +  WL
Sbjct: 120 GIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIANGADLKRWL 179

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASID-VKEQEVCGCNNRYELSLIENIWQSRYR 246
            ++  N    EYY+TDII  A  +G+ IA++   +  E  G NNR +LS +E I+Q+   
Sbjct: 180 SKLTNNNAQGEYYITDIIALAYHEGREIAAVHPARISETDGVNNRLQLSRLERIYQAEQA 239

Query: 247 RQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFG------CGVSIENYV-- 292
            ++++SGV +  P    L        D  I  + +IE +V  G       G  I+N V  
Sbjct: 240 EKLLLSGVMLRDPARFDLRGNLAHGRDVEIDANVIIEGNVTLGHRVKIGAGCIIKNSVIG 299

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +I  +S +E  H+     IGPFAR+R    +     +GNF E+KKA + +GSK  HL
Sbjct: 300 DDCEISPYSVVEDAHLEAACTIGPFARLRPGAELLAGAHVGNFVEMKKARLGKGSKAGHL 359

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+G+G  +A+G
Sbjct: 360 TYLGDAEIGDNVNIGAGTITCNYDGANKFKTVIGDDVFVGSDTQLVAPVTVGKGATIAAG 419

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + +T++  +N LV +R  Q+ K+     ++KK
Sbjct: 420 TTVTRNVADNELVLSRVPQVHKQGWQRPVKKK 451


>gi|300721112|ref|YP_003710380.1| bifunctional N-acetyl glucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate acetyl
           transferase [Xenorhabdus nematophila ATCC 19061]
 gi|297627597|emb|CBJ88116.1| bifunctional: N-acetyl glucosamine-1-phosphate uridyltransferase
           (N-terminal); glucosamine-1-phosphate acetyl transferase
           (C-terminal) [Xenorhabdus nematophila ATCC 19061]
          Length = 462

 Score =  312 bits (800), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 168/445 (37%), Positives = 272/445 (61%), Gaps = 34/445 (7%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++T    G +NV LV G+G + + +    
Sbjct: 14  VILAAGKGTRMYSDLPKVLHLLAGKPMVQHVIDTAMELGTQNVHLVYGHGGDLMKQ---- 69

Query: 68  PTLS---VEYYIQDCQQGTAHAVLTAQDAIKPGY---DDVIIMYGDVPLVSSHTLKKAMD 121
            TLS   + + +Q  Q GT HA+  A     P +   +D++I+YGDVPL++  TL + ++
Sbjct: 70  -TLSNQNLNWVLQAEQLGTGHAMQQA----APHFADDEDILILYGDVPLIAKDTLARLIE 124

Query: 122 KIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
              +G  I ++    DNP GYGR++ +N ++  I E+ DAT+E+RKI+  N+G++  +G 
Sbjct: 125 AKPEG-GIGLLTAILDNPTGYGRIIRENGDVTGIIEQKDATEEQRKINEINTGILVANGG 183

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASID-VKEQEVCGCNNRYELSLIENI 240
            +  WL +++ N    EYYLTD+I  A  +G  I ++   +  E+ G NNR +LS +E I
Sbjct: 184 DLKRWLAKLENNNAQGEYYLTDVIALAYKEGCQIKAVHPSRLSEMEGVNNRLQLSALERI 243

Query: 241 WQSRYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG------CGVSI 288
           +QS    +++++GV ++ P       T+    D +I  + +IE HV  G       G  +
Sbjct: 244 YQSEQAEKLLLAGVMLLDPARFDLRGTLVHGRDIVIDTNVIIEGHVTLGNHVHIGSGCIL 303

Query: 289 ENYV-----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG 343
           +N V      I  ++ +E   +  +  +GPFAR+R  T + +   +GNF E+KKA++ +G
Sbjct: 304 KNCVIGDGAVISPYTVIEDSELSTECTVGPFARLRLGTKLAEQAHVGNFVEMKKASLGKG 363

Query: 344 SKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQG 403
           SK  HL+Y+GD+V+G NVNIGAGTITCNYDG +K+KT I ++ F+GS++  +AP+TI +G
Sbjct: 364 SKAGHLTYLGDAVIGDNVNIGAGTITCNYDGANKFKTIIGDDVFVGSDTQFVAPVTIEKG 423

Query: 404 TYVASGSIITQDTPENSLVFARSRQ 428
             + +G+ +T++  EN LV +R +Q
Sbjct: 424 ATIGAGTTVTKNVAENELVISRVKQ 448


>gi|319648574|ref|ZP_08002788.1| glucosamine-1-phosphate N-acetyltransferase [Bacillus sp. BT1B_CT2]
 gi|317389341|gb|EFV70154.1| glucosamine-1-phosphate N-acetyltransferase [Bacillus sp. BT1B_CT2]
          Length = 456

 Score =  312 bits (800), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 177/457 (38%), Positives = 265/457 (57%), Gaps = 22/457 (4%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR 63
           KR A+VLAAG+G RMKS   KVL  + GKPM+ HV++      +E +  ++G+GAE++ +
Sbjct: 3   KRFAVVLAAGQGTRMKSKLYKVLHPVCGKPMVEHVVDEARKLSLEKLVTIVGHGAEDVKK 62

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM-DK 122
                +   EY +Q  Q GTAHAV  A+  +       I++ GD PL+++ T++  + + 
Sbjct: 63  QLGEKS---EYALQAEQLGTAHAVKQAKSILGSEKGTTIVICGDTPLLTAETMEAMLTEH 119

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLI-KNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
             +   + ++   A++P GYGR++  +N ++  I E  DAT+EER +   N+G    D  
Sbjct: 120 QKKAAKVTILTAVAEDPTGYGRIIRNENGDVAKIVEHKDATEEERLVKEINTGTYCFDNE 179

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENI 240
            +   + Q+  + V  EYYL D+IE  +  G+++A+      QE  G N+R  LS  E  
Sbjct: 180 ALFQTIEQVSNDNVQGEYYLPDVIEILKNQGETVAAYQTGNFQETLGVNDRVALSQAEIY 239

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
            + R  ++ M +GV++I P+  ++S + +I  DTVI P       V I     I   S L
Sbjct: 240 MKQRINKRHMQNGVSLIDPDNTYISPEAVIGRDTVIYPGTVIKGRVVIGEDAVIGQNSEL 299

Query: 301 EGVHIGKKTII----------------GPFARIRQETTIEKNVRIGNFCEVKKATIKEGS 344
           E   +G +T+I                GPFA IR ++ I   VRIGNF EVKK+   + S
Sbjct: 300 ENSTVGSRTVIKQSVIVDSEVGDDVTIGPFAHIRPDSKIGNEVRIGNFVEVKKSEFGDRS 359

Query: 345 KINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGT 404
           K +HLSY+GD+ +G +VN+G G+IT NYDG HK+KT I   AFIG NS+L+AP+TIG+G 
Sbjct: 360 KASHLSYIGDAEIGTDVNLGCGSITVNYDGKHKFKTKIENGAFIGCNSNLVAPVTIGEGA 419

Query: 405 YVASGSIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           YVA+GS IT D P  +L  AR+RQ+ KED A ++ KK
Sbjct: 420 YVAAGSTITDDVPGRALSIARARQVNKEDYAENIHKK 456


>gi|153834310|ref|ZP_01986977.1| UDP-N-acetylglucosamine pyrophosphorylase [Vibrio harveyi HY01]
 gi|148869318|gb|EDL68332.1| UDP-N-acetylglucosamine pyrophosphorylase [Vibrio harveyi HY01]
          Length = 453

 Score =  312 bits (800), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 169/446 (37%), Positives = 263/446 (58%), Gaps = 34/446 (7%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG+G RM S+  KVL  +AGKPM  HV++T    G +N+ LV G+G +++ +   
Sbjct: 5   AVILAAGKGTRMYSNMPKVLHTLAGKPMAKHVIDTCTGLGAQNIHLVYGHGGDQMQQ--- 61

Query: 67  PPTLS---VEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAM 120
             TL+   V + +Q  Q GT HAV    D   P ++D   V+++YGDVPL+S+ T++  +
Sbjct: 62  --TLAEEPVNWVLQAEQLGTGHAV----DQASPKFEDDEKVLVLYGDVPLISAETIENLL 115

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
           D    G  IA++    DNP GYGR++ KN  ++AI E+ DAT+E++ I  CN+G++   G
Sbjct: 116 DAQPTG-GIALLTVMLDNPMGYGRIIRKNGPVVAIVEQKDATEEQKLIKECNTGVLVATG 174

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIEN 239
             +  WL  +       EYYLTD+I  A  +G+++ ++  V   EV G N+R +L+ +E 
Sbjct: 175 GDLKRWLAGLNNENAQGEYYLTDVIAAAHDEGRAVEAVHPVNAIEVEGVNDRAQLARLER 234

Query: 240 IWQSRYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGV------- 286
            +QS   ++++  GV +  P    L        D  I  + +IE +V  G  V       
Sbjct: 235 AFQSMQAQKLLEQGVMLRDPARFDLRGELQCGMDCEIDANVIIEGNVSLGDNVVIGAGCV 294

Query: 287 ----SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKE 342
                I++   +R +S +EG  +G++  +GPF R+R    +  +  +GNF EVK A I E
Sbjct: 295 LKDCEIDDNTIVRPYSVIEGATVGEECTVGPFTRLRPGAEMRNDSHVGNFVEVKNARIGE 354

Query: 343 GSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQ 402
           GSK NHL+Y+GD+ +G+  NIGAGTITCNYDG +K+KT I  + F+GS+S L+AP+TI  
Sbjct: 355 GSKANHLTYLGDAEIGQRTNIGAGTITCNYDGANKFKTVIGNDVFVGSDSQLVAPVTIAD 414

Query: 403 GTYVASGSIITQDTPENSLVFARSRQ 428
           G  + +G+ +T+D  E  LV  R ++
Sbjct: 415 GATIGAGTTLTKDVAEGELVITRVKE 440


>gi|148978359|ref|ZP_01814864.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Vibrionales bacterium SWAT-3]
 gi|145962518|gb|EDK27796.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Vibrionales bacterium SWAT-3]
          Length = 452

 Score =  312 bits (800), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 171/445 (38%), Positives = 263/445 (59%), Gaps = 32/445 (7%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG+G RM S++ KVL  +AGKPM+ HV++T    G +N+ LV G+G +++     
Sbjct: 5   AVILAAGKGTRMYSNTPKVLHTLAGKPMVKHVIDTCNGLGAQNIHLVYGHGGDQMK---- 60

Query: 67  PPTL---SVEYYIQDCQQGTAHAVLTAQDAIKPGYDD--VIIMYGDVPLVSSHTLKKAMD 121
             TL   SV + +Q  Q GT HAV  A        DD  V+++YGDVPL+S  T++  +D
Sbjct: 61  -ATLAEESVNWALQAEQLGTGHAVDQASAHFA---DDEKVLVLYGDVPLISPETIENLLD 116

Query: 122 KIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
               G  IA++    DNP GYGR++ +N  ++AI E+ DATDE++ I   N+G+M   G 
Sbjct: 117 AQPNG-GIALLTVVLDNPMGYGRIIRRNGPVVAIVEQKDATDEQKLIKEINTGVMVATGG 175

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENI 240
            +  WL  +  +    EYYLTD+I  A  +G+++ ++  V   EV G N+R +L+ +E  
Sbjct: 176 DLKRWLSGLSNDNAQGEYYLTDVIAAAHDEGRAVEAVHPVSPIEVEGVNDRSQLARLERA 235

Query: 241 WQSRYRRQMMISGVTMIAPE------------TVFLSHDTIIQPDTVIEPHVFFGCGV-- 286
           +Q+    +++  GV +  P              V +  + II+    I  +V  G G   
Sbjct: 236 YQAEQADKLLKQGVMLRDPSRFDLRGELQCGMDVEIDTNVIIEGSVSIGDNVVIGTGCVL 295

Query: 287 ---SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG 343
               I++   IR +S +EG  +G+   +GPF R+R    +  +  +GNF EVK   + EG
Sbjct: 296 KDCEIDDNTVIRPYSVIEGATVGEDCTVGPFTRLRPGADMRNDSHVGNFVEVKNTRLGEG 355

Query: 344 SKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQG 403
           SK NHL+Y+GD+ +G+ VN+GAG ITCNYDG +K+KT I ++ F+GS+S LIAP+TIG G
Sbjct: 356 SKANHLTYLGDAEIGQRVNVGAGAITCNYDGANKFKTIIGDDVFVGSDSQLIAPVTIGNG 415

Query: 404 TYVASGSIITQDTPENSLVFARSRQ 428
             V +GS +T+D  EN LV +R+++
Sbjct: 416 ATVGAGSTVTRDVSENELVISRAKE 440


>gi|172056085|ref|YP_001812545.1| UDP-N-acetylglucosamine pyrophosphorylase [Exiguobacterium
           sibiricum 255-15]
 gi|254798765|sp|B1YGP5|GLMU_EXIS2 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|171988606|gb|ACB59528.1| UDP-N-acetylglucosamine pyrophosphorylase [Exiguobacterium
           sibiricum 255-15]
          Length = 449

 Score =  312 bits (800), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 177/448 (39%), Positives = 253/448 (56%), Gaps = 22/448 (4%)

Query: 5   RLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRI 64
             A++LAAG+G RMKS   KVL  +AGKPM+ HV++ +   G+    +++G+GAE +  +
Sbjct: 3   HFAVILAAGKGTRMKSKLYKVLHPVAGKPMVQHVVDQLTTLGVTRQVVIVGHGAESVKEV 62

Query: 65  NFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIA 124
                 SVEY +Q  Q GT HAV  A+  +       +++ GD PL++S TL+  +   A
Sbjct: 63  ---LGTSVEYALQSEQLGTGHAVQMAEPVLGQEKGSTLVVCGDTPLLTSETLQSLLQHHA 119

Query: 125 Q-GYSIAVVGFNADNPKGYGRLLI-KNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           + G  + V+  +AD+  GYGR++  ++  +  I E  DA  EE  I   N+G    D   
Sbjct: 120 ETGAKVTVLTAHADDATGYGRIVRGEDGNVSKIVEHKDANAEELLIKEINTGTYVFDNEM 179

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIW 241
           + + L Q+K + V  EYYL D+IE A+ DG++IA+      +E  G N+R  L+  E   
Sbjct: 180 LFEALKQVKNDNVQGEYYLPDVIEIAKADGETIAAYAASTFEETIGVNDRVALAQAETSM 239

Query: 242 QSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEP------------HVFFGCGVSIE 289
           + R     M  GVT I P + ++  D +I  DTV+ P                G    I 
Sbjct: 240 RKRTNEHWMRQGVTFIDPASTYIGPDVVIGSDTVLYPGTQLLGNTTIGSECIIGPNSDIR 299

Query: 290 NY-VQIRAF---SYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
           N  V  +A    S +    IG    +GPFA +RQ+  +  N RIGNF EVKK+T  EGSK
Sbjct: 300 NSEVADQAVVRQSVVTDSKIGPAAQVGPFAHLRQQAVLGANTRIGNFVEVKKSTFGEGSK 359

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
             HLSYVGD+ +G NVN+G G+IT NYDGT+K++T I ++AFIG N +LIAP+T+G+   
Sbjct: 360 SAHLSYVGDATIGTNVNLGCGSITVNYDGTNKFQTVIEDDAFIGCNVNLIAPVTVGKNAL 419

Query: 406 VASGSIITQDTPENSLVFARSRQIVKED 433
           VA+GS +T D PEN L  AR RQ  K D
Sbjct: 420 VAAGSTVTDDVPENGLAIARERQTTKPD 447


>gi|257452397|ref|ZP_05617696.1| glucosamine-1-phosphate acetyltransferase [Fusobacterium sp.
           3_1_5R]
 gi|317058940|ref|ZP_07923425.1| glucosamine-1-phosphate acetyltransferase [Fusobacterium sp.
           3_1_5R]
 gi|313684616|gb|EFS21451.1| glucosamine-1-phosphate acetyltransferase [Fusobacterium sp.
           3_1_5R]
          Length = 452

 Score =  312 bits (799), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 163/445 (36%), Positives = 261/445 (58%), Gaps = 22/445 (4%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
            ++LAAG+G RMKS   KVL K+ GKPM+  +++ +     E   L+LGY  EEI     
Sbjct: 5   TLILAAGKGTRMKSDLPKVLHKVNGKPMLHKILDVVNFLQPEENILILGYKREEI----L 60

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMD-KIAQ 125
               +  Y +Q+ Q GT HA+L A++ +K  + D++++YGD PL+   TL++       Q
Sbjct: 61  ATLDTCSYVVQEEQLGTGHAILQAKEKLKDYHGDIMVLYGDTPLLREETLQQLHQYHKEQ 120

Query: 126 GYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMD 185
             +  V+    +NP GYGR+L K  +++ I EE +AT+E++KI   N+G+   D   +  
Sbjct: 121 KATTTVLTAVYENPFGYGRILKKERKVLGIVEEKEATEEQKKIQEVNAGVYCFDSQELWK 180

Query: 186 WLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSR 244
            L +I       EYYLTD++    ++GK++ S ++K+ QE+ G N++ EL+    + + R
Sbjct: 181 ALSKINNKNEKGEYYLTDVLSIQAMEGKTVLSYELKDSQEILGVNSKVELAEANQVLRQR 240

Query: 245 YRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVH 304
             +Q+M +GVT++ P   ++  D  I  DTV+ P V       I    +I   + +    
Sbjct: 241 KNKQLMENGVTLLDPSITYVEEDVKIGQDTVLAPTVILQGKTIIGKKCEILGNTRIIDSQ 300

Query: 305 IGKKTII----------------GPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
           +G   ++                GPFA +R +  ++K V IGNF EVKK+ ++EG K  H
Sbjct: 301 LGDNIVVESSVIEESILEDGVTMGPFAHLRPKAHLKKKVHIGNFVEVKKSVLEEGVKAGH 360

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           L+Y+GD+ VG+  NIGAGTITCNYDG +K+ T+I ++ FIGS+S L+AP+ IG+   + +
Sbjct: 361 LTYLGDAHVGERTNIGAGTITCNYDGVNKFPTNIGKDVFIGSDSMLVAPVNIGENALIGA 420

Query: 409 GSIITQDTPENSLVFARSRQIVKED 433
           GS+IT+D PEN+L   R++QI+K +
Sbjct: 421 GSVITKDVPENALAVERNKQIIKNE 445


>gi|189041394|sp|B0UW09|GLMU_HAES2 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
          Length = 453

 Score =  312 bits (799), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 172/441 (39%), Positives = 258/441 (58%), Gaps = 26/441 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL KIAGKPM+ HV++T        + L+ G+GA+ + +    
Sbjct: 7   VILAAGKGTRMYSDLPKVLHKIAGKPMVKHVIDTAKKLSAAQIHLIYGHGADLLKQ--HL 64

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD--VIIMYGDVPLVSSHTLKKAMDKIAQ 125
               V +  Q  Q GT HA+   Q A+    DD  ++++YGDVPL+S  TL+  + +  +
Sbjct: 65  ADEPVNWVFQSEQLGTGHAM---QQAVPFFQDDENIVMLYGDVPLISKETLECLISQKPE 121

Query: 126 GYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMD 185
              IA++  N DNP GYGR++ +N  + AI E+ DA  E+ KI   N+G+M  DG     
Sbjct: 122 N-GIALLTVNLDNPTGYGRVIRENGTVTAIVEQKDANPEQLKITEVNTGVMVSDGASFRK 180

Query: 186 WLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSR 244
           WL ++  N    EYY+TD+I  A  DG  + ++  K+  EV G NNR +L+ +E  +Q +
Sbjct: 181 WLARLDNNNAQGEYYMTDVIGLANQDGFKVVAVQAKDLMEVEGVNNRLQLANLERHYQRK 240

Query: 245 YRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIE------PHVFFGCGVSIEN-- 290
              +++++GVT   P    L        D  I  + +IE       +VF G G  ++N  
Sbjct: 241 QVEKLLLAGVTFADPARFDLRGELTHGKDVEIDINVIIEGTVRLGNNVFIGAGCVLKNCT 300

Query: 291 ---YVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKIN 347
               V+I+ +S +E   +G    IGPF+R+R    + +N  +GNF E+KKA I +GSK+N
Sbjct: 301 IADNVEIKPYSVIEDAIVGNNAKIGPFSRLRPGAELSENTHVGNFVEIKKAQIGKGSKVN 360

Query: 348 HLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVA 407
           HL+Y+GD+ VG + NIGAG ITCNYDG +K+KT I +N F+GS+S L+AP+TI  G  + 
Sbjct: 361 HLTYIGDAEVGHHCNIGAGVITCNYDGANKFKTLIGDNVFVGSDSQLVAPLTIASGATIG 420

Query: 408 SGSIITQDTPENSLVFARSRQ 428
           +G+ +T+D  EN LV  R  Q
Sbjct: 421 AGTTVTKDVQENELVITRVPQ 441


>gi|197250592|ref|YP_002148797.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|254798791|sp|B5EYZ3|GLMU_SALA4 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|197214295|gb|ACH51692.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
          Length = 456

 Score =  312 bits (799), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 170/452 (37%), Positives = 265/452 (58%), Gaps = 22/452 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++     G   V LV G+G E + +    
Sbjct: 9   VILAAGKGTRMYSDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTLKD 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HA+  A        +D++++YGDVPL+S  TL++  D   QG 
Sbjct: 69  DKLN--WVLQAEQLGTGHAMQQAAPFFSDD-EDILMLYGDVPLISVETLQRLRDAKPQG- 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    D+P GYG +  +N ++  I E  DATDE+R+I   N+G++  +G  +  WL
Sbjct: 125 GIGLLTVKLDDPSGYGHITRENGKVTGIVEHKDATDEQRQIQEINTGILIANGADLKRWL 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASID-VKEQEVCGCNNRYELSLIENIWQSRYR 246
            ++  N    EYY+TDII  A  +G+ IA++   +  E  G NNR +LS +E I+Q+   
Sbjct: 185 SKLTNNNAQGEYYITDIIALAYQEGREIAAVHPARISETDGVNNRLQLSRLERIYQAEQA 244

Query: 247 RQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG------CGVSIENYV-- 292
            ++++SGV +  P       T+    D  I  + +IE +V  G       G  I+N V  
Sbjct: 245 EKLLLSGVMLRDPARFDLRGTLHCGMDVEIDANVIIEGYVTLGHRVKIGAGCIIKNSVIG 304

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +I  +S +E  H+     IGPFAR+R    +     +GNF E+KKA + +GSK  HL
Sbjct: 305 DDCEISPYSVVEDAHLEAACTIGPFARLRPGAELLAGAHVGNFVEMKKARLGKGSKAGHL 364

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+G+G  +A+G
Sbjct: 365 TYLGDAEIGDNVNIGAGTITCNYDGANKFKTVIGDDVFVGSDTQLVAPVTVGKGATIAAG 424

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + +T++  +N LV +R  Q+ K+     ++KK
Sbjct: 425 TTVTRNVADNELVLSRVPQVHKQGWQRPVKKK 456


>gi|113460479|ref|YP_718541.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Haemophilus somnus 129PT]
 gi|119370572|sp|Q0I1G0|GLMU_HAES1 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|112822522|gb|ABI24611.1| UDP-N-acetylglucosamine pyrophosphorylase / glucosamine-1-phosphate
           N-acetyltransferase [Haemophilus somnus 129PT]
          Length = 453

 Score =  312 bits (799), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 172/442 (38%), Positives = 257/442 (58%), Gaps = 28/442 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL KIAGKPM+ HV++T        + L+ G+GA+ + +    
Sbjct: 7   VILAAGKGTRMYSDLPKVLHKIAGKPMVKHVIDTAKKLSAAQIHLIYGHGADLLKQ--HL 64

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAMDKIA 124
               V +  Q  Q GT HA+  A     P + D   ++++YGDVPL+S  TL+  + +  
Sbjct: 65  ADEPVNWVFQSEQLGTGHAMQQA----APFFQDDENIVMLYGDVPLISKETLECLISQKP 120

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
           +   IA++  N DNP GYGR++ +N  + AI E+ DA  E+ KI   N+G+M  DG    
Sbjct: 121 EN-GIALLTVNLDNPTGYGRVIRENGTVTAIVEQKDANPEQLKITEVNTGVMVSDGASFR 179

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQS 243
            WL ++  N    EYY+TD+I  A  DG  + ++  K+  EV G NNR +L+ +E  +Q 
Sbjct: 180 KWLARLDNNNAQGEYYMTDVIGLANQDGLKVVAVQAKDLMEVEGVNNRLQLANLERHFQR 239

Query: 244 RYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIE------PHVFFGCGVSIEN- 290
           +   +++++GVT   P    L        D  I  + +IE       +VF G G  ++N 
Sbjct: 240 KQVEKLLLAGVTFADPARFDLRGELTHGKDVEIDINVIIEGTVRLGNNVFIGAGCVLKNC 299

Query: 291 ----YVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
                V+I+ +S +E   +G    IGPF+R+R    + +N  +GNF E+KKA I +GSK+
Sbjct: 300 TIADNVEIKPYSVIEDAIVGNNAKIGPFSRLRPGAELSENTHVGNFVEIKKAQIGKGSKV 359

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
           NHLSY+GD+ VG + NIGAG ITCNYDG +K+KT I +N F+GS+S L+AP+TI  G  +
Sbjct: 360 NHLSYIGDAEVGHHCNIGAGVITCNYDGANKFKTLIGDNVFVGSDSQLVAPLTIASGATI 419

Query: 407 ASGSIITQDTPENSLVFARSRQ 428
            +G+ +T+D  EN LV  R  Q
Sbjct: 420 GAGTTVTKDVQENELVITRVPQ 441


>gi|325295636|ref|YP_004282150.1| Bifunctional protein glmU [Desulfurobacterium thermolithotrophum
           DSM 11699]
 gi|325066084|gb|ADY74091.1| Bifunctional protein glmU [Desulfurobacterium thermolithotrophum
           DSM 11699]
          Length = 460

 Score =  311 bits (798), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 168/456 (36%), Positives = 268/456 (58%), Gaps = 27/456 (5%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYG---AEEITR 63
           A++LAAG+G R KS   KVL KI GKP++ +V++    AG E + +V+G+     EE  +
Sbjct: 5   AVILAAGKGTRFKSDLPKVLHKILGKPILWYVVKAAKKAGAEEIIVVVGHKKELVEEFLK 64

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKI 123
             FP   +V    Q+ Q GT HAV+ A++ +K     ++++ GD PLV +  +K+  +  
Sbjct: 65  SEFPEVKTV---YQEQQLGTGHAVMCAEELLKDYNKKIVVLNGDTPLVKAEEIKRLAE-- 119

Query: 124 AQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
             G  + + G   DNP GYGR++    EI+ I EE DAT+EE+KI   N+G+ + D   +
Sbjct: 120 VDGDMLVLTG-EIDNPTGYGRVIRDGREILKIVEEKDATEEEKKIKEVNTGIYSFDPKKL 178

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQ 242
            + L +I  N    EYYL D+++  +  G  +  +  ++   V G NNRYELS  E + Q
Sbjct: 179 FEALKEIDNNNAQGEYYLPDVLKVFKCKGWKVVPVATRDFSTVMGVNNRYELSKAEKVLQ 238

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFF--------GCGV-------- 286
            R  + + +SGVT+  PE+ ++  +  I  DT I   ++         GC +        
Sbjct: 239 ERIVKALQLSGVTIHNPESAYIEPEVEIGIDTEIFAPIYIKGKTKIGKGCYLGAFSEIVD 298

Query: 287 -SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
            +I +  ++ + S+++G  +  +T +GPFA++R  T +E + ++G F E K A ++ G+K
Sbjct: 299 STIGDETKVESHSWIKGAVLEPETSVGPFAKLRPGTYLESSAKLGTFVETKNAYLERGAK 358

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
            NHL+Y+GD  +G+N NIGAGTITCNYDG +K+KT I +N F+GSN+  IAP+ +G  + 
Sbjct: 359 ANHLTYLGDCRIGENTNIGAGTITCNYDGFNKWKTEIGKNVFVGSNTLFIAPVKVGNNSI 418

Query: 406 VASGSIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
            A+GS+IT D PEN+L   R++Q+  E  A  +R+K
Sbjct: 419 TAAGSVITSDVPENTLAVGRAKQLNYEGKAERIREK 454


>gi|56418578|ref|YP_145896.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Geobacillus kaustophilus HTA426]
 gi|81558130|sp|Q5L3V0|GLMU_GEOKA RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|56378420|dbj|BAD74328.1| UDP-N-acetylglucosamine pyrophosphorylase [Geobacillus kaustophilus
           HTA426]
          Length = 458

 Score =  311 bits (798), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 183/449 (40%), Positives = 263/449 (58%), Gaps = 24/449 (5%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR 63
           KR A++LAAG+G RMKS   KVL  I GKPM+ HV++ ++  G+E    V+G+GAE++  
Sbjct: 2   KRYAVILAAGQGTRMKSKRYKVLHPICGKPMVQHVIDQVSKLGVEKAIAVVGFGAEQVKE 61

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK- 122
                    EY +Q+ Q GTAHAV+ A   ++      I++ GD PL+++ T++  ++  
Sbjct: 62  ---QLGSQCEYALQEEQLGTAHAVMQAAPHLRGLEGVTIVVCGDTPLITAETMEMLIEHH 118

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNN--EIIAIREENDATDEERKIHYCNSGLMAIDG 180
           +A      V+   AD+P GYGR+ ++N    +  I E  DA+++ER I   N+G    D 
Sbjct: 119 MAAKAKATVLTAIADDPSGYGRI-VRNEAGHVEKIVEHKDASEQERNIREINTGTYCFDN 177

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIEN 239
             +   L ++       EYYLTD+IE  + DG  +++      +E  G N+R  L+  E 
Sbjct: 178 ETLFQALTKVTNQNAQGEYYLTDVIEIIKADGGVVSAYQAPSFEETIGVNDRIALAEAER 237

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLS------HDTIIQPDTVIEPHVFFG--CGVS---- 287
           I ++R  RQ M +GVT+I P + ++S       DT+I P TVIE     G  C +     
Sbjct: 238 IMRARICRQHMKNGVTIIDPASTYISAEAVIGRDTVIYPGTVIEGETVIGEDCVIGPNSE 297

Query: 288 IEN-YVQIRA---FSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG 343
           I+N Y+  R     S      IG    IGPFA IR  + I+  VRIGNF EVKK+T  +G
Sbjct: 298 IKNCYIGHRTSIRHSVAHDSEIGSDVTIGPFAHIRPLSKIDDEVRIGNFVEVKKSTFGKG 357

Query: 344 SKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQG 403
           SK +HLSY+GD+ VG +VN+G G+IT NYDG +K+ T I + AFIG N +LIAP+T+GQG
Sbjct: 358 SKASHLSYIGDAEVGADVNLGCGSITVNYDGVNKHMTKIEDGAFIGCNVNLIAPVTVGQG 417

Query: 404 TYVASGSIITQDTPENSLVFARSRQIVKE 432
            YVA+GS IT D P  +L  AR+RQ+ KE
Sbjct: 418 AYVAAGSTITDDVPGRALAIARARQVNKE 446


>gi|91226240|ref|ZP_01261080.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Vibrio alginolyticus 12G01]
 gi|91189251|gb|EAS75530.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Vibrio alginolyticus 12G01]
          Length = 453

 Score =  311 bits (798), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 170/446 (38%), Positives = 264/446 (59%), Gaps = 34/446 (7%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG+G RM S+  KVL  +AGKPM  HV++T    G +N+ LV G+G +++ +   
Sbjct: 5   AVILAAGKGTRMYSNMPKVLHTLAGKPMAKHVIDTCTGLGAQNIHLVYGHGGDQMQQ--- 61

Query: 67  PPTLS---VEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAM 120
             TL+   V + +Q  Q GT HAV    D   P ++D   V+++YGDVPL+S+ T++  +
Sbjct: 62  --TLAEEPVNWVLQAEQLGTGHAV----DQASPKFEDDEKVLVLYGDVPLISAETIENLL 115

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
           D    G  IA++    DNP GYGR++ KN  ++AI E+ DAT+E+++I   N+G+M   G
Sbjct: 116 DAQPTG-GIALLTVILDNPTGYGRIIRKNGPVVAIVEQKDATEEQKQIKEINTGVMVATG 174

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIEN 239
             +  WL  +  N    EYYLTD+I  A  +G+++ ++  V   EV G N+R +L+ +E 
Sbjct: 175 GDLKRWLSGLNNNNAQGEYYLTDVIAAAHDEGRAVEAVHPVNAIEVEGVNDRAQLARLER 234

Query: 240 IWQSRYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGV------- 286
            +QS   ++++  GV +  P    L        D  I  + +IE +V  G  V       
Sbjct: 235 AFQSMQAQKLLEQGVMLRDPARFDLRGELQCGMDCEIDVNVIIEGNVSLGDNVVIGAGCV 294

Query: 287 ----SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKE 342
                I++   +R +S +EG  +G++  +GPF R+R    +  +  +GNF EVK A I E
Sbjct: 295 LKDCEIDDNTIVRPYSVIEGATVGEECTVGPFTRLRPGAEMRNDSHVGNFVEVKNARIGE 354

Query: 343 GSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQ 402
           GSK NHL+Y+GD+ +G+  NIGAGTITCNYDG +K+KT I  + F+GS+S L+AP+TI  
Sbjct: 355 GSKANHLTYLGDAEIGQRTNIGAGTITCNYDGANKFKTIIGNDVFVGSDSQLVAPVTIAD 414

Query: 403 GTYVASGSIITQDTPENSLVFARSRQ 428
           G  + +G+ +T+D  E  LV  R ++
Sbjct: 415 GATIGAGTTLTKDVEEGELVITRVKE 440


>gi|261417543|ref|YP_003251225.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Geobacillus sp. Y412MC61]
 gi|297528418|ref|YP_003669693.1| UDP-N-acetylglucosamine pyrophosphorylase [Geobacillus sp. C56-T3]
 gi|319765200|ref|YP_004130701.1| UDP-N-acetylglucosamine pyrophosphorylase [Geobacillus sp.
           Y412MC52]
 gi|261374000|gb|ACX76743.1| UDP-N-acetylglucosamine pyrophosphorylase [Geobacillus sp.
           Y412MC61]
 gi|297251670|gb|ADI25116.1| UDP-N-acetylglucosamine pyrophosphorylase [Geobacillus sp. C56-T3]
 gi|317110066|gb|ADU92558.1| UDP-N-acetylglucosamine pyrophosphorylase [Geobacillus sp.
           Y412MC52]
          Length = 458

 Score =  311 bits (798), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 182/450 (40%), Positives = 265/450 (58%), Gaps = 24/450 (5%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR 63
           KR A++LAAG+G RMKS   KVL  + GKPM+ HV++ ++  G+E    V+G+GAE++  
Sbjct: 2   KRYAVILAAGQGTRMKSKWYKVLHPVCGKPMVQHVIDQVSKLGVEKTIAVVGFGAEQVKE 61

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK- 122
                    EY +Q+ Q GTAHAV+ A   ++      I++ GD PL+++ T++  ++  
Sbjct: 62  ---QLGSQCEYALQEEQLGTAHAVMQAAPHLRGLEGVTIVVCGDTPLITAETMETLVEHH 118

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNN--EIIAIREENDATDEERKIHYCNSGLMAIDG 180
           +A      V+   AD+P GYGR+ ++N    +  I E  DA+++ER I   N+G+   D 
Sbjct: 119 MAAKAKATVLTAIADDPSGYGRI-VRNQAGHVEKIVEHKDASEQERNIREINTGIYCFDN 177

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIEN 239
             +   L ++  +    EYYLTD+IE  + DG  +++      +E  G N+R  L+  E 
Sbjct: 178 QTLFQALTKVTNHNAQGEYYLTDVIEIIKADGGVVSAYQAPSFEETIGVNDRIALAEAER 237

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLS------HDTIIQPDTVIEPHVFFG--CGVS---- 287
           I ++R  RQ M +GVT+I P + ++S       DT+I P TVIE     G  C +     
Sbjct: 238 IMRARICRQHMKNGVTIIDPASTYISAEAMIGRDTVIYPGTVIEGETVIGEDCVIGPNSE 297

Query: 288 IEN-YVQIRA---FSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG 343
           I+N Y+  R     S      IG    IGPFA IR  + I+  VRIGNF EVKK+T  +G
Sbjct: 298 IKNCYIGHRTSIRHSVAHDSEIGSDVTIGPFAHIRPLSKIDDEVRIGNFVEVKKSTFGKG 357

Query: 344 SKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQG 403
           SK  HLSY+GD+ VG +VN+G G+IT NYDG +K+ T I + AFIG N +LIAP+T+GQG
Sbjct: 358 SKAPHLSYIGDAEVGADVNLGCGSITVNYDGVNKHMTKIEDGAFIGCNVNLIAPVTVGQG 417

Query: 404 TYVASGSIITQDTPENSLVFARSRQIVKED 433
            YVA+GS IT D P  +L  AR+RQ+ KE+
Sbjct: 418 AYVAAGSTITNDVPGRALAIARARQVNKEN 447


>gi|170718326|ref|YP_001783555.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Haemophilus somnus 2336]
 gi|168826455|gb|ACA31826.1| UDP-N-acetylglucosamine pyrophosphorylase [Haemophilus somnus 2336]
          Length = 460

 Score =  311 bits (798), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 172/441 (39%), Positives = 258/441 (58%), Gaps = 26/441 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL KIAGKPM+ HV++T        + L+ G+GA+ + +    
Sbjct: 14  VILAAGKGTRMYSDLPKVLHKIAGKPMVKHVIDTAKKLSAAQIHLIYGHGADLLKQ--HL 71

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD--VIIMYGDVPLVSSHTLKKAMDKIAQ 125
               V +  Q  Q GT HA+   Q A+    DD  ++++YGDVPL+S  TL+  + +  +
Sbjct: 72  ADEPVNWVFQSEQLGTGHAM---QQAVPFFQDDENIVMLYGDVPLISKETLECLISQKPE 128

Query: 126 GYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMD 185
              IA++  N DNP GYGR++ +N  + AI E+ DA  E+ KI   N+G+M  DG     
Sbjct: 129 N-GIALLTVNLDNPTGYGRVIRENGTVTAIVEQKDANPEQLKITEVNTGVMVSDGASFRK 187

Query: 186 WLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSR 244
           WL ++  N    EYY+TD+I  A  DG  + ++  K+  EV G NNR +L+ +E  +Q +
Sbjct: 188 WLARLDNNNAQGEYYMTDVIGLANQDGFKVVAVQAKDLMEVEGVNNRLQLANLERHYQRK 247

Query: 245 YRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIE------PHVFFGCGVSIEN-- 290
              +++++GVT   P    L        D  I  + +IE       +VF G G  ++N  
Sbjct: 248 QVEKLLLAGVTFADPARFDLRGELTHGKDVEIDINVIIEGTVRLGNNVFIGAGCVLKNCT 307

Query: 291 ---YVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKIN 347
               V+I+ +S +E   +G    IGPF+R+R    + +N  +GNF E+KKA I +GSK+N
Sbjct: 308 IADNVEIKPYSVIEDAIVGNNAKIGPFSRLRPGAELSENTHVGNFVEIKKAQIGKGSKVN 367

Query: 348 HLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVA 407
           HL+Y+GD+ VG + NIGAG ITCNYDG +K+KT I +N F+GS+S L+AP+TI  G  + 
Sbjct: 368 HLTYIGDAEVGHHCNIGAGVITCNYDGANKFKTLIGDNVFVGSDSQLVAPLTIASGATIG 427

Query: 408 SGSIITQDTPENSLVFARSRQ 428
           +G+ +T+D  EN LV  R  Q
Sbjct: 428 AGTTVTKDVQENELVITRVPQ 448


>gi|169634843|ref|YP_001708579.1| bifunctional UDP-N-acetylglucosamine
           pyrophosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Acinetobacter baumannii SDF]
 gi|254798608|sp|B0VPT6|GLMU_ACIBS RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|169153635|emb|CAP02827.1| bifunctional protein [Includes: UDP-N-acetylglucosamine
           pyrophosphorylase (N-acetylglucosamine-1-phosphate
           uridyltransferase); Glucosamine-1-phosphate
           N-acetyltransferase ] [Acinetobacter baumannii]
          Length = 454

 Score =  311 bits (798), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 178/453 (39%), Positives = 264/453 (58%), Gaps = 22/453 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM+S   KVLQ +AG+P++ HV++T      EN+  + G+G + + +  F 
Sbjct: 6   IILAAGKGTRMRSQLPKVLQPLAGRPLLGHVIKTAKQLLAENIITIYGHGGDHVKK-TFA 64

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
              ++++  Q  Q GT HAV      + P     +I+YGDVPL    TL++ ++  +   
Sbjct: 65  QE-NIQWVEQAEQLGTGHAVQMTLPVL-PKDGISLILYGDVPLARQTTLEQLIEA-SNKT 121

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++  + DNP GYGR++ ++ +I AI E  DAT+ +R+I   N+G+  +    + +WL
Sbjct: 122 GIGMITLHVDNPTGYGRIVRQDGKIQAIVEHKDATEAQRQIQEINTGIYCVSNAKLHEWL 181

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRYR 246
            ++       EYYLTDI+  A  DG  IASI  +   EV G N+R +L+ +E  +Q +  
Sbjct: 182 PKLSNENAQGEYYLTDIVAMAVADGLEIASIQPELAFEVEGVNDRLQLAALEREFQKQQA 241

Query: 247 RQMMISGVTMIAPE------TVFLSHDTIIQPDTVIE------PHVFFGCGVSIENYV-- 292
           +++M  GVT   P       TV + HD  I  + +IE        V  G G  ++N    
Sbjct: 242 KELMQQGVTFADPARFDLRGTVKVGHDVRIDVNVIIEGDCELGDFVEIGAGCILKNTTIA 301

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +++A+S  +G  +G+ T IGPFAR+R    +   V IGNF EVK  TI  GSK NH 
Sbjct: 302 AGTKVQAYSVFDGAVVGENTQIGPFARLRPGAKLANEVHIGNFVEVKNTTIGLGSKANHF 361

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G   NIGAGTITCNYDG +K+KT I +  FIGSNSSL+AP+TIG G  V +G
Sbjct: 362 TYLGDAEIGAESNIGAGTITCNYDGANKHKTTIGDAVFIGSNSSLVAPVTIGNGATVGAG 421

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           S+IT+D  E SL F R++QI K +     + KK
Sbjct: 422 SVITKDVAEQSLSFERAQQISKANYQRPQKLKK 454


>gi|300115590|ref|YP_003762165.1| UDP-N-acetylglucosamine pyrophosphorylase [Nitrosococcus watsonii
           C-113]
 gi|299541527|gb|ADJ29844.1| UDP-N-acetylglucosamine pyrophosphorylase [Nitrosococcus watsonii
           C-113]
          Length = 453

 Score =  311 bits (798), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 172/443 (38%), Positives = 260/443 (58%), Gaps = 29/443 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM SS  KVL ++AG+P++SHV+ T      E + +V G+G E +     P
Sbjct: 6   IILAAGQGKRMHSSLPKVLHQLAGRPLLSHVIATARQLNPEQIIVVYGHGGETV-----P 60

Query: 68  PTLS---VEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIA 124
              S   + +  Q+ Q GT HA L     +KPG   ++I+ GDVPLV + TLK+ +  + 
Sbjct: 61  KAFSAADITWIRQELQLGTGHAALQTLPYVKPGAM-LLILSGDVPLVKTETLKRLLVMMD 119

Query: 125 QGYSIAVVGFNADNPKGYGRLLI-KNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
           QG  + ++  +  NP GYGR++  +  ++  I EE DA+ E+R+I   N+G+ AI+  Y+
Sbjct: 120 QG-KVGLLTVDLPNPNGYGRIIRDRVGKVSKIIEEADASPEQRQIREVNTGITAIEARYL 178

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQ 242
              +  +  N    EYYLTDIIE A   G+ +A++   +  EV G N+R +L+ +E ++Q
Sbjct: 179 KQIVPNLSNNNAQGEYYLTDIIEYAATSGEKVAAVSAADPIEVMGINDRQQLAYLERVYQ 238

Query: 243 SRYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGVSIENY----- 291
            R   ++M  GVT+  P    L        D  I  + +IE  V  G GV I  +     
Sbjct: 239 KREAARLMGEGVTLGDPNRFDLRGELVAGEDVFIDINVIIEGKVILGDGVKIGPHCYLRN 298

Query: 292 ------VQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
                 V++ A   +E   I  +  +GPF RIR ET + + V IGNF E+KK+TI++ SK
Sbjct: 299 AVLGKGVEVLANCVIEEATIDARARVGPFTRIRPETRLGEGVHIGNFVEIKKSTIRDNSK 358

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
           +NHLSY+GD+ +GK VNIGAGTITCNYDG  K++T I + AF+GS++ L+AP+ +G G  
Sbjct: 359 VNHLSYIGDTTIGKEVNIGAGTITCNYDGASKHRTIIEDGAFVGSDTQLVAPVKVGAGAT 418

Query: 406 VASGSIITQDTPENSLVFARSRQ 428
           + +G+ IT+D P   L  +R+ Q
Sbjct: 419 IGAGTTITRDAPPGELTLSRAPQ 441


>gi|20808921|ref|NP_624092.1| N-acetylglucosamine-1-phosphate uridyltransferase
           [Thermoanaerobacter tengcongensis MB4]
 gi|81590555|sp|Q8R752|GLMU_THETN RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|20517582|gb|AAM25696.1| N-acetylglucosamine-1-phosphate uridyltransferase (contains
           nucleotidyltransferase and I-patch acetyltransferase
           domains) [Thermoanaerobacter tengcongensis MB4]
          Length = 457

 Score =  311 bits (798), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 177/456 (38%), Positives = 275/456 (60%), Gaps = 25/456 (5%)

Query: 6   LAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRIN 65
           ++++LAAG G RMKS   KV+ K+ GKPM+  V+E    AG + V +V+G+G E +  + 
Sbjct: 5   VSVILAAGLGKRMKSKYPKVVHKVCGKPMVKWVVEAAQEAGSKEVIVVVGHGREMVEEVL 64

Query: 66  FPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMD-KIA 124
                 V+Y  Q  Q GT HAV+ A++ + P    V+I+ GD PL++S TL+K ++  I+
Sbjct: 65  GD---EVKYAYQKVQLGTGHAVMMAEEFL-PLEGMVLILTGDTPLITSDTLRKLVEYHIS 120

Query: 125 QGYSIAVVGFNADNPKGYGRLL-IKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
           +G  + ++    D+P GYGR++  ++  ++ I EE DA++EE+++   NSG+  +D   +
Sbjct: 121 EGNDVTILSSIFDDPTGYGRIIRDESGNVVKIVEEKDASEEEKRVKEINSGMYVVDIAKL 180

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQS 243
              L +I  +    EYYLTD +E  R  G  I ++  + +E+ G N+R +LS  E + + 
Sbjct: 181 RAALKEITNDNAQGEYYLTDAVEIIRNMGGKIGAVVGESEEIIGVNSRVQLSNAEKVMRR 240

Query: 244 RYRRQMMISGVTMIAPETVFLS------HDTIIQPDTVIEPHVFFG--CGV--------- 286
           R   + M +GVT+I P++ ++        DT+I P T+++     G  C +         
Sbjct: 241 RINEKHMENGVTIIDPDSTYIDAEVEIGRDTVILPGTILQGKTKIGEDCEIGPNSRIVDS 300

Query: 287 SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
           +I N   +  +S +    +G    IGPFA IR E+ I+ NV+IG+F E+KK+ I EGSK+
Sbjct: 301 TIGNGCNV-MYSVVLSSSVGNNVKIGPFAHIRPESVIKNNVKIGDFVEIKKSVIDEGSKV 359

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
            HL+YVGD+ +GKNVN+G G+IT NYDG  K+KT I +N F+G N +L+AP+ IG   Y+
Sbjct: 360 PHLTYVGDAELGKNVNMGCGSITVNYDGKQKHKTIIGDNVFVGCNVNLVAPVKIGNNAYI 419

Query: 407 ASGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           A+GS IT+D PE +L  ARSRQ  KE G +  R KK
Sbjct: 420 AAGSTITEDVPEGALAIARSRQTNKE-GWVEERIKK 454


>gi|119370580|sp|Q1GXN2|GLMU_METFK RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
          Length = 458

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 168/453 (37%), Positives = 262/453 (57%), Gaps = 24/453 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM SS  KVL  +AGKP++ HV++T       ++ +V G+G E + +    
Sbjct: 12  VILAAGKGTRMNSSKPKVLHALAGKPVLQHVLDTARRLNPSSIIVVYGFGGEIVPQA--L 69

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
           P   + +  Q  Q GT HA+  A   ++P    +I++ GDVPL++  +  + +    Q  
Sbjct: 70  PADDIIWVKQAEQLGTGHAMQQALPYLEPDARTLILL-GDVPLLTQESCTQLL---TQQA 125

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
           ++ ++  + DNP GYGR++ + + + AI E  DA + +  I   N+G+MA +  ++  WL
Sbjct: 126 ALCLLTVSKDNPSGYGRIVRQGDAVKAIVEHKDAAEAQLAIREVNTGIMAAENTWLATWL 185

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVK-EQEVCGCNNRYELSLIENIWQSRYR 246
            ++      QEYYLTDI+  A  DG+++A++    E +V G N++ +L+ +E ++Q RY 
Sbjct: 186 PRLDNRNAQQEYYLTDIVAMAVADGQAVAAVQSNDEWQVAGINSKQDLAALERVYQGRYA 245

Query: 247 RQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGVSIENYVQIR----- 295
            +++  GVT+  P  + +        D  I    V E  V     V I  Y  IR     
Sbjct: 246 ARLLAKGVTLADPSRIDVRGELTTGRDVEIDVGCVFEGQVTLADNVRIGPYCVIRDATIG 305

Query: 296 ------AFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
                 A+++++G  + +   IGP+AR+R  T +  +  IGNF E+K A +  GSKINHL
Sbjct: 306 AGTTLAAYTHIDGATLAEDCRIGPYARLRPGTVLSDHAHIGNFVELKNAQVDSGSKINHL 365

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           SYVGD+ VGK VNIGAGTITCNYDG +K++T I +NAFIGS+S L+AP+TI  G  +A+G
Sbjct: 366 SYVGDATVGKQVNIGAGTITCNYDGVNKFRTVIEDNAFIGSDSQLVAPVTIKAGATIAAG 425

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           S IT+D P + L  +R RQ   E+     + KK
Sbjct: 426 STITEDAPADKLTMSRVRQFTIENWKRPEKVKK 458


>gi|254509063|ref|ZP_05121166.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Vibrio parahaemolyticus 16]
 gi|219547996|gb|EED25018.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Vibrio parahaemolyticus 16]
          Length = 453

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 168/444 (37%), Positives = 263/444 (59%), Gaps = 30/444 (6%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI-TRIN 65
           A++LAAG+G RM S+  KVL  +AGKPM+ HV++T  + G +N+ LV G+G +++ T + 
Sbjct: 5   AVILAAGKGTRMYSNKPKVLHTLAGKPMVKHVIDTCNSLGAQNIHLVYGHGGDQMQTEL- 63

Query: 66  FPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAMDK 122
                +V + +Q  Q GT HAV    D   P ++D   ++++YGDVPL+S  T++  +D 
Sbjct: 64  --AQENVNWVLQADQLGTGHAV----DQASPQFEDDEKILVLYGDVPLISEETIEGLLDA 117

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
              G  IA++    DNP GYGR++ +N  ++AI E+ DATDE++ I   N+G+M   G  
Sbjct: 118 QPTG-GIALLTVVLDNPMGYGRIVRRNGPVVAIVEQKDATDEQKLIKEINTGVMVATGGD 176

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIW 241
           +  WL  +       EYYLTD+I  A  +G+++ ++  V   EV G N+R +L+ +E  +
Sbjct: 177 LKRWLSGLNNENAQGEYYLTDVIAAAHDEGRAVEAVHPVNPIEVEGVNDRAQLARLERAF 236

Query: 242 QSRYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGV--------- 286
           QS   ++++  GV +  P    L        D  I  + +IE +V  G  V         
Sbjct: 237 QSMQAKKLLEQGVMLRDPARFDLRGELQCGMDCEIDANVIIEGNVSLGDNVVIGTGCVLK 296

Query: 287 --SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGS 344
              I++   IR +S +EG  +G++  +GPF R+R    +  +  +GNF EVK A I EGS
Sbjct: 297 DCEIDDNTVIRPYSVIEGATVGEECTVGPFTRLRPGAEMRNDSHVGNFVEVKNARIGEGS 356

Query: 345 KINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGT 404
           K NHL+Y+GD+ +G+  NIGAGTITCNYDG +K+KT I  + F+GS+S L+AP+TI  G 
Sbjct: 357 KANHLTYLGDAEIGQRTNIGAGTITCNYDGANKFKTMIGNDVFVGSDSQLVAPVTIADGA 416

Query: 405 YVASGSIITQDTPENSLVFARSRQ 428
            + +G+ +T+D  E  LV  R+++
Sbjct: 417 TIGAGTTLTKDVAEGELVITRAKE 440


>gi|156972754|ref|YP_001443661.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Vibrio harveyi ATCC BAA-1116]
 gi|166990440|sp|A7N0Z7|GLMU_VIBHB RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|156524348|gb|ABU69434.1| hypothetical protein VIBHAR_00419 [Vibrio harveyi ATCC BAA-1116]
          Length = 453

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 169/446 (37%), Positives = 262/446 (58%), Gaps = 34/446 (7%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG+G RM S+  KVL  +AGKPM  HV++T    G +N+ LV G+G +++ +   
Sbjct: 5   AVILAAGKGTRMYSNMPKVLHTLAGKPMAKHVIDTCTGLGAQNIHLVYGHGGDQMQQ--- 61

Query: 67  PPTLS---VEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAM 120
             TL+   V + +Q  Q GT HAV    D   P ++D   V+++YGDVPL+S+ T++  +
Sbjct: 62  --TLAEEPVNWVLQAEQLGTGHAV----DQASPKFEDDEKVLVLYGDVPLISAETIENLL 115

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
           D    G  IA++    DNP GYGR++ KN  ++AI E+ +AT+E++ I  CN+G++   G
Sbjct: 116 DAQPTG-GIALLTVMLDNPMGYGRIIRKNGPVVAIVEQKEATEEQKLIKECNTGVLVATG 174

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIEN 239
             +  WL  +       EYYLTD+I  A  +G+++ ++  V   EV G N+R +L+ +E 
Sbjct: 175 GDLKRWLAGLNNENAQGEYYLTDVIAAAHDEGRAVEAVHPVNAIEVEGVNDRAQLARLER 234

Query: 240 IWQSRYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGV------- 286
            +QS   ++++  GV +  P    L        D  I  + VIE  V  G  V       
Sbjct: 235 AFQSMQAQKLLEQGVMLRDPARFDLRGELQCGMDCEIDANVVIEGKVSLGDNVVIGAGCV 294

Query: 287 ----SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKE 342
                I++   +R +S +EG  +G++  +GPF R+R    +  +  +GNF EVK A I E
Sbjct: 295 LKDCEIDDNTVVRPYSVIEGATVGEECTVGPFTRLRPGAEMRNDSHVGNFVEVKNACIGE 354

Query: 343 GSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQ 402
           GSK NHL+Y+GD+ +G+  NIGAGTITCNYDG +K+KT I  + F+GS+S L+AP+TI  
Sbjct: 355 GSKANHLTYLGDAEIGQRTNIGAGTITCNYDGANKFKTVIGNDVFVGSDSQLVAPVTIAD 414

Query: 403 GTYVASGSIITQDTPENSLVFARSRQ 428
           G  + +G+ +T+D  E  LV  R ++
Sbjct: 415 GATIGAGTTLTKDVAEGELVITRVKE 440


>gi|302608248|emb|CBW44473.1| bifunctional: N-acetyl glucosamine-1-phosphate uridyltransferase
           (N-terminal); glucosamine-1-phosphate acetyl transferase
           (C-terminal) [Marinobacter hydrocarbonoclasticus]
          Length = 465

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 172/441 (39%), Positives = 263/441 (59%), Gaps = 25/441 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RMKSS  KVL  +AGK M+ HV++T    G E +  V+G+GA+++ R +  
Sbjct: 18  VILAAGQGSRMKSSLPKVLHPVAGKAMLHHVVDTAKQLGAEKIHTVIGHGADQV-RASLE 76

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
              SV + +Q  Q GT HAV  A  A+ P    V+++YGDVPL    TL+  +  + +  
Sbjct: 77  DD-SVNWVLQTEQLGTGHAVAQALPAL-PDDARVLVLYGDVPLTRKDTLETMVADLDE-R 133

Query: 128 SIAVVGFNADNPKGYGRLLIKNNE--IIAIREENDATDEERKIHYCNSGLMAIDGLYIMD 185
           ++A++  + DNP GYGR+ ++N +  + AI E+ DAT E+++I   N+G++A+   ++  
Sbjct: 134 NLALLTVDMDNPHGYGRI-VRNEQGLVQAIVEQKDATAEQQQIQEVNTGILAVSARHLKQ 192

Query: 186 WLLQIKKNKVSQEYYLTDIIEKARLDGKSIA-SIDVKEQEVCGCNNRYELSLIENIWQSR 244
           WL  +  +    EYYLTDII  A   G S+  S  +   EV G NNR +L+ +E  +Q +
Sbjct: 193 WLPALSNSNAQGEYYLTDIIAMAVDHGLSVTVSQPLNPFEVQGVNNRLQLAELERWYQRQ 252

Query: 245 YRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV------------ 292
              ++M  G ++  P  + +  +  I  D  I+ +  F   VS+ N V            
Sbjct: 253 QAERLMTEGASLADPARIEVRGELTIGNDLWIDVNAVFEGRVSLGNNVVIGPNCVIKDAT 312

Query: 293 -----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKIN 347
                +I+A S +EG  +G    IGPFAR+R  T +  N ++GNF E KKA + EGSKIN
Sbjct: 313 IADGAEIKANSVIEGAVVGANAQIGPFARLRPGTELAANTKVGNFVETKKAVVGEGSKIN 372

Query: 348 HLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVA 407
           HLSYVGD+ +G+NVN+GAGTITCNYDG +K++T + +  F+GSN+SL+AP+ + +   + 
Sbjct: 373 HLSYVGDASLGRNVNVGAGTITCNYDGVNKHQTVLGDGVFVGSNTSLVAPVNVAEQATIG 432

Query: 408 SGSIITQDTPENSLVFARSRQ 428
           +GS IT+D  E  L  AR +Q
Sbjct: 433 AGSTITRDISEGELAVARGKQ 453


>gi|85060394|ref|YP_456096.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Sodalis glossinidius str.
           'morsitans']
 gi|109892121|sp|Q2NQ84|GLMU_SODGM RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|84780914|dbj|BAE75691.1| UDP-N-acetylglucosamine pyrophosphorylase [Sodalis glossinidius
           str. 'morsitans']
          Length = 458

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 165/452 (36%), Positives = 266/452 (58%), Gaps = 20/452 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           +VLAAG+G RM S+  KVL  +AGK M+ HV++T    G   + LV G+G E +      
Sbjct: 9   VVLAAGKGSRMFSTLPKVLHPLAGKAMVQHVIDTAMRLGASRIHLVYGHGGELLRERLAR 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               + + +Q  Q+GT HAV      ++   +DV+I+YGDVPL+S  TL+  +    QG 
Sbjct: 69  QYAPLNWVLQAEQRGTGHAVQQTLTCLRD-EEDVLILYGDVPLISPDTLQCLLAARPQG- 126

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    DNP+GYGR++  N E+  I E+ DA++++R+I   N+G++   G  I  WL
Sbjct: 127 GIGLLTVTLDNPEGYGRIVRLNGEVAGIVEQKDASEQQRQIKEINTGILVAGGEDIKRWL 186

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASID-VKEQEVCGCNNRYELSLIENIWQSRYR 246
            Q+       E+YLTDII  A  +G+ I ++   ++ EV G NNR +L+ +E ++Q    
Sbjct: 187 GQLTNKNAQGEFYLTDIIAMAWHEGRKINAVQPTRQTEVEGVNNRLQLARLERLFQREQA 246

Query: 247 RQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFG--------C---GVSIE 289
            +++++GV +  P+   L        D  I  + ++E  V  G        C    V I 
Sbjct: 247 ERLLLAGVMLSDPDRFDLRGEFRHGQDVSIDTNVILEGQVTLGDRVIIGTGCVLKNVVIG 306

Query: 290 NYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
           + V I  ++ +E   +  ++ +GPFAR+R  + +E++  +GNF E+K+A + +GSK  HL
Sbjct: 307 DDVIISPYTVIEDARVAARSTLGPFARLRPGSELEEDAHVGNFVEMKQARLGKGSKAGHL 366

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           SY+GD+ +G  VNIGAGTITCNYDG +K+KTHI ++ F+GS+S L+AP+TIG+G  + +G
Sbjct: 367 SYLGDAEIGAQVNIGAGTITCNYDGANKHKTHIGDDVFVGSDSQLVAPVTIGRGATIGAG 426

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + +T+D  E  ++ +R RQ    +    ++KK
Sbjct: 427 TTVTRDVAEGEMIISRIRQFPLANWTRPVKKK 458


>gi|315128166|ref|YP_004070169.1| bifunctional: N-acetyl glucosamine-1-phosphate uridyltransferase
           (N-terminal); glucosamine-1-phosphate acetyl transferase
           (C-terminal) [Pseudoalteromonas sp. SM9913]
 gi|315016679|gb|ADT70017.1| bifunctional: N-acetyl glucosamine-1-phosphate uridyltransferase
           (N-terminal); glucosamine-1-phosphate acetyl transferase
           (C-terminal) [Pseudoalteromonas sp. SM9913]
          Length = 452

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 173/439 (39%), Positives = 254/439 (57%), Gaps = 22/439 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM+S+  KVL K+AGKPM+ HV++   A G  +  LV G+G E + +    
Sbjct: 6   VILAAGKGTRMRSALPKVLHKVAGKPMVQHVIDNANALGATSTNLVYGHGGELLQQ--QL 63

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
              +V + +Q  Q GT HAV  A   I    D V+++YGDVPL    TL++ +       
Sbjct: 64  ADNNVNWVLQAEQLGTGHAVAQANPHINDD-DTVLVLYGDVPLTKQSTLERLLAATPMN- 121

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            +AV+  N  NP GYGR+L  + +++ I E+ DA+ E+  I+  N+G+MA++G  +  WL
Sbjct: 122 GLAVLTVNLANPNGYGRMLRVDGKLVGIVEQKDASAEQLLINEVNTGIMAVNGKLLKTWL 181

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSRYR 246
             +  N    EYYLTDI+  A  +G  I S       EV G NNR +L+ +E  +Q+   
Sbjct: 182 GNLSNNNAQGEYYLTDIVAMAHSEGVEITSAQPDHPMEVEGANNRVQLAGLERAYQAWQA 241

Query: 247 RQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIG 306
            ++M++G T+  P  + +  D     D +I+ +V F   V++ N VQI     L+   IG
Sbjct: 242 EELMLNGATLADPARIDVRGDVKTGEDVLIDINVIFEGTVTLGNNVQIGPNCVLKNCSIG 301

Query: 307 KKTII-----------------GPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +I                 GP+AR+R    +E++  IGNF E+KK  + +GSK NHL
Sbjct: 302 DNVVIKANTLIEDASVAAHCTLGPYARLRPGAVMEEDSHIGNFVEMKKTRLGKGSKANHL 361

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           SY+GD+ +G+ VNIGAGTITCNYDG +K KT I +NAFIGSNSSL+AP+ IG    V +G
Sbjct: 362 SYLGDAEIGEKVNIGAGTITCNYDGVNKAKTIIGDNAFIGSNSSLVAPVNIGATATVGAG 421

Query: 410 SIITQDTPENSLVFARSRQ 428
           S+IT    ++ L  AR +Q
Sbjct: 422 SVITNTVADDQLAVARGKQ 440


>gi|91777090|ref|YP_546846.1| UDP-N-acetylglucosamine pyrophosphorylase / glucosamine-1-phosphate
           N-acetyltransferase [Methylobacillus flagellatus KT]
 gi|91711077|gb|ABE51005.1| UDP-N-acetylglucosamine pyrophosphorylase / glucosamine-1-phosphate
           N-acetyltransferase [Methylobacillus flagellatus KT]
          Length = 476

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 168/453 (37%), Positives = 262/453 (57%), Gaps = 24/453 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM SS  KVL  +AGKP++ HV++T       ++ +V G+G E + +    
Sbjct: 30  VILAAGKGTRMNSSKPKVLHALAGKPVLQHVLDTARRLNPSSIIVVYGFGGEIVPQA--L 87

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
           P   + +  Q  Q GT HA+  A   ++P    +I++ GDVPL++  +  + +    Q  
Sbjct: 88  PADDIIWVKQAEQLGTGHAMQQALPYLEPDARTLILL-GDVPLLTQESCTQLL---TQQA 143

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
           ++ ++  + DNP GYGR++ + + + AI E  DA + +  I   N+G+MA +  ++  WL
Sbjct: 144 ALCLLTVSKDNPSGYGRIVRQGDAVKAIVEHKDAAEAQLAIREVNTGIMAAENTWLATWL 203

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVK-EQEVCGCNNRYELSLIENIWQSRYR 246
            ++      QEYYLTDI+  A  DG+++A++    E +V G N++ +L+ +E ++Q RY 
Sbjct: 204 PRLDNRNAQQEYYLTDIVAMAVADGQAVAAVQSNDEWQVAGINSKQDLAALERVYQGRYA 263

Query: 247 RQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGVSIENYVQIR----- 295
            +++  GVT+  P  + +        D  I    V E  V     V I  Y  IR     
Sbjct: 264 ARLLAKGVTLADPSRIDVRGELTTGRDVEIDVGCVFEGQVTLADNVRIGPYCVIRDATIG 323

Query: 296 ------AFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
                 A+++++G  + +   IGP+AR+R  T +  +  IGNF E+K A +  GSKINHL
Sbjct: 324 AGTTLAAYTHIDGATLAEDCRIGPYARLRPGTVLSDHAHIGNFVELKNAQVDSGSKINHL 383

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           SYVGD+ VGK VNIGAGTITCNYDG +K++T I +NAFIGS+S L+AP+TI  G  +A+G
Sbjct: 384 SYVGDATVGKQVNIGAGTITCNYDGVNKFRTVIEDNAFIGSDSQLVAPVTIKAGATIAAG 443

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           S IT+D P + L  +R RQ   E+     + KK
Sbjct: 444 STITEDAPADKLTMSRVRQFTIENWKRPEKVKK 476


>gi|295095357|emb|CBK84447.1| UDP-N-acetylglucosamine pyrophosphorylase /glucosamine-1-phosphate
           N-acetyltransferase [Enterobacter cloacae subsp. cloacae
           NCTC 9394]
          Length = 458

 Score =  311 bits (796), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 169/452 (37%), Positives = 266/452 (58%), Gaps = 22/452 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++     G   V LV G+G + + +    
Sbjct: 11  VILAAGKGTRMYSDLPKVLHTLAGKPMVQHVIDAANELGASQVHLVYGHGGDLLKKTLRD 70

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HA+  A        +D++++YGDVPL+S  TL +  +   QG 
Sbjct: 71  DNLN--WVLQAEQLGTGHAMQQAAPFFADD-EDILMLYGDVPLISVETLTRLREAKPQG- 126

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    D+P GYGR+  +N ++  I E  DATDE+R+I   N+G++  +G  +  WL
Sbjct: 127 GIGLLTVVLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIANGADMKRWL 186

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQSRYR 246
            ++  N    EYY+TDII  A  +G+ IA++   +  E  G NNR +LS +E I+QS   
Sbjct: 187 SRLNNNNAQGEYYITDIIAMAYQEGREIAAVHPARISETDGVNNRLQLSRLERIYQSEQA 246

Query: 247 RQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG------CGVSIENYV-- 292
            +++++GV +  P       T+    D  I  + ++E +V  G       G  I+N V  
Sbjct: 247 EKLLLAGVMLRDPARFDLRGTLTHGRDVEIDTNVILEGNVTLGNRVKIGTGCVIKNSVIG 306

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +I  +S +E  H+     IGPFAR+R    + +   +GNF E+KKA + +GSK  HL
Sbjct: 307 DDCEISPYSVVEDAHLEAACTIGPFARLRPGAELLEGAHVGNFVEMKKARLGKGSKAGHL 366

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+G+G  +A+G
Sbjct: 367 TYLGDAEIGDNVNIGAGTITCNYDGANKFKTIIGDDVFVGSDTQLVAPVTVGKGVTIAAG 426

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + +T+D  EN LV +R  Q+ K+     +++K
Sbjct: 427 TTVTRDVAENELVLSRVPQVSKQGWKRPVKQK 458


>gi|255318077|ref|ZP_05359322.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Acinetobacter radioresistens SK82]
 gi|262380578|ref|ZP_06073732.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Acinetobacter radioresistens SH164]
 gi|255304900|gb|EET84072.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Acinetobacter radioresistens SK82]
 gi|262298024|gb|EEY85939.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Acinetobacter radioresistens SH164]
          Length = 454

 Score =  311 bits (796), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 177/453 (39%), Positives = 263/453 (58%), Gaps = 22/453 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM+S   KVLQ +AG+P++ HV+ET      EN+  + G+G + +      
Sbjct: 6   IILAAGKGTRMRSHLPKVLQPLAGRPLLGHVIETAKKLQAENIITIYGHGGQLVQDAFVE 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               +++  Q  Q GT HAV      + P     +I+YGDVPLV   TL++ ++  ++  
Sbjct: 66  E--KIQWVEQAEQLGTGHAVQMTLPVL-PKEGISLILYGDVPLVRQQTLEQLLEA-SRET 121

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    D P GYGR++ ++ +I AI E  DA+DE+R I+  N+G+  +    +  WL
Sbjct: 122 GIGMITLTVDKPAGYGRIVRESGKIQAIVEHKDASDEQRLINEINTGIYCVSNAKLHQWL 181

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRYR 246
            Q+  + V  EYYLTDI+  A  DG  IASI  +   EV G N+R +LS +E  +Q +  
Sbjct: 182 PQLSNDNVQGEYYLTDIVAMAVADGLEIASIQPELAFEVEGINDRLQLSALERDFQQQQA 241

Query: 247 RQMMISGVTMIAP------------ETVFLSHDTIIQPDTVIEPHVFFGCGVSIENY--- 291
           + +M  GV +I P            + V +  + II+ D  +   V  G G  ++N    
Sbjct: 242 KDLMQQGVHLIDPSRFDLRGTLKAGQDVRIDINVIIEGDCELGDFVEIGAGCVLKNTKIA 301

Query: 292 --VQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +++ +S  E   +G+ T IGPFAR+R    +  +V IGNF EVK  +I  GSK NH 
Sbjct: 302 AGTKVQPYSVFENAVVGENTQIGPFARLRPGAKLGNDVHIGNFVEVKNTSIGTGSKANHF 361

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ VG+N NIGAGTITCNYDG +K+KT I   AF+GSNSSL+AP+ IG G  V +G
Sbjct: 362 TYLGDAEVGENSNIGAGTITCNYDGANKHKTIIGNEAFVGSNSSLVAPVRIGNGATVGAG 421

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           S+IT+D  + SL F R++Q+ KE+     + KK
Sbjct: 422 SVITRDVEDYSLAFERAKQLSKENYQRPQKIKK 454


>gi|325123927|gb|ADY83450.1| bifunctional protein glmU [Acinetobacter calcoaceticus PHEA-2]
          Length = 454

 Score =  311 bits (796), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 177/453 (39%), Positives = 263/453 (58%), Gaps = 22/453 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM+S   KVLQ +AG+P++ HV++T      EN+  + G+G + + +  F 
Sbjct: 6   IILAAGKGTRMRSQLPKVLQPLAGRPLLGHVIQTAKKIHAENIITIYGHGGDHVKQ-TFA 64

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               +++  Q  Q GT HAV      + P     +I+YGDVPLV   TL++ ++ ++   
Sbjct: 65  QE-KIQWVEQAEQLGTGHAVQMTLPVL-PKDGISLILYGDVPLVRQKTLEQLVE-VSSKT 121

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++  + DNP GYGR++ +  +I AI E  DAT+ +R+I   N+G+  +    + +WL
Sbjct: 122 GIGMITLHVDNPTGYGRIVRQEGKIQAIVEHKDATEAQRQIQEINTGIYCVSNAKLHEWL 181

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRYR 246
            ++       EYYLTDI+  A  DG  IASI  +   EV G N+R +L+ +E  +Q +  
Sbjct: 182 PKLSNENAQGEYYLTDIVAMAVADGLEIASIQPELAFEVEGVNDRLQLAALEREFQQQQA 241

Query: 247 RQMMISGVTMIAPE------TVFLSHDTIIQPDTVIE------PHVFFGCGVSIENY--- 291
           +++M  GVT   P       +V + HD  I  + +IE        V  G G  ++N    
Sbjct: 242 KELMQQGVTFADPARFDLRGSVKVGHDVRIDVNVIIEGDCELGDFVEIGAGCILKNTKIA 301

Query: 292 --VQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +++A+S  +G  +G+   IGPFAR+R    +   V IGNF EVK  TI  GSK NH 
Sbjct: 302 AGTKVQAYSVFDGAVVGENAQIGPFARLRPGAKLANEVHIGNFVEVKNTTIGLGSKANHF 361

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G   NIGAGTITCNYDG +K+KT I +  FIGSNSSL+AP+TIG G  V +G
Sbjct: 362 TYLGDAEIGAESNIGAGTITCNYDGANKHKTTIGDAVFIGSNSSLVAPVTIGNGATVGAG 421

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           S+IT+D  E SL F R++QI K +     + KK
Sbjct: 422 SVITKDVAEQSLSFERAQQISKANYQRPQKVKK 454


>gi|157377614|ref|YP_001476214.1| UDP-N-acetylglucosamine pyrophosphorylase [Shewanella sediminis
           HAW-EB3]
 gi|189041296|sp|A8G1W3|GLMU_SHESH RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|157319988|gb|ABV39086.1| UDP-N-acetylglucosamine pyrophosphorylase [Shewanella sediminis
           HAW-EB3]
          Length = 455

 Score =  311 bits (796), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 171/440 (38%), Positives = 261/440 (59%), Gaps = 24/440 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM+S   KVL  IA K M+ HV++T  + G + + LV GYGAE++  +   
Sbjct: 6   VILAAGKGTRMRSELPKVLHPIAHKSMVQHVIDTAHSVGSDAIQLVYGYGAEKLQSVLGE 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD-VIIMYGDVPLVSSHTLKKAMDKIAQG 126
             L+  + +Q  Q GT HAV  A D I  G DD V+I+YGDVPL+ + TL+ A+    + 
Sbjct: 66  QQLN--WVLQAEQLGTGHAVAQANDNI--GDDDTVLILYGDVPLIQASTLE-ALLAARED 120

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
             +A++  N  NP GYGR++ + N+++ I E+ DA+ E+  I+  N+G+MA  G  +  W
Sbjct: 121 NGLAILTVNLANPMGYGRIVREANKVVGIVEQKDASAEQLAINEINTGIMAAPGKQLKAW 180

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRY 245
           L Q+  +    EYYLTDI+  A  DG  I +   +   EV G NNR +L+ +E  +Q+R 
Sbjct: 181 LGQLSSDNAQGEYYLTDIVAMAHKDGVEITTAQPESAIEVEGANNRVQLAQLERAYQARA 240

Query: 246 RRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV------------- 292
             ++M+ G  +  P  + +  D  +  D +I+ +V     V+I N V             
Sbjct: 241 AEKLMLEGANLRDPARLDIRGDVTVGMDVMIDINVIIQGKVTIGNNVTIGAGAILIDCEI 300

Query: 293 ----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
               +I+ +S +E   +G +   GPFAR+R    ++++  IGNF E+KKA + EGSK  H
Sbjct: 301 GDNAEIKPYSIVENAKLGVEASAGPFARLRPGAELKRDAHIGNFVEMKKAVLGEGSKAGH 360

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           L+Y+GD+ +G  VNIGAGTITCNYDG +K+ T I +N F+GS++ L+AP+TIG+G  + +
Sbjct: 361 LAYIGDAQIGCGVNIGAGTITCNYDGANKHLTVIEDNVFVGSDTQLVAPVTIGKGATLGA 420

Query: 409 GSIITQDTPENSLVFARSRQ 428
           GS IT +  E  LV  R +Q
Sbjct: 421 GSTITSNVAEGELVITRVKQ 440


>gi|88797075|ref|ZP_01112665.1| UDP-N-acetylglucosamine pyrophosphorylase [Reinekea sp. MED297]
 gi|88779944|gb|EAR11129.1| UDP-N-acetylglucosamine pyrophosphorylase [Reinekea sp. MED297]
          Length = 452

 Score =  311 bits (796), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 170/441 (38%), Positives = 257/441 (58%), Gaps = 24/441 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           +VLAAG+G RMKS   KVL ++AG P+ +HV+ T A     ++++V+G+GAEE+ +  + 
Sbjct: 6   VVLAAGQGSRMKSKQPKVLHRLAGIPLAAHVINT-ARQFTSDISMVIGHGAEEVRQ--YF 62

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               +++ +Q  Q GT HAV  A   + P    V+I+YGDVPL    TL   + K+ Q +
Sbjct: 63  DDQQIKFCVQSEQLGTGHAVAQALPEL-PKAGAVLILYGDVPLTKPETLTVLVSKVGQ-H 120

Query: 128 SIAVVGFNADNPKGYGRLLIKNN-EIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
           S+ ++  N  +P GYGR++  +   +  I E  DA  E+ K+   NSG++A+    + +W
Sbjct: 121 SMGLLTVNVADPTGYGRIIRDHGGNVQKIVEHKDADTEQLKVKEINSGIIAVPAWMLHEW 180

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQSRY 245
           L ++  N    EYYLTD+I  A  DG ++ ++    E+E  G NNR +L+ +E  +Q + 
Sbjct: 181 LPRLSNNNAQGEYYLTDLIAMAVADGVAVQTVHPCDEEETLGVNNRIQLAELERWYQLQV 240

Query: 246 RRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIR---- 295
             Q+M +GVT+  P       T+    D  I  + V E  V  G  V I +   IR    
Sbjct: 241 ADQLMTNGVTLQDPNRIDVRGTLTTGEDCWIDVNCVFEGDVTLGDNVVIRSNCLIRNATI 300

Query: 296 -------AFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
                  A S +E   IG    +GP+AR+R  T +E   ++GNF E KKA I  GSK+NH
Sbjct: 301 ASGSVIEANSVIEDARIGDNATVGPYARLRPGTELEAGAKVGNFVETKKAYIGAGSKVNH 360

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           LSY+GD+ VG   NIGAGTITCNYDG +K++T I   AF+GSNS+L+AP+T+  G ++ +
Sbjct: 361 LSYIGDTTVGNGANIGAGTITCNYDGVNKHQTQIGHGAFVGSNSTLVAPVTVEDGAFIGA 420

Query: 409 GSIITQDTPENSLVFARSRQI 429
           GS++T+  P + L   R+RQ+
Sbjct: 421 GSVLTKTAPADQLTVGRARQV 441


>gi|326625593|gb|EGE31938.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 451

 Score =  311 bits (796), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 170/452 (37%), Positives = 265/452 (58%), Gaps = 22/452 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++     G   V LV G+G E + +    
Sbjct: 4   VILAAGKGTRMYSDIPKVLHTLAGKPMVQHVIDAATKLGAAQVHLVYGHGGELLKQTLKD 63

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HA+  A        +D++++YGDVPL+S  TL++  D   QG 
Sbjct: 64  DKLN--WVLQAEQLGTGHAMQQAAPFFSDD-EDILMLYGDVPLISVETLQRLRDAKPQG- 119

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++     +P GYGR+  +N ++  I E  DATDE+R+I   N+G++  +G  +  WL
Sbjct: 120 GIGLLTVKLGDPSGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIANGADLKRWL 179

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQSRYR 246
            ++  N    EYY+TDII  A  +G+ IA++   +  E  G NNR +LS +E I+Q+   
Sbjct: 180 SKLTNNNAQGEYYITDIIALAYQEGREIAAVHPARISETDGVNNRLQLSRLERIYQAEQA 239

Query: 247 RQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG------CGVSIENYV-- 292
            ++++SGV +  P       T+    D  I  + +IE +V  G       G  I+N V  
Sbjct: 240 EKLLLSGVMLRDPARFDLRGTLHCGMDVEIDANVIIEGYVTLGHRVKIGAGCIIKNSVIG 299

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +I  +S +E  H+     IGPFAR+R    +     +GNF E+KKA + +GSK  HL
Sbjct: 300 DDCEISPYSVVEDAHLEAACTIGPFARLRPGAELLAGAHVGNFVEMKKARLGKGSKAGHL 359

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+G+G  +A+G
Sbjct: 360 TYLGDAEIGDNVNIGAGTITCNYDGANKFKTVIGDDVFVGSDTQLVAPVTVGKGATIAAG 419

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + +T++  +N LV +R  Q+ K+     ++KK
Sbjct: 420 TTVTRNVADNELVLSRVPQVHKQGWQRPVKKK 451


>gi|163751426|ref|ZP_02158651.1| UDP-N-acetylglucosamine pyrophosphorylase [Shewanella benthica
           KT99]
 gi|161328729|gb|EDP99877.1| UDP-N-acetylglucosamine pyrophosphorylase [Shewanella benthica
           KT99]
          Length = 460

 Score =  311 bits (796), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 172/445 (38%), Positives = 259/445 (58%), Gaps = 28/445 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM+S   KVL  IA K M+ HV++T    G + + LV GYGA+++  +   
Sbjct: 6   VILAAGKGTRMRSDLPKVLHPIAHKSMVQHVIDTAHNVGSDAIQLVYGYGADKLQSVLGE 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HAV  A   IK   D V+I+YGDVPL+ + TL+ A+    +  
Sbjct: 66  QQLN--WVLQAEQLGTGHAVAQANANIKDD-DTVLILYGDVPLIQAKTLE-ALLMAREAN 121

Query: 128 SIAVVGFNADNPKGYGRLL------IKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
            +A++  N  NP GYGR++       +  +++ I E+ DA  E+  I   N+G+MA  G 
Sbjct: 122 GLAILTVNLPNPTGYGRIVRTPCEGQEQGKVLGIVEQKDANTEQLLIQEVNTGIMAAPGK 181

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENI 240
            + DWL Q+  +    EYYLTDI+  A  DG +I +   +   EV G NNR +L+ +E  
Sbjct: 182 QLKDWLGQLSSDNAQGEYYLTDIVAMAHKDGVAITTAQPESAVEVEGANNRVQLAQLERA 241

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV-------- 292
           +Q+R   ++M++G  +  P  + +  +  +  D +I+ +V     V+I N V        
Sbjct: 242 YQAREAEKLMLAGANLRDPARIDIRGEVTVGMDVMIDINVIIQGRVTIGNNVTIGAGAIL 301

Query: 293 ---------QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG 343
                    +I+ +S +E   +G K   GPFAR+R    ++ +  +GNF E+KKA + EG
Sbjct: 302 IDCEIGDNAEIKPYSIVESAKVGVKASAGPFARLRPGAELKTDAHVGNFVEIKKAVLGEG 361

Query: 344 SKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQG 403
           SK  HLSY+GD+++G  VNIGAGTITCNYDG +K+ T I +N FIGS++ LIAP+TIG+G
Sbjct: 362 SKAGHLSYIGDALIGAGVNIGAGTITCNYDGANKHLTVIEDNVFIGSDTQLIAPVTIGKG 421

Query: 404 TYVASGSIITQDTPENSLVFARSRQ 428
             + +GS IT D  EN LV  R +Q
Sbjct: 422 ATIGAGSTITSDVAENELVITRVKQ 446


>gi|289551702|ref|YP_003472606.1| N-acetylglucosamine-1-phosphate
           uridyltransferase/Glucosamine-1-phosphate
           N-acetyltransferase [Staphylococcus lugdunensis
           HKU09-01]
 gi|289181233|gb|ADC88478.1| N-acetylglucosamine-1-phosphate
           uridyltransferase/Glucosamine-1-phosphate
           N-acetyltransferase [Staphylococcus lugdunensis
           HKU09-01]
          Length = 451

 Score =  311 bits (796), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 179/450 (39%), Positives = 265/450 (58%), Gaps = 26/450 (5%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR 63
           +R AI+LAAG+G RMKS   KVL ++AGKPMI HV+  + A+G++ V  V+G+GA+E+  
Sbjct: 2   QRYAIILAAGKGTRMKSKRYKVLHEVAGKPMIEHVLTNVKASGVDQVVTVVGHGADEVKE 61

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKI 123
                +L   Y  Q  Q GTAHAV TAQD +       +++ GD PL+++ TL+  ++  
Sbjct: 62  TLGHQSL---YSFQAEQLGTAHAVKTAQDHLSSKEGTTLVVCGDTPLITAETLQALIEHH 118

Query: 124 AQGYS-IAVVGFNADNPKGYGRLLIKN--NEIIAIREENDATDEERKIHYCNSGLMAIDG 180
            +  + + V+   A NP GYGR+ I+N   ++  I EE DA+  E+ I   +SG+ A D 
Sbjct: 119 ERNKAHVTVLSATAINPFGYGRI-IRNEQQQLERIVEEKDASAAEKTISEISSGIFAFDN 177

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ--EVCGCNNRYELSLIE 238
             + + L Q++ +    EYYL D +    L    IA +   +   E+ G N+R  LS  E
Sbjct: 178 QVLFETLNQVRNDNAQGEYYLPDAVALI-LHNHGIAEVYHTDDFDEIIGVNDRVMLSQAE 236

Query: 239 NIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFS 298
              Q R     M +GVT+I P   +++ D  I  DTVIEP V      +I   V +  +S
Sbjct: 237 KALQQRVNDYHMRNGVTLIDPTQTYIAPDVEIGMDTVIEPGVRITGTTTIGENVHVGQYS 296

Query: 299 YLEGVHI----------------GKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKE 342
            +    I                G  T +GPFA++R  + + K+V++GNF EVKKA +K+
Sbjct: 297 EIHNSKIAAHVEIKQSVINDSKVGAYTKVGPFAQLRPGSNLGKDVKVGNFVEVKKAELKD 356

Query: 343 GSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQ 402
           G+K++HLSY+GD+ VG+  NIG G+IT NYDG +K++T I  +AFIG N++LIAP+T+G 
Sbjct: 357 GAKVSHLSYIGDAEVGERTNIGCGSITVNYDGINKFRTVIGRDAFIGCNTNLIAPVTVGD 416

Query: 403 GTYVASGSIITQDTPENSLVFARSRQIVKE 432
           G+ +A+GS IT D P +SL  AR+RQI KE
Sbjct: 417 GSLIAAGSTITDDIPNDSLALARARQITKE 446


>gi|90415396|ref|ZP_01223330.1| N-acetylglucosamine-1-phosphate uridyltransferase [marine gamma
           proteobacterium HTCC2207]
 gi|90332719|gb|EAS47889.1| N-acetylglucosamine-1-phosphate uridyltransferase [marine gamma
           proteobacterium HTCC2207]
          Length = 455

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 175/440 (39%), Positives = 262/440 (59%), Gaps = 23/440 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM+S   KVL  +AGKPM++HV++  +     +  +V G+GAE++ R  +P
Sbjct: 7   VILAAGKGTRMRSQLPKVLHTLAGKPMLTHVLDAASEIADAHKIVVAGHGAEKV-RATYP 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
            + +     Q  Q GT HAV    D ++     VII+YGDVPL++  T+ K +D +   +
Sbjct: 66  DS-AFTLVEQSEQLGTGHAVKCVLDNLR-AQAKVIILYGDVPLITPATISKMLDAVDDEH 123

Query: 128 SIAVVGFNADNPKGYGRLLIKN-NEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
            IA++     +P GYGR++  +  +I AI E+ DA   + +I   N+G+MA+    +  W
Sbjct: 124 -IALLTIELADPSGYGRIIRDSAGQIEAIVEQKDAKPVQLQIPEVNTGVMALTTELLSAW 182

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQSRY 245
           L QI       EYYLTD+I  AR  G S+ S+      EV G N+R +L+ +E ++Q + 
Sbjct: 183 LPQIGNQNAQGEYYLTDLIAIARSAGYSVRSVHPASASEVEGINSRQQLAALERVYQRQL 242

Query: 246 RRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGV-----------SI 288
             Q+M SG ++  P        +    D  I  + + E  V  G  V            I
Sbjct: 243 ADQLMASGTSLADPARFDQRGILNAGSDNFIDVNCLFEGTVSIGSNVRIGPNCQIINSQI 302

Query: 289 ENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
            + V+I+A + +E   IG   ++GPFARIR  T +  N ++GNF E KKA +  GSKINH
Sbjct: 303 GDGVEIKANTVIEQSTIGDHAVLGPFARIRPGTQLGSNTKVGNFVETKKAIVGNGSKINH 362

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           LSYVGD+ +G+NVN+GAGTITCNYDG +K+KT I +N+F+GSNS+LIAP+TIG+  +VA+
Sbjct: 363 LSYVGDAELGENVNVGAGTITCNYDGVNKHKTEIGDNSFVGSNSTLIAPVTIGENGFVAA 422

Query: 409 GSIITQDTPENSLVFARSRQ 428
           GS I+ + PE+ L   R++Q
Sbjct: 423 GSTISSEVPESHLAVGRAKQ 442


>gi|251793579|ref|YP_003008308.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Aggregatibacter aphrophilus NJ8700]
 gi|247534975|gb|ACS98221.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Aggregatibacter aphrophilus NJ8700]
          Length = 455

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 172/443 (38%), Positives = 254/443 (57%), Gaps = 30/443 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT-RINF 66
           ++LAAG+G RM S   KVL  IAGKPM+ HV++T    G  N+ LV G+G + +  R+  
Sbjct: 9   VILAAGKGTRMYSDLPKVLHPIAGKPMVKHVIDTAKQLGAHNIHLVYGHGGDLMQQRLAN 68

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAMDKI 123
            P   V + +Q  Q GT HA+  A     P + D   ++++YGD PL++  TL+K +   
Sbjct: 69  EP---VNWVLQTEQLGTGHAMQQA----APFFADDENILMLYGDAPLITKATLEKLI-AA 120

Query: 124 AQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
                IA++    DNP GYGR+L +   ++ I E+ DA  E+ KI   N+G+M  DG   
Sbjct: 121 KPDKGIALLTVVLDNPTGYGRILREKGNVVGIVEQKDANAEQLKIQEVNTGVMVSDGASF 180

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQ 242
             WL Q+  N    EYY+TD+I  A  DG  +A++   +  EV G NNR +L  +E  +Q
Sbjct: 181 KKWLTQLDNNNAQGEYYMTDVIALANRDGCQVAAVQAADLMEVEGANNRLQLVALEQYFQ 240

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFF--------------GCGVS- 287
            +  R+++++GV ++ P +  L        D  I+ +V                GC ++ 
Sbjct: 241 QKQARELLLAGVMLLDPNSFKLRGKLTHGKDVEIDMNVILKGKVRLGNRVKIGAGCVLTN 300

Query: 288 --IENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
             I + V+I+ +S LE   +G    IGPF+R+R  T + +N  +GNF E+KKA I +GSK
Sbjct: 301 CDIGDDVEIKPYSVLEDTSVGANAAIGPFSRLRPGTELAENTHVGNFVEIKKAQIGKGSK 360

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
           +NHL+YVGD+ +GK+ NIGAG ITCNYDG +K+KT I +N FIGS+S L+AP+TI  G  
Sbjct: 361 VNHLTYVGDAEIGKDCNIGAGVITCNYDGANKFKTIIGDNVFIGSDSQLVAPVTIESGAT 420

Query: 406 VASGSIITQDTPENSLVFARSRQ 428
           + +GS I  D   + LV  R  Q
Sbjct: 421 IGAGSTIRDDVRHDELVTTRVPQ 443


>gi|323490988|ref|ZP_08096182.1| bifunctional N-acetylglucosamine-1-phosphate uridyltransferase /
           glucosamine-1-phosphate N-acetyltransferase [Planococcus
           donghaensis MPA1U2]
 gi|323395344|gb|EGA88196.1| bifunctional N-acetylglucosamine-1-phosphate uridyltransferase /
           glucosamine-1-phosphate N-acetyltransferase [Planococcus
           donghaensis MPA1U2]
          Length = 457

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 182/457 (39%), Positives = 267/457 (58%), Gaps = 26/457 (5%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG+G RMKS   KVL  + G PM+ HV   +   G+E +  V+G+GAE++ +   
Sbjct: 6   AVILAAGQGTRMKSKLYKVLHPVCGMPMVEHVTSNVEQLGVEKIVTVVGHGAEKVQQQLG 65

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQ- 125
             +   EY +Q  Q GTAHAV      I+      +++ GD PL+   T++  +D+  + 
Sbjct: 66  AKS---EYALQAEQLGTAHAVQQTASLIEGLAGTTLVVCGDTPLIRPETMQALLDQHTET 122

Query: 126 GYSIAVVGFNADNPKGYGRLLIKNNEIIA--IREENDATDEERKIHYCNSGLMAIDGLYI 183
           G    ++   ADNP GYGR+L +N+E I   I E+ DA+ EE+++   N+G    D   +
Sbjct: 123 GAKATILTAIADNPTGYGRIL-RNSEGIVEKIVEQKDASSEEQQVKEINTGTYCFDNEAL 181

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQ 242
            + L  +  + V  EYYL D+IE  +  G+ +A+       E  G N+R  LS  ENI +
Sbjct: 182 FEALKLVSNDNVQGEYYLPDVIEILQKQGEIVAAYATDSFDETLGVNDRVALSQAENIMR 241

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFG--------CGVS------- 287
            R   + M +GV++I P T ++S    I  DT+I P+V           C +S       
Sbjct: 242 KRIAEKHMRAGVSIIDPATAYISAQAEIGADTIIHPNVTIAGDTKIGEDCVISSNSQIVN 301

Query: 288 --IENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
             I +   IR+ S +    IG  T +GPFA +R E+ +  +V+IGNF EVKKA I   SK
Sbjct: 302 SVIGDRTTIRS-SEVYDSSIGTDTAVGPFAHVRPESALGNDVKIGNFVEVKKAEIGNDSK 360

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
           I+HLSY+GD+ VG  VNIG GTIT NYDG +K++T I ++ FIG NS+LIAP+T+G+G+Y
Sbjct: 361 ISHLSYIGDATVGTGVNIGCGTITVNYDGKNKFQTVIEDDTFIGCNSNLIAPVTVGKGSY 420

Query: 406 VASGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           VA+GS I+++ PE+SL  ARSRQ  KE  A  + +KK
Sbjct: 421 VAAGSTISKNVPEDSLAIARSRQENKEGYASKLNRKK 457


>gi|315660334|ref|ZP_07913187.1| UDP-N-acetylglucosamine diphosphorylase [Staphylococcus lugdunensis
           M23590]
 gi|315494623|gb|EFU82965.1| UDP-N-acetylglucosamine diphosphorylase [Staphylococcus lugdunensis
           M23590]
          Length = 451

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 180/450 (40%), Positives = 266/450 (59%), Gaps = 26/450 (5%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR 63
           +R AI+LAAG+G RMKS   KVL ++AGKPMI HV+  + A+G++ V  V+G+GA+E+  
Sbjct: 2   QRYAIILAAGKGTRMKSKRYKVLHEVAGKPMIEHVLTNVKASGVDQVVTVVGHGADEVKE 61

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKI 123
                +L   Y  Q  Q GTAHAV TAQD +       +++ GD PL+++ TL+  ++  
Sbjct: 62  TLGHQSL---YSFQAEQLGTAHAVKTAQDHLSSKEGTTLVVCGDTPLITAETLQALIEHH 118

Query: 124 AQGYS-IAVVGFNADNPKGYGRLLIKN--NEIIAIREENDATDEERKIHYCNSGLMAIDG 180
            +  + + V+   A NP GYGR+ I+N   ++  I EE DA+  E+ I   +SG+ A D 
Sbjct: 119 ERNKAHVTVLSATAINPFGYGRI-IRNEQQQLERIVEEKDASAAEKTISEISSGIFAFDN 177

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ--EVCGCNNRYELSLIE 238
             + + L Q++ +    EYYL D +    L    IA +   +   E+ G N+R  LS  E
Sbjct: 178 QVLFETLNQVRNDNAQGEYYLPDAVALI-LHNHGIAEVYHTDDFDEIIGVNDRVMLSQAE 236

Query: 239 NIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHV------FFGCGVSIENYV 292
              Q R     M +GVT+I P   +++ D  I  DTVIEP V        G  V +  Y 
Sbjct: 237 KALQQRVNDYHMRNGVTLIDPTQTYIAPDVEIGMDTVIEPGVRITGRTTIGENVHVGQYS 296

Query: 293 QIRAF----------SYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKE 342
           +I             S +    +G  T +GPFA++R  + + K+V++GNF EVKKA +K+
Sbjct: 297 EIHNSKIAAHVEIKQSVINDSEVGAYTKVGPFAQLRPGSNLGKDVKVGNFVEVKKAELKD 356

Query: 343 GSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQ 402
           G+K++HLSY+GD+ VG+  NIG G+IT NYDG +K++T I  +AFIG N++LIAP+T+G 
Sbjct: 357 GAKVSHLSYIGDAEVGERTNIGCGSITVNYDGINKFRTVIGRDAFIGCNTNLIAPVTVGD 416

Query: 403 GTYVASGSIITQDTPENSLVFARSRQIVKE 432
           G+ +A+GS IT D P +SL  AR+RQI KE
Sbjct: 417 GSLIAAGSTITDDIPNDSLALARARQITKE 446


>gi|209696441|ref|YP_002264372.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Aliivibrio salmonicida LFI1238]
 gi|254798701|sp|B6EHG2|GLMU_ALISL RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|208010395|emb|CAQ80741.1| bifunctional protein [includes: UDP-N-acetylglucosamine
           pyrophosphorylase (N-acetylglucosamine-1-phosphate
           uridyltransferase); glucosamine-1-phosphate
           N-acetyltransferase] [Aliivibrio salmonicida LFI1238]
          Length = 452

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 172/443 (38%), Positives = 262/443 (59%), Gaps = 28/443 (6%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG+G RM S+  KVL  +AGKPM  HV++T    G +N+ LV G+G +++     
Sbjct: 5   AVILAAGKGTRMYSNKPKVLHTLAGKPMAKHVIDTCEGLGAKNIHLVYGHGGDQMQA--E 62

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAMDKI 123
                V + +Q  Q GT HAV  A     P + D   V+I+YGDVPL+S+ T++  +D  
Sbjct: 63  LGQERVTWVLQAEQLGTGHAVNQA----SPEFSDDEKVLILYGDVPLISTATVENLLDAQ 118

Query: 124 AQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
             G  IA++    DNP GYGR++ +N  +IAI E+ DAT+E++ I   N+G+M   G  +
Sbjct: 119 PTG-GIALLTVVLDNPMGYGRIIRRNGPVIAIVEQKDATEEQKLIKEINTGVMVATGGDL 177

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQ 242
             WL  +K      EYYLTDII  A  +G+++ ++  V   EV G N+R +L+ +E  +Q
Sbjct: 178 KRWLAALKNENAQGEYYLTDIIAAAHDEGRAVEAVHPVSPIEVEGVNDRAQLARLERAYQ 237

Query: 243 SRYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGV---------- 286
           +   ++++  GV +  P    L        D  I  + +IE +V  G  V          
Sbjct: 238 AAQAQKLLEQGVMLRDPSRFDLRGSLQCGMDIEIDVNVIIEGNVTLGDNVVIGAGCVLKD 297

Query: 287 -SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
             I++   IR +S +EG  +G+K  +GPF R+R    +  +  +GNF EVK   + EGSK
Sbjct: 298 CEIDDNTIIRPYSVIEGATVGEKCTVGPFTRLRPGAELCNDAHVGNFVEVKNVRLGEGSK 357

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
            NHL+Y+GD+ +GK VN+GAG ITCNYDG +K+KT I ++ F+GS+S LIAP+TIG G  
Sbjct: 358 ANHLTYLGDAEIGKRVNVGAGVITCNYDGANKFKTIIGDDVFVGSDSQLIAPVTIGNGAT 417

Query: 406 VASGSIITQDTPENSLVFARSRQ 428
           + +GS +T+D  EN L+ +R+++
Sbjct: 418 IGAGSTVTKDVAENELMISRAKE 440


>gi|322417746|ref|YP_004196969.1| UDP-N-acetylglucosamine pyrophosphorylase [Geobacter sp. M18]
 gi|320124133|gb|ADW11693.1| UDP-N-acetylglucosamine pyrophosphorylase [Geobacter sp. M18]
          Length = 457

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 172/460 (37%), Positives = 273/460 (59%), Gaps = 25/460 (5%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           +K  AIVLAAG G RMKS   KV+  +AG PMI   +    AAG+E   LV+G+  E++ 
Sbjct: 2   KKISAIVLAAGMGTRMKSDLVKVMHPVAGPPMIEWPVAAAFAAGVERCVLVVGHQQEKV- 60

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
           R  F     V + +Q  Q GT HAV  A   + P    V+I+ GD PL+S+ +L+  +  
Sbjct: 61  RDYFAGRSEVSFALQAEQLGTGHAVRCAMPEVAPDASTVLILCGDTPLLSAQSLRGMLQA 120

Query: 123 IAQGYS-IAVVGFNADNPKGYGRLLIKNNE--IIAIREENDATDEERKIHYCNSGLMAID 179
             +  + + V+    ++P GYGR+ +K+ E  ++AI EE DA+D ER+I   N+G+  ID
Sbjct: 121 HEESKACVTVMTARLEHPFGYGRI-VKDAEGKVVAITEEKDASDTERQIREVNAGVYCID 179

Query: 180 GLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIE 238
             ++ + + ++  +    EYYLTD++ +A   G +  S  V +  E+ G N+R +++   
Sbjct: 180 RAFLEEAVGKLNNDNAQGEYYLTDVVRQAGAKGLACRSYRVADPLEISGVNDRVQMAEAA 239

Query: 239 NIWQSRYRRQMMISGVTMIAPETVFLSH------DTIIQPDTVIEPHVFFG--CGVS--- 287
            + + R  R++M+SGVTMI P+ V++        D+++ P  V++     G  C +    
Sbjct: 240 AVLRQRINRELMLSGVTMIDPDLVYIDRGVQIGRDSVVYPGAVVKGDTVIGERCQIGQNT 299

Query: 288 ------IENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIK 341
                 I + V ++A S LE   +G +  IGP A +R  T +  +V+IGNF E KKA + 
Sbjct: 300 LIESCRIADDVVVKAGSVLEDASVGPEAAIGPMAHLRPGTELSAHVKIGNFVETKKAFMG 359

Query: 342 EGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIG 401
           EGSK +HL+Y+GD+ +G++VNIG GTITCNYDG  K+KT I +  F+GS+  L+AP+T+G
Sbjct: 360 EGSKASHLTYLGDATIGRDVNIGCGTITCNYDGVRKHKTVIEDGVFVGSDVQLVAPVTVG 419

Query: 402 QGTYVASGSIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + + +A+G+ +T+D P +SL  AR+ Q+ KE    ++RKK
Sbjct: 420 KNSLIAAGTTVTKDVPADSLAIARAPQVNKE--GWTLRKK 457


>gi|294496921|ref|YP_003560621.1| UDP-N-acetylglucosamine pyrophosphorylase [Bacillus megaterium QM
           B1551]
 gi|223899244|gb|ACN23232.1| UDP-N-acetylglucosamine pyrophosphorylase [Bacillus megaterium]
 gi|294346858|gb|ADE67187.1| UDP-N-acetylglucosamine pyrophosphorylase [Bacillus megaterium QM
           B1551]
          Length = 459

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 180/461 (39%), Positives = 275/461 (59%), Gaps = 28/461 (6%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR 63
           KR A++LAAG+G RMKSS  KVL  + GKPM+ HV++ ++   + N+  V+G+GAE++  
Sbjct: 3   KRYAVILAAGQGTRMKSSLYKVLHPVCGKPMVQHVIDQLSRLDLTNLITVVGHGAEKVKS 62

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKI 123
                +L   + +Q+ Q GTAHAV+ A+  +       I++ GD PL+++ T++  +   
Sbjct: 63  HVGDKSL---FALQEEQLGTAHAVMQAESLLAHEKGTTIVVCGDTPLITAETIESLLKHH 119

Query: 124 AQGYSIA-VVGFNADNPKGYGRLLIKNNE--IIAIREENDATDEERKIHYCNSGLMAIDG 180
               ++A ++  +A++P GYGR+ I+N +  +  I E  DAT++ER +   N+G    D 
Sbjct: 120 EATNAMATILTAHAEDPTGYGRI-IRNEQGSVEKIVEHKDATEQERLVQEINTGTYCFDN 178

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIEN 239
             + + L ++  + V  EYYL D+IE  + +G+ I++    +  E  G N+R+ LS  E 
Sbjct: 179 EKLFETLSKVSNDNVQGEYYLPDVIEILKNEGQIISAYQTSDFAETLGVNDRFALSQAEE 238

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLS------HDTIIQPDTVIEPHVFFG--CGVS---- 287
             + R  +Q M++GVT++ P   ++S       DT I P TVI+  V  G  C V     
Sbjct: 239 TMKKRINKQHMLNGVTIVDPSNTYISADAVIGRDTFIYPGTVIQGTVVIGENCEVGPNSE 298

Query: 288 -----IENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKE 342
                I N   IR  S      IG +  IGPFA IR ++ I   VR+GNF E+KKA+  +
Sbjct: 299 IKDCKIGNNTSIR-HSVAHDSEIGHEVTIGPFAHIRPQSLIGDEVRVGNFVEIKKASFGK 357

Query: 343 GSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQ 402
           GSK +HLSY+GD+ VGK VN+G G+IT NYDG +K+ T I + AF+G NS+LIAP+TIG+
Sbjct: 358 GSKASHLSYIGDAEVGKGVNLGCGSITVNYDGKNKFLTKIEDGAFVGCNSNLIAPVTIGE 417

Query: 403 GTYVASGSIITQDTPENSLVFARSRQIVKEDGA--LSMRKK 441
           G YVA+GS +T D P  +L  AR++Q+ KE+ A  L + KK
Sbjct: 418 GAYVAAGSTVTDDVPGKALSIARAKQVNKENYAEKLDINKK 458


>gi|261866990|ref|YP_003254912.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261412322|gb|ACX81693.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 456

 Score =  310 bits (795), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 172/443 (38%), Positives = 255/443 (57%), Gaps = 30/443 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT-RINF 66
           ++LAAG+G RM S   KVL  IAGKPM+ HV++T    G  N+ LV G+G + I  R+  
Sbjct: 9   VILAAGKGTRMYSDLPKVLHPIAGKPMVKHVIDTAKQLGARNIHLVYGHGGDLIQQRLAG 68

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAMDKI 123
            P   V + +Q  Q GT HA+  A     P + D   ++++YGD PL++  TL+K +   
Sbjct: 69  EP---VNWVLQTEQLGTGHAMQQA----APFFADDENILMLYGDAPLITKDTLEKLI-AA 120

Query: 124 AQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
                IA++    DNP GYGR+L +N  ++ I E+ DA  E+  I   N+G+M  DG   
Sbjct: 121 KPDNGIALLTVVLDNPTGYGRILRENGNVVGIVEQKDANVEQLNIQEVNTGVMVSDGASF 180

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASID-VKEQEVCGCNNRYELSLIENIWQ 242
             WL Q+  N    EYY+TD+I  A  DG  +A++  V   EV G NNR +L+ +E  +Q
Sbjct: 181 KKWLAQLDNNNAQGEYYMTDVIALANRDGCQVAAVQAVDLMEVEGANNRLQLTALEQYFQ 240

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFF--------------GCGVS- 287
            +  R+++++GV ++ P +  L  +     D  I+ +V                GC ++ 
Sbjct: 241 QKQARELLLAGVMLLDPNSFKLRGELSHGKDVEIDMNVILNGKVRLGNRVKIGAGCVLTN 300

Query: 288 --IENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
             I + V+I+ +S LE   +G    IGPF+R+R    + +N  +GNF E+KKA I +GSK
Sbjct: 301 CDIGDDVEIKPYSVLEDASVGANAAIGPFSRLRPGADLAENTHVGNFVEIKKAYIGKGSK 360

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
           +NHL+YVGD+ +GK+ NIGAG ITCNYDG +K+KT I +N F+GS+S L+AP+TI  G  
Sbjct: 361 VNHLTYVGDAEIGKDCNIGAGVITCNYDGANKFKTTIGDNVFVGSDSQLVAPVTIESGAT 420

Query: 406 VASGSIITQDTPENSLVFARSRQ 428
           + +GS I  D   + LV  R  Q
Sbjct: 421 IGAGSTIRYDVKRDELVTTRVPQ 443


>gi|120556777|ref|YP_961128.1| UDP-N-acetylglucosamine pyrophosphorylase [Marinobacter aquaeolei
           VT8]
 gi|189041275|sp|A1U7H2|GLMU_MARAV RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|120326626|gb|ABM20941.1| UDP-N-acetylglucosamine pyrophosphorylase / glucosamine-1-phosphate
           N-acetyltransferase [Marinobacter aquaeolei VT8]
          Length = 454

 Score =  310 bits (794), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 172/441 (39%), Positives = 263/441 (59%), Gaps = 25/441 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RMKSS  KVL  +AGK M+ HV++T    G E +  V+G+GA+++ R +  
Sbjct: 7   VILAAGQGSRMKSSLPKVLHPVAGKAMLHHVVDTAKQLGAEKIHTVIGHGADQV-RASLE 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
              SV + +Q  Q GT HAV  A  A+ P    V+++YGDVPL    TL+  +  + +  
Sbjct: 66  DD-SVNWVLQTEQLGTGHAVAQALPAL-PDDARVLVLYGDVPLTRKDTLETMVADLDE-R 122

Query: 128 SIAVVGFNADNPKGYGRLLIKNNE--IIAIREENDATDEERKIHYCNSGLMAIDGLYIMD 185
           ++A++  + DNP GYGR+ ++N +  + AI E+ DAT E+++I   N+G++A+   ++  
Sbjct: 123 NLALLTVDMDNPHGYGRI-VRNEQGLVQAIVEQKDATAEQQQIQEVNTGILAVSASHLKQ 181

Query: 186 WLLQIKKNKVSQEYYLTDIIEKARLDGKSIA-SIDVKEQEVCGCNNRYELSLIENIWQSR 244
           WL  +  +    EYYLTDII  A   G S+  S  +   EV G NNR +L+ +E  +Q +
Sbjct: 182 WLPALSNSNAQGEYYLTDIIAMAVDHGLSVTVSQPLNPFEVQGVNNRLQLAELERWYQRQ 241

Query: 245 YRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV------------ 292
              ++M  G ++  P  + +  +  I  D  I+ +  F   VS+ N V            
Sbjct: 242 QAERLMTEGASLADPARIEVRGELTIGNDLWIDVNAVFEGRVSLGNNVVIGPNCVIKDAT 301

Query: 293 -----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKIN 347
                +I+A S +EG  +G    IGPFAR+R  T +  N +IGNF E KKA + EGSKIN
Sbjct: 302 IADGAEIKANSVIEGAVVGANAQIGPFARLRPGTELAANTKIGNFVETKKAVVGEGSKIN 361

Query: 348 HLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVA 407
           HLSYVGD+ +G+NVN+GAGTITCNYDG +K++T + +  F+GSN+SL+AP+ + +   + 
Sbjct: 362 HLSYVGDASLGRNVNVGAGTITCNYDGVNKHQTVLGDGVFVGSNTSLVAPVNVAEQATIG 421

Query: 408 SGSIITQDTPENSLVFARSRQ 428
           +GS IT+D  +  L  AR +Q
Sbjct: 422 AGSTITRDISKGELAVARGKQ 442


>gi|294624650|ref|ZP_06703321.1| UDP-N-acetylglucosamine pyrophosphorylase [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
 gi|294667257|ref|ZP_06732477.1| UDP-N-acetylglucosamine pyrophosphorylase [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
 gi|292601044|gb|EFF45110.1| UDP-N-acetylglucosamine pyrophosphorylase [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
 gi|292602929|gb|EFF46360.1| UDP-N-acetylglucosamine pyrophosphorylase [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
          Length = 456

 Score =  310 bits (794), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 175/444 (39%), Positives = 253/444 (56%), Gaps = 24/444 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG G RM+SS  KVLQ +AG+PM++HV+ T        + +V G+G +++ +  F 
Sbjct: 8   VILAAGEGKRMRSSLPKVLQPLAGQPMLAHVIATARQLQPAAIHIVYGHGGDQV-QAAFA 66

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               +++  Q  Q GT HAV  A  AI P    V+++YGDVPL+ S +L + +    +  
Sbjct: 67  DQGDLQWAQQREQLGTGHAVQQAMPAI-PDAATVLVLYGDVPLIRSESLLQLLHAPGR-- 123

Query: 128 SIAVVGFNADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
            +AV+     NP GYGR+L     ++ AI E+ DA DE+R+I   N+G++  +   +  W
Sbjct: 124 -MAVLVAELANPTGYGRILRDAEGKVAAIVEQKDANDEQRRIRTINTGILTAESTALRRW 182

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSRY 245
           L  +  +    E+YLTD+   A  D      + V + Q+V G N+ ++L+ +E  WQ R 
Sbjct: 183 LAGLSNDNAQGEFYLTDVFASAAADFTPADMVHVADPQDVEGANDPWQLAQLERAWQLRA 242

Query: 246 RRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV------- 292
            R + + GV M  P       +V +  D  +  D V+E +V  G  V I  +V       
Sbjct: 243 ARTLCLQGVRMADPARVEQRGSVQVGRDVQLDIDVVLEGNVTLGDDVVIGPFVRLRDVTL 302

Query: 293 ----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
               Q+RA S LEGV       IGPFAR+R  T +   V IGNF E KK T+  GSK NH
Sbjct: 303 GAGTQVRAHSDLEGVITEGAVQIGPFARLRPGTVLADGVHIGNFVETKKVTMGVGSKANH 362

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           L+Y+GD+V+G  VNIGAGTITCNYDG +K +T I + AF+GSNS+L+API IG  + + +
Sbjct: 363 LTYLGDAVIGSKVNIGAGTITCNYDGVNKSQTTIGDGAFVGSNSALVAPIEIGANSTIGA 422

Query: 409 GSIITQDTPENSLVFARSRQIVKE 432
           GS+IT D P   L   R+RQ V E
Sbjct: 423 GSVITSDAPAGQLSVTRARQTVVE 446


>gi|119475218|ref|ZP_01615571.1| UDP-N-acetylglucosamine pyrophosphorylase [marine gamma
           proteobacterium HTCC2143]
 gi|119451421|gb|EAW32654.1| UDP-N-acetylglucosamine pyrophosphorylase [marine gamma
           proteobacterium HTCC2143]
          Length = 485

 Score =  310 bits (794), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 178/445 (40%), Positives = 264/445 (59%), Gaps = 34/445 (7%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI-TRINF 66
           I+LAAGRG RM+S   KVL  IAGKPM+ HV++       E + +V+G+GA+ + +R+N 
Sbjct: 37  IILAAGRGTRMRSKLPKVLHAIAGKPMVEHVIDAAKNINAEAIHVVVGHGADLVRSRVN- 95

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTA-----QDAIKPGYDDVIIMYGDVPLVSSHTLKKAMD 121
             +  +++ +Q+ Q GT HAV  A     +DAI      V+++YGDVPLV++ TL  A+ 
Sbjct: 96  --SSDIQWALQEQQLGTGHAVAQAMARVNEDAI------VLVVYGDVPLVATETLA-ALV 146

Query: 122 KIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
             A   +++++    D+P+GYGR++ ++  I AI E+ DA +++  I   N+G++A+   
Sbjct: 147 AAANQTTLSLLTVLLDDPQGYGRIVRRDGSIEAIVEQKDANEDQLAICEVNTGILAVSAA 206

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKS-IASIDVKEQEVCGCNNRYELSLIENI 240
            +  WL Q+  N    EYYLTDII  A  D  + IA       EV G NNR +L+ +E  
Sbjct: 207 KLNQWLPQLSANNAQGEYYLTDIIAMAVADEMAVIAHHPNNAVEVEGVNNRSQLATLERF 266

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQI------ 294
           +Q +   Q+M+ GVT+  P  + +     +  D VI+ +  F   V+I + V I      
Sbjct: 267 YQCQQASQLMLEGVTLADPARIDVRGRMDVGEDIVIDVNCVFIGDVTIGDDVSIGPNCVI 326

Query: 295 -----------RAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG 343
                      +A S LE   +G    +GPFAR+R  T +    +IGNF E KKA I EG
Sbjct: 327 ENSSIGSGSVIKANSVLEDARVGIMCEVGPFARLRPGTDLAAKAKIGNFVETKKAKIGEG 386

Query: 344 SKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQG 403
           SK+NHLSY+GD+ +G   N+GAGTITCNYDG +K+ T+I + AFIGSNSSL+AP+T+G+ 
Sbjct: 387 SKVNHLSYIGDATIGIGANVGAGTITCNYDGVNKFATNIGDGAFIGSNSSLVAPVTVGKN 446

Query: 404 TYVASGSIITQDTPENSLVFARSRQ 428
             VA+GS IT D  ++ L  AR +Q
Sbjct: 447 ATVAAGSTITADVDDDQLGVARGKQ 471


>gi|269965299|ref|ZP_06179420.1| UDP-N-acetylglucosamine pyrophosphorylase [Vibrio alginolyticus
           40B]
 gi|269830100|gb|EEZ84328.1| UDP-N-acetylglucosamine pyrophosphorylase [Vibrio alginolyticus
           40B]
          Length = 453

 Score =  310 bits (793), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 168/446 (37%), Positives = 263/446 (58%), Gaps = 34/446 (7%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG+G RM S+  KVL  +AGKPM  HV++T    G +N+ LV G+G +++ +   
Sbjct: 5   AVILAAGKGTRMYSNMPKVLHTLAGKPMAKHVIDTCTGLGAQNIHLVYGHGGDQMQQ--- 61

Query: 67  PPTLS---VEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAM 120
             TL+   V + +Q  Q GT HAV    D   P ++D   V+++YGDVPL+S+ T++  +
Sbjct: 62  --TLAEEPVNWVLQAEQLGTGHAV----DQASPKFEDDEKVLVLYGDVPLISAETIENLL 115

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
           D    G  IA++    DNP GYGR++ KN  ++AI E+ DAT+E+++I   N+G+M   G
Sbjct: 116 DAQPTG-GIALLTVILDNPTGYGRIIRKNGPVVAIVEQKDATEEQKQIKEINTGVMVATG 174

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIEN 239
             +  WL  +  N    EYYLTD+I  A  +G+++ ++  V   EV G N+R +L+ +E 
Sbjct: 175 GDLKRWLSGLNNNNAQGEYYLTDVIAAAHDEGRAVEAVHPVNAIEVEGVNDRAQLARLER 234

Query: 240 IWQSRYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGV------- 286
            +QS   ++++  GV +  P    L        D  I  + ++E  V  G  V       
Sbjct: 235 AFQSMQAQKLLEQGVMLRDPARFDLRGELQCGMDCEIDVNVIVEGKVSLGDNVVIGAGCV 294

Query: 287 ----SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKE 342
                I++   +R +S +EG  +G++  +GPF R+R    +  +  +GNF EVK A I E
Sbjct: 295 LKDCEIDDNTIVRPYSVIEGATVGEECTVGPFTRLRPGAEMRNDSHVGNFVEVKNARIGE 354

Query: 343 GSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQ 402
           GSK NHL+Y+GD+ +G+  NIGAGTITCNYDG +K++T I  + F+GS+S L+AP+TI  
Sbjct: 355 GSKANHLTYLGDAEIGQRTNIGAGTITCNYDGANKFRTIIGNDVFVGSDSQLVAPVTIAD 414

Query: 403 GTYVASGSIITQDTPENSLVFARSRQ 428
           G  + +G+ +T+D  E  LV  R ++
Sbjct: 415 GATIGAGTTLTKDVEEGELVITRVKE 440


>gi|21244369|ref|NP_643951.1| UDP-N-acetylglucosamine pyrophosphorylase [Xanthomonas axonopodis
           pv. citri str. 306]
 gi|21110027|gb|AAM38487.1| UDP-N-acetylglucosamine pyrophosphorylase [Xanthomonas axonopodis
           pv. citri str. 306]
          Length = 457

 Score =  310 bits (793), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 175/444 (39%), Positives = 253/444 (56%), Gaps = 24/444 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG G RM+SS  KVLQ +AG+PM++HV+ T        + +V G+G +++ +  F 
Sbjct: 9   LILAAGEGKRMRSSLPKVLQPLAGQPMLAHVIATARQLQPAAIHIVYGHGGDQV-QAAFA 67

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               +++  Q  Q GT HAV  A  AI P    V+++YGDVPL+ S +L + +    +  
Sbjct: 68  DQGDLQWAEQREQLGTGHAVQQAMPAI-PDAATVLVLYGDVPLIRSESLLQLLHAPGR-- 124

Query: 128 SIAVVGFNADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
            +AV+     NP GYGR+L     ++ AI E+ DA DE+R+I   N+G++  +   +  W
Sbjct: 125 -MAVLVAELANPTGYGRILRDAEGKVAAIVEQKDANDEQRRIRTINTGILTAESTALRRW 183

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSRY 245
           L  +  +    E+YLTD+   A  D      + V + Q+V G N+ ++L+ +E  WQ R 
Sbjct: 184 LAGLSNDNAQAEFYLTDVFASAAADFTPADMVHVADPQDVEGANDPWQLAQLERAWQLRA 243

Query: 246 RRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV------- 292
            R + + GV M  P       +V +  D  +  D ++E +V  G  V I  +V       
Sbjct: 244 ARTLCLQGVRMADPARVEQRGSVQVGRDVQLDIDVILEGNVTLGDDVVIGPFVRLRDVTL 303

Query: 293 ----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
               Q+RA S LEGV       IGPFAR+R  T +   V IGNF E KK T+  GSK NH
Sbjct: 304 GAGTQVRAHSDLEGVITEGAVQIGPFARLRPGTVLADGVHIGNFVETKKVTMGVGSKANH 363

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           L+Y+GD+V+G  VNIGAGTITCNYDG +K +T I + AFIGSNS+L+API IG  + + +
Sbjct: 364 LTYLGDAVIGSKVNIGAGTITCNYDGVNKSQTTIGDGAFIGSNSALVAPIQIGANSTIGA 423

Query: 409 GSIITQDTPENSLVFARSRQIVKE 432
           GS+IT D P   L   R+RQ V E
Sbjct: 424 GSVITSDAPAGQLSVTRARQTVVE 447


>gi|331001469|ref|ZP_08325087.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Parasutterella excrementihominis
           YIT 11859]
 gi|329568198|gb|EGG50015.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Parasutterella excrementihominis
           YIT 11859]
          Length = 451

 Score =  310 bits (793), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 171/442 (38%), Positives = 267/442 (60%), Gaps = 28/442 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMET---IAAAGIENVALVLGYGAEEITRI 64
           ++LAAG G RM S   KVLQ + GK M+ HV+E    +  AG   + LV+G+G+EE+   
Sbjct: 4   VILAAGLGKRMYSHLPKVLQPVGGKAMLKHVVEAARRLPDAG--KIILVVGHGSEEVKEA 61

Query: 65  NFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIA 124
                  V + +Q  Q+GT HAV  A +AI P  +  +I+YGDVPL+S+ TL  A++K A
Sbjct: 62  M--ADQPVTFVLQKEQKGTGHAVQQALEAINPD-EPTLILYGDVPLISTETLS-ALEKTA 117

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
            G   A++  + DNPKGYGR+L ++ ++I I EE DA++++R I   N+G M +    + 
Sbjct: 118 -GDGFALLTIDLDNPKGYGRILREDGKVIGIVEEKDASEQQRAIKEVNTGFMVLPSKEME 176

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQS 243
            WL  +K +   QEYYLTD++  A  +G+ I +   ++  EV G N++ +L  +E  +Q 
Sbjct: 177 RWLGNLKNDNKQQEYYLTDLVAMAAAEGREIKTFKAQDAWEVEGANSKVQLEGLERAFQL 236

Query: 244 RYRRQMMISGV------------TMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENY 291
           R  ++++  GV            ++   + VF+    I + D V+  +V  G    I+N 
Sbjct: 237 RQAKELLEKGVRLADKNRIDIRGSLTCGKDVFIDVGCIFEGDVVLGDNVVVGPYCVIKNT 296

Query: 292 -----VQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
                  I A+S+ +   +G    IGPFAR+R  T +   V IGNF E+KK+ I +GSK+
Sbjct: 297 KIGDGTVIDAYSHFDQAVVGDTVKIGPFARLRPGTALSDEVHIGNFVEIKKSEIGKGSKV 356

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
           NHL+Y+GD+ +G  VNIGAGTITCNYDG +K++T I ++ FIGS++ L+AP+ +G+G  V
Sbjct: 357 NHLTYIGDTTMGSGVNIGAGTITCNYDGANKFRTVIEDDCFIGSDTQLVAPVKVGKGATV 416

Query: 407 ASGSIITQDTPENSLVFARSRQ 428
            +G+ +T+D  +N+LV +R +Q
Sbjct: 417 GAGTTVTKDVNDNTLVISRVKQ 438


>gi|260914576|ref|ZP_05921044.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325]
 gi|260631367|gb|EEX49550.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325]
          Length = 458

 Score =  310 bits (793), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 175/451 (38%), Positives = 265/451 (58%), Gaps = 31/451 (6%)

Query: 1   MKRKRLAIV-LAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAE 59
           M+ K L+IV LAAG+G RM S   KVL KIAGKPM+ HV++T+ +   +N+ LV G+G E
Sbjct: 1   MEAKTLSIVILAAGKGTRMYSDLPKVLHKIAGKPMVKHVIDTVKSINAKNIHLVYGHGGE 60

Query: 60  EI-TRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHT 115
            +  R+   P   V + +Q  Q GT HA+  A     P + D   ++++YGD PL+++ T
Sbjct: 61  MMQARLQDEP---VNWILQAEQLGTGHAMQQA----APFFADDENILMLYGDGPLITAET 113

Query: 116 LKKAMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGL 175
           L+K +    +   IA++    D+P GYGR+L  N  ++ I E+ DA  E+ KI   N+GL
Sbjct: 114 LQKLIAAKPEN-GIALLTVYLDDPTGYGRILRANGNVVGIVEQKDANPEQLKIQEINTGL 172

Query: 176 MAIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYEL 234
           +  DG     WL Q+  N    EYY+TD+I  A  DG  + ++   +  EV G NNR +L
Sbjct: 173 LVADGKSFKRWLSQLTNNNAQGEYYITDVIALANQDGCQVVAVHPSDVMEVEGVNNRQQL 232

Query: 235 SLIENIWQSRYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGV-- 286
           + +E  +Q +   +++++GV ++ PE   L        D  I  + +IE  V  G  V  
Sbjct: 233 ARLERYYQRKQADKLLLAGVALVDPERFDLRGELTHGKDVEIDVNVIIEGKVHLGNRVRI 292

Query: 287 ---------SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKK 337
                     I + V+I+ +S LE   +GK ++IGPF+R+R  T + ++  IGNF E+K 
Sbjct: 293 GAGCVLKNCEIADDVEIKPYSVLENAVVGKASMIGPFSRLRPGTELAESTHIGNFVEIKN 352

Query: 338 ATIKEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAP 397
           A +  GSK+NHLSYVGD+ VG+  NIGAG ITCNYDG +K+KT I  N F+GS++ L+AP
Sbjct: 353 AKVGNGSKVNHLSYVGDAEVGEKCNIGAGVITCNYDGANKFKTVIGNNVFVGSDAQLVAP 412

Query: 398 ITIGQGTYVASGSIITQDTPENSLVFARSRQ 428
           +TI  G  + +G+ +T++   + LV +R  Q
Sbjct: 413 VTIEDGATIGAGTTVTRNVSYDELVISRIPQ 443


>gi|253987517|ref|YP_003038873.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253778967|emb|CAQ82127.1| bifunctional protein GlmU [Photorhabdus asymbiotica]
          Length = 456

 Score =  310 bits (793), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 164/445 (36%), Positives = 272/445 (61%), Gaps = 34/445 (7%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++T  A G +NV LV G+G + + +    
Sbjct: 9   VILAAGKGTRMYSDLPKVLHLLAGKPMVQHVIDTAMALGAKNVHLVYGHGGDLMKQ---- 64

Query: 68  PTLS---VEYYIQDCQQGTAHAVLTAQDAIKPGY---DDVIIMYGDVPLVSSHTLKKAMD 121
            TLS   + + +Q+ Q GT HA+  A     P +   +D++++YGDVPL+ + TL++ + 
Sbjct: 65  -TLSEQKLNWVLQEEQLGTGHAMQQA----APHFTDDEDILMLYGDVPLIGTDTLERLLA 119

Query: 122 KIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
              +G  I ++    DNP GYGR++ KN ++  I E+ DAT+E+ KI   N+G++  +G 
Sbjct: 120 AKPEG-GIGLLTAILDNPTGYGRIIRKNGDVTGIIEQKDATEEQCKISEINTGILVANGG 178

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENI 240
            +  WL Q+  N    EYY+TD+I  A  +G+ I ++  +   E+ G NNR +LS +E I
Sbjct: 179 DLKRWLSQLDNNNAQGEYYITDVIALAHKEGRKIEAVHPRRLSEMEGVNNRLQLSTLERI 238

Query: 241 WQSRYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHV------FFGCGVSI 288
           +QS    +++++GV ++ P       T+    D +I  + +IE +V        G G  +
Sbjct: 239 YQSEQAEKLLLAGVMLLDPTRFDLRGTLIHGRDVVIDTNVIIEGNVTLGNNVLIGTGCVL 298

Query: 289 ENYVQ-----IRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG 343
           +N +      +  ++ +E   +G    +GPFAR+R  + + +   +GNF E+KK+ + +G
Sbjct: 299 KNCIIGDDSILSPYTVIEDSEMGVGCTVGPFARLRPGSKLAEKAHVGNFVEMKKSYLGKG 358

Query: 344 SKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQG 403
           SK  HL+Y+GD+ +G +VNIGAGTITCNYDG +K+KT I +N F+GSN+ L+AP+TI +G
Sbjct: 359 SKAGHLTYLGDADIGSDVNIGAGTITCNYDGANKFKTIIGDNVFVGSNTQLVAPVTIAKG 418

Query: 404 TYVASGSIITQDTPENSLVFARSRQ 428
             + +G+ +T++  E+ LV +R++Q
Sbjct: 419 ATIGAGTTVTKNVAEDELVVSRTKQ 443


>gi|183597139|ref|ZP_02958632.1| hypothetical protein PROSTU_00378 [Providencia stuartii ATCC 25827]
 gi|188023449|gb|EDU61489.1| hypothetical protein PROSTU_00378 [Providencia stuartii ATCC 25827]
          Length = 456

 Score =  310 bits (793), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 167/458 (36%), Positives = 271/458 (59%), Gaps = 24/458 (5%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           +++  ++LAAG+G RM S   KVL  +AGKPM+ HV++T  + G  ++ LV G+G + + 
Sbjct: 4   QRKSVVILAAGKGTRMYSELPKVLHLLAGKPMVQHVIDTAKSVGASDIHLVYGHGGDLLK 63

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                  L+  + +Q  Q GT HA+  A    +   +D+I++YGDVPL++  TL++ ++ 
Sbjct: 64  EKLGEQNLN--WVLQAEQLGTGHAMQQAAPHFQDD-EDIIMLYGDVPLIAKDTLQRLIEA 120

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
             +G  I ++    DNP GYGR++ +N E++ I E+ DAT+E+RKI   N+G+M   G  
Sbjct: 121 KPEG-GIGLLTVILDNPTGYGRIIRENGEVVGIIEQKDATEEQRKIQEINTGIMVASGKD 179

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASID-VKEQEVCGCNNRYELSLIENIW 241
              WL Q+  N    EYY+TD+I  A  +G  I ++   +  E+ G NNR +L+ +E I+
Sbjct: 180 FKRWLSQLDNNNAQGEYYITDVIALAHKEGNKIETVHPSRLSEMEGVNNRLQLAALERIY 239

Query: 242 QSRYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGVSIE------ 289
           Q     +++++GV +I PE      T+    D II  + +IE +V  G  V I+      
Sbjct: 240 QREQAEKLLLAGVMLIDPERFDIRGTLTHGRDIIIDTNVIIEGNVTLGNNVHIQSGCILK 299

Query: 290 ------NYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG 343
                 N V I  +S +E   +  +  +GPFAR+R    +     +GNF E+K A++  G
Sbjct: 300 NCVIGDNSV-ISPYSVIENSELSAECTVGPFARLRPGAKLAAKAHVGNFVEMKNASLGVG 358

Query: 344 SKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQG 403
           SK  HL+Y+GD+ +G+NVNIGAGTITCNYDG +KYKT I ++ F+GS++ LIAP+++  G
Sbjct: 359 SKAGHLTYLGDAQIGENVNIGAGTITCNYDGANKYKTIIGDDVFVGSDTQLIAPVSVANG 418

Query: 404 TYVASGSIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
             + +G+ +T+D  E  LV +R +Q+  ++    ++KK
Sbjct: 419 ATIGAGTTVTRDVNEGELVVSRVKQVHIKNWQRPVKKK 456


>gi|127514767|ref|YP_001095964.1| UDP-N-acetylglucosamine pyrophosphorylase [Shewanella loihica PV-4]
 gi|166226125|sp|A3QJQ7|GLMU_SHELP RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|126640062|gb|ABO25705.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase [Shewanella
           loihica PV-4]
          Length = 454

 Score =  310 bits (793), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 171/441 (38%), Positives = 262/441 (59%), Gaps = 26/441 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI-TRINF 66
           ++LAAG+G RM+S   KVL  IA K M+ HV++T    G E + LV GYGA+++  R+  
Sbjct: 6   VILAAGKGTRMRSDLPKVLHPIAHKSMVQHVIDTAHQLGSEAIQLVYGYGADKLQARLG- 64

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD-VIIMYGDVPLVSSHTLKKAMDKIAQ 125
               ++ + +Q  Q GT HAV  A D I  G DD V+I+YGDVPL+   TL+ A+     
Sbjct: 65  --EQALNWVLQAEQLGTGHAVAQANDNI--GDDDTVLILYGDVPLIQVSTLE-ALLAARD 119

Query: 126 GYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMD 185
              +A++  N  +P GYGR++ +  +++ I E+ DA +E+ KI+  N+G+MA  G  +  
Sbjct: 120 ANGLAILTVNLHDPTGYGRIVREAGKVVGIVEQKDANEEQLKINEINTGIMAAPGKQLKA 179

Query: 186 WLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSR 244
           WL Q+  +    EYYLTDI+  A  DG SI +   +   EV G NNR +L+ +E  +Q+R
Sbjct: 180 WLGQLSSDNAQGEYYLTDIVAMAHSDGVSITTAQPESAIEVEGANNRVQLAQLERAYQAR 239

Query: 245 YRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV------------ 292
              ++M+ G  +  P  + +  +  +  D +I+ +V F   V+I N V            
Sbjct: 240 AAEKLMLEGANLRDPARIDVRGEVTVGMDVMIDVNVVFQGKVTIGNNVTIGAGAILIDCE 299

Query: 293 -----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKIN 347
                +I+ +S +E   +G+    GPFAR+R    ++++  IGNF E+KKA + EGSK  
Sbjct: 300 IGDNAEIKPYSIIENAIVGEAASAGPFARLRPGAELKRDAHIGNFVEMKKAVLGEGSKAG 359

Query: 348 HLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVA 407
           HL+Y+GD+ VG  VNIGAGTITCNYDG +K+ T I ++ F+GS++ L+AP+TIG+G  + 
Sbjct: 360 HLAYIGDAQVGAGVNIGAGTITCNYDGANKHLTVIEDDVFVGSDTQLVAPVTIGKGATLG 419

Query: 408 SGSIITQDTPENSLVFARSRQ 428
           +GS IT+D   + LV  R +Q
Sbjct: 420 AGSTITRDVAADELVITRVKQ 440


>gi|222099803|ref|YP_002534371.1| Bifunctional protein glmU [Thermotoga neapolitana DSM 4359]
 gi|221572193|gb|ACM23005.1| Bifunctional protein glmU [Thermotoga neapolitana DSM 4359]
          Length = 449

 Score =  310 bits (793), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 176/451 (39%), Positives = 273/451 (60%), Gaps = 25/451 (5%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG+G RMKS   KVL +++GK MI  V++T A    + V +VLG+ AE++ R + 
Sbjct: 8   ALILAAGKGTRMKSRIPKVLHRLSGKSMIEWVVDT-AGKVAQEVGVVLGFEAEKV-RKHL 65

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQG 126
           P  + +  +IQ+ Q GTAHAV+ A+  ++P  DDVII+YGDVPL+S +TLK+ +++  +G
Sbjct: 66  PEWVRI--FIQEEQLGTAHAVMCARSFLEPD-DDVIILYGDVPLISENTLKRMIEEHRKG 122

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
             + ++  + ++P GYGR+ + +     I EE D  +  + I   N+G     G ++++ 
Sbjct: 123 ADVTILVADVEDPSGYGRV-VGDGGRYRIIEEVDLPENLKGIKTINTGFYVFSGEFLLEV 181

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYR 246
           L +IK +    EYYLTD +  A  + + + + D    E+ G N R  L  +E+  + R  
Sbjct: 182 LPKIKNDNAKGEYYLTDAVNLAE-NVRVVRTAD--PLEITGVNTRKTLVWLEDQLRRRKI 238

Query: 247 RQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIG 306
            +++ +GVT++ P T ++ +   I  DT++ P  F      I    +I   S +    +G
Sbjct: 239 EELLENGVTILDPNTTYIHYSVEIGMDTIVYPMTFIEGKTRIGEGCEIGPLSRIVDCEVG 298

Query: 307 K----------KTII------GPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLS 350
                      K++I      GPFAR+R+ T ++K+ +IGNF E+KK+TI EG+K  HLS
Sbjct: 299 NNVKIMRSECFKSVIEDDVSVGPFARLREGTVLKKSSKIGNFVEIKKSTIGEGTKAQHLS 358

Query: 351 YVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGS 410
           Y+GD+ VG NVNIGAGTITCNYDG  K  T I +  FIGSN+SL+AP+ IG+G  + +GS
Sbjct: 359 YIGDAYVGMNVNIGAGTITCNYDGKRKNPTFIEDETFIGSNTSLVAPVRIGKGALIGAGS 418

Query: 411 IITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           +IT+D P  SL   R+RQIVKE   L  +++
Sbjct: 419 VITEDVPPYSLGLGRARQIVKEGWVLKRKEE 449


>gi|146313765|ref|YP_001178839.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Enterobacter sp. 638]
 gi|166990435|sp|A4WGF8|GLMU_ENT38 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|145320641|gb|ABP62788.1| UDP-N-acetylglucosamine pyrophosphorylase [Enterobacter sp. 638]
          Length = 456

 Score =  310 bits (793), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 171/455 (37%), Positives = 265/455 (58%), Gaps = 28/455 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++     G  NV LV G+G + + +    
Sbjct: 9   VILAAGKGTRMYSDLPKVLHTLAGKPMVQHVIDAANELGASNVHLVYGHGGDLLKK---- 64

Query: 68  PTLS---VEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIA 124
            TLS   + + +Q  Q GT HA+  A        +D++++YGDVPL++  TL +  +   
Sbjct: 65  -TLSDDKLNWVLQAEQLGTGHAMQQAAPFFADD-EDILMLYGDVPLIAVETLTRLREAKP 122

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
           QG  I ++    D+P GYGR+  +N ++  I E  DA+DE+R+I   N+G++  +G  + 
Sbjct: 123 QG-GIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDASDEQRQIQEINTGILIANGADLK 181

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASID-VKEQEVCGCNNRYELSLIENIWQS 243
            WL ++  N    EYY+TDII  A  +G  I ++   +  E  G NNR +LS +E I+Q+
Sbjct: 182 RWLSKLNNNNAQGEYYITDIIAMAHHEGHEITAVHPTRISETDGVNNRLQLSRLERIYQA 241

Query: 244 RYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG------CGVSIENY 291
               +++++GV +  P       T+    D  I  + +IE  V  G       G  I+N 
Sbjct: 242 EQAEKLLLAGVMLRDPARFDLRGTLAHGRDVEIDTNVIIEGQVTLGHRVKIGTGCVIKNS 301

Query: 292 V-----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
           V     +I  +S +E   +     IGPFAR+R    + +   +GNF E+KKA + +GSK 
Sbjct: 302 VIGDDCEISPYSVVEDARLDAACTIGPFARLRPGAELLEGAHVGNFVEMKKARLGKGSKA 361

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
            HL+Y+GD+ +G NVNIGAGTITCNYDG +K+KT I ++ F+GS+S L+AP+TIG+G  +
Sbjct: 362 GHLTYLGDAEIGDNVNIGAGTITCNYDGANKFKTIIGDDVFVGSDSQLVAPVTIGKGVTI 421

Query: 407 ASGSIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           A+G+ +T+D  EN LV +R  Q+ K+     ++KK
Sbjct: 422 AAGTTVTRDVAENELVLSRVPQVNKQGWQRPVKKK 456


>gi|332535720|ref|ZP_08411470.1| N-acetylglucosamine-1-phosphate uridyltransferase /
           glucosamine-1-phosphate N-acetyltransferase
           [Pseudoalteromonas haloplanktis ANT/505]
 gi|332034874|gb|EGI71404.1| N-acetylglucosamine-1-phosphate uridyltransferase /
           glucosamine-1-phosphate N-acetyltransferase
           [Pseudoalteromonas haloplanktis ANT/505]
          Length = 452

 Score =  310 bits (793), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 169/439 (38%), Positives = 254/439 (57%), Gaps = 22/439 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM+S+  KVL  +AGKPM+ HV++   A G     LV G+G + + +    
Sbjct: 6   VILAAGKGTRMRSALPKVLHNVAGKPMVQHVIDNAMALGATTTNLVYGHGGDLLQQ--QL 63

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               V + +Q  Q GT HAV  A   I    D V+I+YGDVPL    TL++ +    +  
Sbjct: 64  ADNDVNWVLQAEQLGTGHAVAQANSHIND-EDTVLILYGDVPLTKQSTLERLLAATPKN- 121

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            +AV+  N  NP GYGR+L    +++ I E+ DA+ E+  I+  N+G+MA++G  +  WL
Sbjct: 122 GLAVLTVNLVNPNGYGRMLRVGGKLVGIVEQKDASSEQLLINEVNTGIMAVNGKLLKTWL 181

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSRYR 246
             +  N    EYYLTDI+  A  +G  I S       EV G NNR +L+ +E  +Q+   
Sbjct: 182 GNLSNNNAQGEYYLTDIVAMAHSEGVEITSAQPDHAMEVEGANNRVQLAGLERAYQAWQA 241

Query: 247 RQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQI------------ 294
            ++M++G T+  P  + +  +     D +++ +V F   V++ N VQI            
Sbjct: 242 EELMLNGATLADPARIDVRGNVKTGEDVLVDINVIFEGNVTLGNNVQIGPNCVLKNCTIG 301

Query: 295 -----RAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
                +A + +E   +  K  +GP+AR+R    +E++  IGNF E+KK  + +GSK NHL
Sbjct: 302 DNVVIKANTLIEDASVAAKCTLGPYARLRPGAVMEEDSHIGNFVEMKKTRLGKGSKANHL 361

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           SY+GD+ +G+ VNIGAGTITCNYDG +K KT I +NAFIGSNSSL+AP+ IG    + +G
Sbjct: 362 SYLGDAEIGEKVNIGAGTITCNYDGVNKSKTIIGDNAFIGSNSSLVAPVNIGATATIGAG 421

Query: 410 SIITQDTPENSLVFARSRQ 428
           S+IT    ++ L  ARS+Q
Sbjct: 422 SVITSTVEDDQLAIARSKQ 440


>gi|94717585|sp|Q8PGH2|GLMU_XANAC RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
          Length = 456

 Score =  309 bits (792), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 175/444 (39%), Positives = 253/444 (56%), Gaps = 24/444 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG G RM+SS  KVLQ +AG+PM++HV+ T        + +V G+G +++ +  F 
Sbjct: 8   LILAAGEGKRMRSSLPKVLQPLAGQPMLAHVIATARQLQPAAIHIVYGHGGDQV-QAAFA 66

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               +++  Q  Q GT HAV  A  AI P    V+++YGDVPL+ S +L + +    +  
Sbjct: 67  DQGDLQWAEQREQLGTGHAVQQAMPAI-PDAATVLVLYGDVPLIRSESLLQLLHAPGR-- 123

Query: 128 SIAVVGFNADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
            +AV+     NP GYGR+L     ++ AI E+ DA DE+R+I   N+G++  +   +  W
Sbjct: 124 -MAVLVAELANPTGYGRILRDAEGKVAAIVEQKDANDEQRRIRTINTGILTAESTALRRW 182

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSRY 245
           L  +  +    E+YLTD+   A  D      + V + Q+V G N+ ++L+ +E  WQ R 
Sbjct: 183 LAGLSNDNAQAEFYLTDVFASAAADFTPADMVHVADPQDVEGANDPWQLAQLERAWQLRA 242

Query: 246 RRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV------- 292
            R + + GV M  P       +V +  D  +  D ++E +V  G  V I  +V       
Sbjct: 243 ARTLCLQGVRMADPARVEQRGSVQVGRDVQLDIDVILEGNVTLGDDVVIGPFVRLRDVTL 302

Query: 293 ----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
               Q+RA S LEGV       IGPFAR+R  T +   V IGNF E KK T+  GSK NH
Sbjct: 303 GAGTQVRAHSDLEGVITEGAVQIGPFARLRPGTVLADGVHIGNFVETKKVTMGVGSKANH 362

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           L+Y+GD+V+G  VNIGAGTITCNYDG +K +T I + AFIGSNS+L+API IG  + + +
Sbjct: 363 LTYLGDAVIGSKVNIGAGTITCNYDGVNKSQTTIGDGAFIGSNSALVAPIQIGANSTIGA 422

Query: 409 GSIITQDTPENSLVFARSRQIVKE 432
           GS+IT D P   L   R+RQ V E
Sbjct: 423 GSVITSDAPAGQLSVTRARQTVVE 446


>gi|295702288|ref|YP_003595363.1| UDP-N-acetylglucosamine pyrophosphorylase [Bacillus megaterium DSM
           319]
 gi|294799947|gb|ADF37013.1| UDP-N-acetylglucosamine pyrophosphorylase [Bacillus megaterium DSM
           319]
          Length = 459

 Score =  309 bits (792), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 179/461 (38%), Positives = 276/461 (59%), Gaps = 28/461 (6%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR 63
           KR A++LAAG+G RMKSS  KVL  + GKPM+ HV++ ++   + ++  V+G+GAE++  
Sbjct: 3   KRYAVILAAGQGTRMKSSLYKVLHPVCGKPMVQHVIDQLSRLDLTSLITVVGHGAEKVKS 62

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKI 123
                +L   + +Q+ Q GTAHAV+ A+  +       I++ GD PL+++ T++  +   
Sbjct: 63  HVGDKSL---FALQEEQLGTAHAVMQAESLLAHEKGTTIVVCGDTPLITAETIESLLKHH 119

Query: 124 AQGYSIA-VVGFNADNPKGYGRLLIKNNE--IIAIREENDATDEERKIHYCNSGLMAIDG 180
               ++A ++  +A++P GYGR+ I+N +  +  I E  DAT++ER +   N+G    D 
Sbjct: 120 EATNAMATILTAHAEDPTGYGRI-IRNEQGSVEKIVEHKDATEQERLVQEINTGTYCFDN 178

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIEN 239
             + + L ++  + V  EYYL D+IE  + +G+ I++    +  E  G N+R+ LS  E 
Sbjct: 179 EKLFETLSKVSNDNVQGEYYLPDVIEILKNEGQIISAYQTSDFAETLGVNDRFALSQAEE 238

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLS------HDTIIQPDTVIEPHVFFG--CGVS---- 287
             + R  +Q M++GVT++ P   ++S       DT+I P TVI+  V  G  C V     
Sbjct: 239 TMKKRINKQHMLNGVTIVDPSNTYISADAVIGRDTVIYPGTVIQGTVVIGENCEVGPNSE 298

Query: 288 -----IENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKE 342
                I N   IR  S      IG +  IGPFA IR ++ I   VR+GNF E+KKA+  +
Sbjct: 299 IKDCKIGNNTSIR-HSVAHDSEIGHEVTIGPFAHIRPQSLIGDEVRVGNFVEIKKASFGK 357

Query: 343 GSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQ 402
           GSK +HLSY+GD+ VGK VN+G G+IT NYDG +K+ T I + AF+G NS+LIAP+TIG+
Sbjct: 358 GSKASHLSYIGDAEVGKGVNLGCGSITVNYDGKNKFLTKIEDGAFVGCNSNLIAPVTIGE 417

Query: 403 GTYVASGSIITQDTPENSLVFARSRQIVKEDGA--LSMRKK 441
           G YVA+GS +T D P  +L  AR++Q+ KE+ A  L + KK
Sbjct: 418 GAYVAAGSTVTDDVPGKALSIARAKQVNKENYAEKLDINKK 458


>gi|257466266|ref|ZP_05630577.1| glucosamine-1-phosphate acetyltransferase [Fusobacterium
           gonidiaformans ATCC 25563]
 gi|315917423|ref|ZP_07913663.1| glucosamine-1-phosphate acetyltransferase [Fusobacterium
           gonidiaformans ATCC 25563]
 gi|313691298|gb|EFS28133.1| glucosamine-1-phosphate acetyltransferase [Fusobacterium
           gonidiaformans ATCC 25563]
          Length = 452

 Score =  309 bits (792), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 162/445 (36%), Positives = 259/445 (58%), Gaps = 22/445 (4%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
            ++LAAG+G RMKS   KVL K+ GKPM+  +++ +     E   L+LGY  EEI     
Sbjct: 5   TLILAAGKGTRMKSDLPKVLHKVNGKPMLHKILDVVNFLQPEENILILGYKREEI----L 60

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMD-KIAQ 125
               +  Y +Q+ Q GT HA+L A++ +K  + D++++YGD PL+   TL++       Q
Sbjct: 61  ATLDTCSYVVQEEQLGTGHAILQAKEKLKDYHGDIMVLYGDTPLLREETLQQLYQYHKEQ 120

Query: 126 GYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMD 185
             +  V+    +NP GYGR+L K  +++ I EE +AT+E++KI   N+G+   D   +  
Sbjct: 121 KATTTVLTAVYENPFGYGRILKKERKVLGIVEEKEATEEQKKIQEVNAGVYCFDSQELWK 180

Query: 186 WLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSR 244
            L +I       EYYLTD++    ++GK++ S ++K+ QE+ G N++ EL+    + + R
Sbjct: 181 ALSKINNKNEKGEYYLTDVLSIQAMEGKTVLSYELKDSQEILGVNSKVELAEANQVLRQR 240

Query: 245 YRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVH 304
             +Q+M  GV ++ P   ++  D  I  DTV+ P V       I    +I   + +    
Sbjct: 241 KNKQLMEDGVILLDPSITYVEEDVKIGQDTVLAPTVILQGKTIIGKKCEILGNTRIIDSQ 300

Query: 305 IGKKTII----------------GPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
           +G   ++                GPFA +R +  ++K V IGNF EVKK+ ++EG K  H
Sbjct: 301 LGDNIVVESSVIEESILEDGVTMGPFAHLRPKAHLKKKVHIGNFVEVKKSVLEEGVKAGH 360

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           L+Y+GD+ VG+  NIGAGTITCNYDG +K+ T+I ++ FIGS+S L+AP+ IG+   + +
Sbjct: 361 LTYLGDAHVGERTNIGAGTITCNYDGVNKFPTNIGKDVFIGSDSMLVAPVNIGENALIGA 420

Query: 409 GSIITQDTPENSLVFARSRQIVKED 433
           GS+IT+D PEN+L   R++QI+K +
Sbjct: 421 GSVITKDVPENALAVERNKQIIKNE 445


>gi|254000514|ref|YP_003052577.1| UDP-N-acetylglucosamine pyrophosphorylase [Methylovorus sp. SIP3-4]
 gi|253987193|gb|ACT52050.1| UDP-N-acetylglucosamine pyrophosphorylase [Methylovorus sp. SIP3-4]
          Length = 452

 Score =  309 bits (792), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 176/445 (39%), Positives = 261/445 (58%), Gaps = 33/445 (7%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM++HV+ET        + +V G+G + +     P
Sbjct: 5   LILAAGKGTRMHSDLPKVLHPVAGKPMLAHVIETAKQLSPSKILVVYGFGGDAV-----P 59

Query: 68  PTLSVE--YYIQDCQQ-GTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIA 124
                E  +++Q  +Q GT HAV+ A   + P     +IM GDVPL+S  T ++ +   A
Sbjct: 60  DQFRHENIHWVQQAEQLGTGHAVMQALPFLDP-EAKTLIMLGDVPLISVQTCQELLKNQA 118

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKN--NEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           +   + ++ F   NP GYGR+ ++N  +E++AI E  DA++E+R+I+  N+G+MA+D   
Sbjct: 119 K---LTLLTFAKANPSGYGRI-VRNAQDEVVAIVEHKDASEEQRQINEINTGIMAVDNHA 174

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIW 241
           + +WL  +  +    EYYLTDI+  A   G ++  +    E E+ G N++ +L+ IE  +
Sbjct: 175 LSEWLKNLGNDNAQGEYYLTDIVGMASQQGIAVGGVLAANEPEITGINSKSDLASIERCY 234

Query: 242 QSRYRRQMMISGVTMIAPETV------FLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIR 295
           Q +   Q++  GVT+  P  +       +  D  I    V E  V    GV I  Y  IR
Sbjct: 235 QQQQAAQLLQQGVTLSDPARIDIRGKLSVGRDVHIDVGCVFEGEVHLADGVRIGPYCVIR 294

Query: 296 -----------AFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGS 344
                      AF++++   IGK+  IGP+AR+R  T ++    +GNF E+K A +  GS
Sbjct: 295 NASIGVGTAIAAFTHIDDAEIGKQAKIGPYARLRPGTVLQDETHVGNFVELKNAQVDVGS 354

Query: 345 KINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGT 404
           KINHLSYVGD+ VGK VNIGAGTITCNYDG +K++T I +NAFIGS+S LIAP+TIG G 
Sbjct: 355 KINHLSYVGDTTVGKQVNIGAGTITCNYDGVNKFRTVIGDNAFIGSDSQLIAPVTIGAGA 414

Query: 405 YVASGSIITQDTPENSLVFARSRQI 429
            + +GS I++D P   L  AR RQ+
Sbjct: 415 TIGAGSTISKDAPAGELTVARGRQV 439


>gi|120600833|ref|YP_965407.1| UDP-N-acetylglucosamine pyrophosphorylase [Shewanella sp. W3-18-1]
 gi|146295034|ref|YP_001185458.1| UDP-N-acetylglucosamine pyrophosphorylase [Shewanella putrefaciens
           CN-32]
 gi|166226126|sp|A4YCH6|GLMU_SHEPC RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|166226128|sp|A1RQA8|GLMU_SHESW RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|120560926|gb|ABM26853.1| UDP-N-acetylglucosamine pyrophosphorylase / glucosamine-1-phosphate
           N-acetyltransferase [Shewanella sp. W3-18-1]
 gi|145566724|gb|ABP77659.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase [Shewanella
           putrefaciens CN-32]
          Length = 454

 Score =  309 bits (792), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 169/439 (38%), Positives = 259/439 (58%), Gaps = 22/439 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM+S   KVL  IA K M+ HV++T  + G + + LV GYGA+++      
Sbjct: 6   VILAAGKGTRMRSDLPKVLHPIAHKSMVQHVIDTAHSIGSDAIQLVYGYGADKLQASLGE 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HAV  A   I    D V+I+YGDVPL+ + TL+  +    +  
Sbjct: 66  QQLN--WVLQAEQLGTGHAVAQASPYIADN-DTVLILYGDVPLIQASTLEALLAARPEN- 121

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            +A++  N  NP GYGR++ +  +++ I E+ DA  E+  I+  N+G+MA+ G  +  WL
Sbjct: 122 GVAILTVNLANPTGYGRIVREQGKVVGIIEQKDANPEQLLINEINTGIMAVPGKQLKTWL 181

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRYR 246
            ++  N    EYYLTDII  A  DG +I +   +   EV G NNR +L+ +E  +Q+R  
Sbjct: 182 SRLSNNNAQGEYYLTDIIAMAHADGVAIDTAQPQSAIEVEGANNRVQLAQLERAYQAREA 241

Query: 247 RQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFF------------GCGV-----SIE 289
            ++M++G  +  P  + +  +  +  D +I+ +V F            G G       I 
Sbjct: 242 EKLMLAGANLRDPHRIDIRGEVTVGMDVMIDINVIFEGKVILGNNVTIGAGAILIDCEIA 301

Query: 290 NYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
           +  +I+ +S +EG  +G     GPFAR+R    ++++  IGNF EVKKA I  GSK  HL
Sbjct: 302 DGAEIKPYSIIEGAKLGVAASAGPFARLRPGAELKQDAHIGNFVEVKKAIIGVGSKAGHL 361

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+++G  VNIGAGTITCNYDG +K+ T I +N F+GS++ L+AP+TIG+G  + +G
Sbjct: 362 AYLGDAIIGDGVNIGAGTITCNYDGANKHLTVIEDNVFVGSDTQLVAPVTIGKGATLGAG 421

Query: 410 SIITQDTPENSLVFARSRQ 428
           S IT+D  EN LV  R +Q
Sbjct: 422 STITRDVGENELVITRVKQ 440


>gi|114565642|ref|YP_752796.1| UDP-N-acetylglucosamine pyrophosphorylase [Syntrophomonas wolfei
           subsp. wolfei str. Goettingen]
 gi|119370603|sp|Q0B0S9|GLMU_SYNWW RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|114336577|gb|ABI67425.1| UDP-N-acetylglucosamine pyrophosphorylase / glucosamine-1-phosphate
           N-acetyltransferase [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
          Length = 449

 Score =  309 bits (792), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 170/442 (38%), Positives = 269/442 (60%), Gaps = 24/442 (5%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG+G RM+S   KV  ++AGKP+I HV++ +  AGIE++ +V+G+G E +  I  
Sbjct: 5   AVILAAGKGLRMRSDLPKVAHRVAGKPIILHVIQAVKEAGIEDIVVVVGHGREVVQEICS 64

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQG 126
                + + +Q+ Q GT HA++ A+  + P  D ++++ GD+PL+ + +L++ M+   Q 
Sbjct: 65  GE--KIRFVLQEQQLGTGHALMQAEAVVAP-EDTILVLAGDIPLIQATSLQQLMESHRQK 121

Query: 127 YSIA-VVGFNADNPKGYGRLLI-KNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
            + A V+  N  NP GYGR+L  +    + I EE DA DEE+KI   NSG+       + 
Sbjct: 122 QATATVLSVNMQNPSGYGRILRDQQGAFLRIIEEKDANDEEKKIKEINSGIYCFCARKVF 181

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIA-SIDVKEQEVCGCNNRYELSLIENIWQS 243
             L          EYYLT+ +E  +   +SI   +   E+++ G N+R +L+  ENI + 
Sbjct: 182 SALHSTSTRNAQGEYYLTEALELLKNQQESIGIFLSDGEEDIYGINDRVQLAQAENILRQ 241

Query: 244 RYRRQMMISGVTMIAPETVFLS------HDTIIQPDTVIEPHVFFG--CGVS-------- 287
           R  R++M+SGV+++ P + F+       HDTII P T+IE +   G  C +         
Sbjct: 242 RKNRELMLSGVSLMDPASTFIDSDVLIGHDTIILPFTIIEGNSRLGERCEIGPGTRISDS 301

Query: 288 -IENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
            I + V+I + S L    +  +  IGPFA +R ETT+ + V++G+F E+KK+TI  GSKI
Sbjct: 302 IIGSEVKIES-SRLIQASVADRCNIGPFAYLRPETTLLEGVKVGDFVEIKKSTIGTGSKI 360

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
            HLSYVGD+ +G+ VN+GAGTITCNYDG +KY+T + +  FIGSN++L+AP+ IG+ +  
Sbjct: 361 PHLSYVGDATIGQGVNVGAGTITCNYDGKNKYQTVLEDRVFIGSNTNLVAPVRIGENSIT 420

Query: 407 ASGSIITQDTPENSLVFARSRQ 428
            +GS I++D P ++L   R+ Q
Sbjct: 421 GAGSTISRDVPPHTLAVERAGQ 442


>gi|227824249|ref|ZP_03989081.1| UDP-N-acetylglucosamine pyrophosphorylase [Acidaminococcus sp. D21]
 gi|226904748|gb|EEH90666.1| UDP-N-acetylglucosamine pyrophosphorylase [Acidaminococcus sp. D21]
          Length = 456

 Score =  309 bits (791), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 174/461 (37%), Positives = 269/461 (58%), Gaps = 36/461 (7%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           AI+LAAG+G RMKS   KVL K++GKPM+ HV++    AG+++  +++G+G+E++T   F
Sbjct: 6   AIILAAGKGTRMKSKLPKVLHKLSGKPMLEHVLDAAGEAGVDDEIVIVGFGSEKVTE--F 63

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK-IAQ 125
             T +    IQ  Q GT HAVL A+D +       +I+ GD PL+    LKK  +  +  
Sbjct: 64  LGTRA-RVAIQKEQLGTGHAVLQARDLLGGEKGTALILCGDTPLLEGAELKKFYETHLES 122

Query: 126 GYSIAVVGFNADNPKGYGRLLIKN-NEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
           G  ++V+  +A NP GYGR+L  +   +  I EE DA++ +RKIH  N+G+  ++   + 
Sbjct: 123 GAGVSVLTADAPNPFGYGRILRDSVGRVTGIVEEKDASEAQRKIHEINTGIYCVEMPLLF 182

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQE-VCGCNNRYELSLIENIWQS 243
             L  +  +    EYYLTDI+ +    G+ +  I  ++ + V G N+R +L+  + +   
Sbjct: 183 TLLENLSNDNAQGEYYLTDILAECLKRGRDVCGIKTQDFDMVMGINSRRQLAQAQRVMNE 242

Query: 244 RYRRQMMISGVTMIAPETVFL------SHDTIIQP------------DTVIEPHVFF--- 282
           R   ++M  GVT++ P T F+        DT++ P            D VI P+V F   
Sbjct: 243 RIVGRLMDEGVTIMDPSTTFVEKGVKVGRDTVLYPFTLLEGETEIGEDCVIGPNVRFTNV 302

Query: 283 --GCGVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATI 340
             G G SI+       F+Y     +G    +G F  +R  T +  +V++GNF EVK +T+
Sbjct: 303 TVGHGSSIQ-------FAYAHDCRVGNGVTMGCFNHLRPHTVLSDHVKVGNFVEVKNSTV 355

Query: 341 KEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITI 400
            EGSK+ HL Y+GDS +G  VN+G GTIT NYDG  K++T I +NAF+G NS+L+AP+T+
Sbjct: 356 GEGSKLPHLQYIGDSDIGSGVNMGCGTITVNYDGKEKHRTTIEDNAFVGCNSNLVAPVTV 415

Query: 401 GQGTYVASGSIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           G+G+YVA+GS IT++ PE++L  AR +Q+  E  A   R+K
Sbjct: 416 GRGSYVAAGSTITKNVPEDALAVARGKQVNLEGWAKKHREK 456


>gi|303256403|ref|ZP_07342417.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Burkholderiales bacterium 1_1_47]
 gi|302859894|gb|EFL82971.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Burkholderiales bacterium 1_1_47]
          Length = 451

 Score =  308 bits (790), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 170/442 (38%), Positives = 267/442 (60%), Gaps = 28/442 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMET---IAAAGIENVALVLGYGAEEITRI 64
           ++LAAG G RM S   KVLQ + GK M+ HV+E    +  AG   + +V+G+G+EE+   
Sbjct: 4   VILAAGLGKRMYSHLPKVLQPVGGKAMLKHVVEAARRLPDAG--KIIVVVGHGSEEVKEA 61

Query: 65  NFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIA 124
                  V + +Q  Q+GT HAV  A +AI P  +  +I+YGDVPL+S+ TL  A++K A
Sbjct: 62  M--ADQPVTFVLQKEQKGTGHAVQQALEAINPD-EPTLILYGDVPLISTETLS-ALEKTA 117

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
            G   A++  + DNPKGYGR+L ++ ++I I EE DA++++R I   N+G M +    + 
Sbjct: 118 -GDGFALLTIDLDNPKGYGRILREDGKVIGIVEEKDASEQQRAIKEVNTGFMVLPSKEME 176

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQS 243
            WL  +K +   QEYYLTD++  A  +G+ I +   ++  EV G N++ +L  +E  +Q 
Sbjct: 177 RWLGNLKNDNKQQEYYLTDLVAMAAAEGREIKTFKAQDAWEVEGANSKVQLEGLERAFQL 236

Query: 244 RYRRQMMISGV------------TMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENY 291
           R  ++++  GV            ++   + VF+    I + D V+  +V  G    I+N 
Sbjct: 237 RQAKELLEKGVRLADKNRIDIRGSLTCGKDVFIDVGCIFEGDVVLGDNVVVGPYCVIKNT 296

Query: 292 -----VQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
                  I A+S+ +   +G    IGPFAR+R  T +   V IGNF E+KK+ I +GSK+
Sbjct: 297 KIGDGTVIDAYSHFDQAVVGDTVKIGPFARLRPGTALSDEVHIGNFVEIKKSEIGKGSKV 356

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
           NHL+Y+GD+ +G  VNIGAGTITCNYDG +K++T I ++ FIGS++ L+AP+ +G+G  V
Sbjct: 357 NHLTYIGDTTMGSGVNIGAGTITCNYDGANKFRTVIEDDCFIGSDTQLVAPVKVGKGATV 416

Query: 407 ASGSIITQDTPENSLVFARSRQ 428
            +G+ +T+D  +N+LV +R +Q
Sbjct: 417 GAGTTVTKDVNDNTLVISRVKQ 438


>gi|237807076|ref|YP_002891516.1| UDP-N-acetylglucosamine pyrophosphorylase [Tolumonas auensis DSM
           9187]
 gi|259491999|sp|C4L8R0|GLMU_TOLAT RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|237499337|gb|ACQ91930.1| UDP-N-acetylglucosamine pyrophosphorylase [Tolumonas auensis DSM
           9187]
          Length = 454

 Score =  308 bits (790), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 171/440 (38%), Positives = 253/440 (57%), Gaps = 24/440 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI-TRINF 66
           ++LAAG+G RM+SS  KVL  +AG+PM+SHV++T  +   E + LV G+G E +  R+N 
Sbjct: 6   VILAAGKGTRMRSSLPKVLHPVAGRPMVSHVIDTARSLNAEKIHLVYGHGGEAMQARLN- 64

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQG 126
                VE+ +Q  Q GT HAV  A   I P +  V+++YGD PL+S  TL+  +  I   
Sbjct: 65  --DADVEWVLQAEQLGTGHAVAQAMPTI-PDHAKVLVLYGDTPLISPVTLETLL-TIQPA 120

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
             I ++  +  NP GYGR+L  + +++ I E+ DAT E++ I+  N+G++      +  W
Sbjct: 121 NGIGLLTVSLANPTGYGRILRADGQVVGIVEQKDATAEQQLINEVNTGVLVAPAKQLKQW 180

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASID-VKEQEVCGCNNRYELSLIENIWQSRY 245
           L  +       EYYLTD+I  A   G SI +   V  QEV G NNR +L+ +E  +Q R 
Sbjct: 181 LSGLTNLNAQGEYYLTDVIAAAHHSGSSIQTAQPVCAQEVEGANNRLQLAQLERFYQKRA 240

Query: 246 RRQMMISGVTMIAP------------ETVFLSHDTIIQPDTVIEPHVFFGCGVSIENY-- 291
             Q+M+ GVT++ P            E V L  + II+    +   V  G G  ++N   
Sbjct: 241 AEQLMLEGVTLLDPARFDLRGTLQCGEDVLLDVNVIIEGQVELGHRVQIGAGCVLKNCRI 300

Query: 292 ---VQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
                I  +S +EG  + +   +GPFAR+R    +     +GNF E+K A +  GSK  H
Sbjct: 301 ADDSIISPYSIIEGSVLAEGCTVGPFARLRPGAELAAQAHVGNFVELKNARLGLGSKAGH 360

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           LSY+GDS +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+ + +G  + +
Sbjct: 361 LSYLGDSEIGANVNIGAGTITCNYDGANKHKTIIEDDVFVGSDTQLVAPVRVAKGATLGA 420

Query: 409 GSIITQDTPENSLVFARSRQ 428
           GS IT+D  E+ LV  R RQ
Sbjct: 421 GSTITRDVGEDELVLTRVRQ 440


>gi|212637828|ref|YP_002314353.1| UDP-N-acetylglucosamine pyrophosphorylase [Shewanella piezotolerans
           WP3]
 gi|254798800|sp|B8CVU0|GLMU_SHEPW RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|212559312|gb|ACJ31766.1| UDP-N-acetylglucosamine pyrophosphorylase [Shewanella piezotolerans
           WP3]
          Length = 454

 Score =  308 bits (790), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 168/439 (38%), Positives = 257/439 (58%), Gaps = 22/439 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM+S   KVL  IA K M+ HV++T    G + + LV GYGA+++      
Sbjct: 6   VILAAGKGTRMRSDLPKVLHPIAHKSMVQHVIDTAHEVGSDAIQLVYGYGADKLQAKLGE 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HAV  A D I    D V+I+YGDVPL+ + TL+  +  +    
Sbjct: 66  QQLN--WVLQAEQLGTGHAVAQANDNISDD-DTVLILYGDVPLIQASTLESLL-AVRDEN 121

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            +A++  N  NP GYGR++ ++N+++ I E+ DA  E+  I   N+G+MA  G  +  WL
Sbjct: 122 GLAILTVNLPNPMGYGRIVREDNKVVGIVEQKDANAEQLAISEINTGIMAAPGKQLKAWL 181

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRYR 246
            Q+  +    EYYLTDI+  A  DG +I +   +   EV G NNR +L+ +E  +Q+R  
Sbjct: 182 GQLSSDNAQGEYYLTDIVAMAHKDGVAITTAQPESAVEVEGANNRVQLAQLERAYQARAA 241

Query: 247 RQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV-------------- 292
            ++M+ G  +  P  + +  D  +  D +I+ +V     V+I N V              
Sbjct: 242 EKLMLEGANLRDPARIDIRGDVSVGMDVMIDVNVVIEGTVNIGNNVTIGAGAILIDCDIA 301

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +I+ +S +E   +G K   GPFAR+R    + ++  IGNF E+KKA + +GSK  HL
Sbjct: 302 DNAEIKPYSIVENAKVGVKASAGPFARLRPGAELAEDAHIGNFVEMKKALLGKGSKAGHL 361

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G  VNIGAGTITCNYDG +K++T I +N F+GS++ L+APITIG+G  + +G
Sbjct: 362 AYIGDATIGCGVNIGAGTITCNYDGANKFQTIIEDNVFVGSDTQLVAPITIGKGATLGAG 421

Query: 410 SIITQDTPENSLVFARSRQ 428
           S IT+D   + LV  R +Q
Sbjct: 422 STITKDVAADELVITRVKQ 440


>gi|59713169|ref|YP_205945.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Vibrio fischeri ES114]
 gi|75431408|sp|Q5E1N9|GLMU_VIBF1 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|59481270|gb|AAW87057.1| fused N-acetyl glucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate acetyl
           transferase [Vibrio fischeri ES114]
          Length = 452

 Score =  308 bits (790), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 169/443 (38%), Positives = 263/443 (59%), Gaps = 28/443 (6%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG+G RM S+  KVL  +AGKPM  HV++T    G +N+ LV G+G +++ +   
Sbjct: 5   AVILAAGKGTRMYSNKPKVLHTLAGKPMAKHVIDTCEGLGAQNIHLVYGHGGDQM-KAEL 63

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAMDKI 123
                V++ +Q  Q GT HAV  A     P + D   V+++YGDVPL+S+ T++  +D  
Sbjct: 64  GEE-RVQWVLQAEQLGTGHAVNQA----APEFADDEKVLVLYGDVPLISAETVENLLDAQ 118

Query: 124 AQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
             G  IA++    DNP GYGR++ +N  +IAI E+ DAT+E++ I   N+G+M   G  +
Sbjct: 119 PTG-GIALLTVVLDNPMGYGRIIRRNGPVIAIVEQKDATEEQKLIKEINTGVMVATGGDL 177

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQ 242
             WL  +K      EYYLTDII  A  +G+++ ++  V   EV G N+R +L+ +E  +Q
Sbjct: 178 KRWLAALKNENAQGEYYLTDIIAAAHDEGRAVEAVHPVSPIEVEGVNDRAQLARLERAYQ 237

Query: 243 SRYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGV---------- 286
           +   ++++  GV +  P       T+    D  I  + +IE +V  G  V          
Sbjct: 238 AAQAQKLLEQGVMLRDPSRFDLRGTLQCGMDIEIDANVIIEGNVTLGDNVIIGAGCVLKD 297

Query: 287 -SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
             I++   IR +S +EG  +G++  +GPF R+R    +  +  +GNF EVK   + EGSK
Sbjct: 298 CEIDDNTVIRPYSVIEGATVGEECTVGPFTRLRPGAELCNDAHVGNFVEVKNVRLGEGSK 357

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
            NHL+Y+GD+ +GK VN+GAG ITCNYDG +K+KT I ++ F+GS+S LIAP+T+  G  
Sbjct: 358 ANHLTYLGDAEIGKRVNVGAGVITCNYDGANKFKTIIGDDVFVGSDSQLIAPVTVANGAT 417

Query: 406 VASGSIITQDTPENSLVFARSRQ 428
           V +GS +T+D  EN L  +R+++
Sbjct: 418 VGAGSTVTKDVNENELYISRAKE 440


>gi|114565193|ref|YP_752707.1| UDP-N-acetylglucosamine pyrophosphorylase [Shewanella frigidimarina
           NCIMB 400]
 gi|119370593|sp|Q07VU6|GLMU_SHEFN RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|114336486|gb|ABI73868.1| glucosamine-1-phosphate N-acetyltransferase /
           UDP-N-acetylglucosamine pyrophosphorylase [Shewanella
           frigidimarina NCIMB 400]
          Length = 454

 Score =  308 bits (790), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 166/439 (37%), Positives = 257/439 (58%), Gaps = 22/439 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM+S   KVL  IA K M+ HV++T  + G   + LV GYGA+++      
Sbjct: 6   VILAAGKGTRMRSDLPKVLHPIAHKSMVQHVIDTANSLGSSAIQLVYGYGADKLQAALGE 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HAV  A   I    D V+I+YGDVPL+   TL+ A+  +    
Sbjct: 66  QALN--WVLQAEQLGTGHAVAQANPNINDD-DTVLILYGDVPLIQQSTLE-ALLAVRPTN 121

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            +A++  N  NP GYGR++ +  +++ I E+ DA  E+  I+  N+G+MA+ G  +  WL
Sbjct: 122 GLAILTVNLPNPTGYGRIVREQGKVVGIIEQKDANAEQLAINEVNTGIMAVPGKQLKAWL 181

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRYR 246
            ++  N    EYYLTDII  A +DG  I +   +   EV G NNR +L+ +E  +Q+R  
Sbjct: 182 NRLSNNNAQGEYYLTDIIAMANVDGVEITTSQPQSAIEVEGANNRVQLAQLERAYQARAA 241

Query: 247 RQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV-------------- 292
            +MM+ G  +  P  + +  D  +  D +I+ +V F   V++ N V              
Sbjct: 242 EKMMLEGANLRDPARIDIRGDVSVGMDVMIDVNVIFQGKVTLGNNVTIGAGAILIDCDIA 301

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +I+ ++ +EG  +G+    GPFAR+R    ++++  IGNF E+KK+ + +GSK  HL
Sbjct: 302 DNAEIKPYTIVEGAKLGQAASAGPFARLRPGAELKEDAHIGNFVEIKKSVLGKGSKAGHL 361

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G  VNIGAGTITCNYDG +K+ T I +  F+GS++ L+AP+TIG+   + +G
Sbjct: 362 AYLGDAQIGAGVNIGAGTITCNYDGANKFITTIEDGVFVGSDTQLVAPVTIGKNATLGAG 421

Query: 410 SIITQDTPENSLVFARSRQ 428
           S IT+D  EN LV  R +Q
Sbjct: 422 STITKDVAENELVITRVKQ 440


>gi|37681433|ref|NP_936042.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Vibrio vulnificus YJ016]
 gi|81756326|sp|Q7MGI2|GLMU_VIBVY RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|37200185|dbj|BAC96013.1| UDP-N-acetylglucosamine pyrophosphorylase [Vibrio vulnificus YJ016]
          Length = 453

 Score =  308 bits (790), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 166/444 (37%), Positives = 262/444 (59%), Gaps = 30/444 (6%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI-TRIN 65
           A++LAAG+G RM S+  KVL  +AGKPM+ HV++T    G +N+ LV G+G +++   + 
Sbjct: 5   AVILAAGKGTRMYSNMPKVLHTLAGKPMVKHVIDTCTGLGAQNIHLVYGHGGDQMQAALA 64

Query: 66  FPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAMDK 122
             P   V + +Q  Q GT HAV    D   P ++D   ++++YGDVPL+SS T++  +D 
Sbjct: 65  EEP---VNWVLQAEQLGTGHAV----DQASPQFEDDEKILVLYGDVPLISSETIESLLDA 117

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
             +G  IA++    DNP GYGR++ KN  ++AI E+ DA +E++ I   N+G+M   G  
Sbjct: 118 QPKG-GIALLTVVLDNPTGYGRIVRKNGPVVAIVEQKDANEEQKLIKEINTGVMVATGGD 176

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIW 241
           +  WL  +  +    EYYLTD+I  A  +G ++ ++  V   EV G N+R +L+ +E  +
Sbjct: 177 LKRWLAGLNNDNAQGEYYLTDVIAAAHDEGNAVEAVHPVSPIEVEGVNDRAQLARLERAF 236

Query: 242 QSRYRRQMMISGVTMIAPETVFLSH------DTIIQPDTVIEPHVFFGCGV--------- 286
           Q+   ++++  GV +  P    L        D  I  + +IE +V  G  V         
Sbjct: 237 QAAQAKKLLEQGVMLRDPARFDLRGELQCGLDVEIDVNVIIEGNVSLGDNVVIGAGCVLK 296

Query: 287 --SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGS 344
              I++   +R +S +EG  +G++  +GPF R+R    +  +  +GNF EVK A I EGS
Sbjct: 297 DCEIDDNTIVRPYSVIEGATVGEQCTVGPFTRLRPGAEMRNDSHVGNFVEVKNACIGEGS 356

Query: 345 KINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGT 404
           K NHL+Y+GD+ +G+  NIGAGTITCNYDG +K+KT I  + F+GS+S L+AP+TI  G 
Sbjct: 357 KANHLTYLGDAEIGQRTNIGAGTITCNYDGANKFKTIIGNDVFVGSDSQLVAPVTIADGA 416

Query: 405 YVASGSIITQDTPENSLVFARSRQ 428
            + +G+ +T+D  E  LV  R+++
Sbjct: 417 TIGAGTTLTKDVAEGELVITRAKE 440


>gi|226947169|ref|YP_002802242.1| UDP-N-acetylglucosamine pyrophosphorylase GlmU [Azotobacter
           vinelandii DJ]
 gi|259647731|sp|C1DMJ0|GLMU_AZOVD RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|226722096|gb|ACO81267.1| UDP-N-acetylglucosamine pyrophosphorylase; GlmU [Azotobacter
           vinelandii DJ]
          Length = 454

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 166/440 (37%), Positives = 259/440 (58%), Gaps = 24/440 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM+S+  KVL  +AG  M+ HV+ T      + + +V+G+GAE +      
Sbjct: 6   VILAAGQGTRMRSALPKVLHPVAGNSMLGHVVATARQLQPQGIHVVIGHGAERVRERLAA 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HAV  A  A+    + V+I+YGDVPL+ + TL++ + ++    
Sbjct: 66  DDLN--FVLQAEQLGTGHAVAQALPALS--AERVLILYGDVPLIEADTLRRLLAQVGP-E 120

Query: 128 SIAVVGFNADNPKGYGRLLIKN-NEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
            +A++  +  +P GYGR++      ++AI E  DA+ E+R I   N+G++A+ G  + DW
Sbjct: 121 RLALLTVDLVDPSGYGRIVRDAAGRVVAIVEHKDASPEQRAICEGNTGILAVPGARLADW 180

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSRY 245
           L ++  + V  EYYLTD+I  A  DG +IA+   ++  EV G N+R +L+ +E  +QSR 
Sbjct: 181 LGRLSNDNVQGEYYLTDVIAMAVADGLTIATEQPQDAMEVQGANDRLQLAQLERHYQSRV 240

Query: 246 RRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV------------- 292
            R++M  GVT+  P    L  +  +  D +I+ +V     V IE+ V             
Sbjct: 241 ARRLMAQGVTLRDPARFDLRGEVEVGRDVLIDVNVILEGKVIIEDGVEIGPNCTIKDSTL 300

Query: 293 ----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
               Q++A S+LEG  +G+    GPFAR+R    +     +GNF E+K A + EG+K  H
Sbjct: 301 RRGAQVKANSHLEGAELGEGADCGPFARLRPGAVLGAKAHVGNFVELKNAVLGEGAKAGH 360

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           LSY+GD+ +G   NIGAGTITCNYDG +K++T + E+ FIGSNS+L+AP+ +G G    +
Sbjct: 361 LSYLGDAEIGARTNIGAGTITCNYDGANKFRTVMGEDVFIGSNSALVAPVELGAGATTGA 420

Query: 409 GSIITQDTPENSLVFARSRQ 428
           GS+IT+D P  +L   R RQ
Sbjct: 421 GSVITEDVPAGNLALGRGRQ 440


>gi|17544896|ref|NP_518298.1| UDP-N-acetylglucosamine pyrophosphorylase [Ralstonia solanacearum
           GMI1000]
 gi|81592468|sp|Q8Y304|GLMU_RALSO RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|17427185|emb|CAD13705.1| probable udp-n-acetylglucosamine pyrophosphorylase protein
           [Ralstonia solanacearum GMI1000]
          Length = 455

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 168/457 (36%), Positives = 263/457 (57%), Gaps = 29/457 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG G RM+S+  KVL  +AGKP+++HV+ET  +     + +V+G+G + +  +   
Sbjct: 4   VILAAGLGKRMRSALPKVLHPLAGKPLLAHVIETARSLSPTRLVVVVGHGGDRVRDMVGA 63

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVI---IMYGDVPLVSSHTLKKAMDKIA 124
           P   V +  QD Q GT HAV+ A D +    DD +   ++YGDVPL  + TL   +    
Sbjct: 64  P--DVTFATQDQQLGTGHAVMQALDQL----DDTVPTLVLYGDVPLTRAETLNALVGAAG 117

Query: 125 QGYSIAVVGFNADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
           Q + + V+  + D+P GYGR++      I  I E+ DA + +  IH  N+G++      +
Sbjct: 118 QDH-LGVLTVHLDDPTGYGRIVRDATGRITRIVEQKDANETQLAIHEVNTGILVCPTARL 176

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQ 242
             WL  ++ +    EYYLTD+IE+A  +G  I S   + E E  G N++ +L+ +E I Q
Sbjct: 177 KTWLATLRNDNAQGEYYLTDVIERAASEGLPITSAHPLAEWETLGVNSKVQLAELERIHQ 236

Query: 243 SRYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGVSIENYVQIR- 295
               +Q++  GVT+I P  + +        D +I  D + E +V  G GV I  +  IR 
Sbjct: 237 RNLAQQLLEDGVTLIDPARIDIRGRLTCGRDVVIDIDCIFEGNVTLGDGVRIGAHAVIRD 296

Query: 296 ----------AFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
                      F ++E   +G ++ IGP+AR+R  T + ++V IGNF EVK + I   SK
Sbjct: 297 AAIQAGAEILPFCHIEQATVGAQSRIGPYARLRPGTELAEDVHIGNFVEVKNSQIAAHSK 356

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
            NHL+YVGD+ VG  VNIGAGTITCNYDG +K++T I ++AFIGS++ L+AP+ +G+G  
Sbjct: 357 ANHLAYVGDATVGSRVNIGAGTITCNYDGANKFRTIIEDDAFIGSDTQLVAPVRVGRGAT 416

Query: 406 VASGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           + +G+ +T+D PE  L  +R+RQ         +++KK
Sbjct: 417 LGAGTTLTKDAPEGQLTVSRARQTTVNGWQRPVKQKK 453


>gi|56961860|ref|YP_173582.1| UDP-N-acetylglucosamine pyrophosphorylase [Bacillus clausii
           KSM-K16]
 gi|81600608|sp|Q5WAD9|GLMU_BACSK RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|56908094|dbj|BAD62621.1| UDP-N-acetylglucosamine pyrophosphorylase [Bacillus clausii
           KSM-K16]
          Length = 454

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 173/448 (38%), Positives = 260/448 (58%), Gaps = 22/448 (4%)

Query: 5   RLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRI 64
           R A++LAAG+G RMKS   KVL  + GKPM+ HV++ ++    +  A+++G+GAEE+ + 
Sbjct: 4   RFAVILAAGQGTRMKSKLYKVLHPVCGKPMVEHVVDQVSKLEFDKTAVIVGHGAEEVKKT 63

Query: 65  NFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK-I 123
               T  +E+ +Q  Q GT HAV  A+  +       +++ GD PL+++ T+KK MD   
Sbjct: 64  ---LTEKIEFVMQPEQLGTGHAVKCAEHLLASQKGTTVVLCGDTPLITAATIKKLMDTHE 120

Query: 124 AQGYSIAVVGFNADNPKGYGRLLIKNN-EIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
           A G    V+  +A +P GYGR++  N  ++  I E  DA+ +E  I   N+G    D   
Sbjct: 121 ANGAKATVLTAHAPDPTGYGRVIRGNQGQVEKIVEHKDASVDELAIAEVNTGTYCFDNEA 180

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIW 241
           + + L ++K      EYYL D+I   R  G++I++       E  G N+R  LS  E   
Sbjct: 181 LFEALAEVKNENAQGEYYLPDVIGILRQKGETISAYQTDSLSETMGVNDRVALSQAEAAM 240

Query: 242 QSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHV------FFGCGVSIENYVQIR 295
           + R   + M  GVT+I P+T ++S D  I  DTV+ P+         G    IE+  +I 
Sbjct: 241 RKRINEEWMRQGVTIIDPQTTYISADASIGQDTVLYPNTSIKGPSVIGEDCVIESGTEIA 300

Query: 296 AFSYLEGVHIGKKTI----------IGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
           + +   GVH+    I          IGPFA IR  + + +NVR+GNF E+KKA+I  GSK
Sbjct: 301 SATLGRGVHVCSSVISNSVVADGSSIGPFAHIRPGSDVGENVRVGNFVELKKASIGTGSK 360

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
           ++HL+YVGD+ VG +VN+G G +T NYDG +K+KT I + AF+GS S+LIAP+ IG+  +
Sbjct: 361 VSHLTYVGDAEVGSDVNVGCGVVTVNYDGKNKHKTIIKDGAFVGSGSNLIAPVEIGERAF 420

Query: 406 VASGSIITQDTPENSLVFARSRQIVKED 433
           VA+GS IT D P  +L  ARSRQ+ K++
Sbjct: 421 VAAGSTITDDVPSQALSIARSRQVNKDN 448


>gi|27364456|ref|NP_759984.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Vibrio vulnificus CMCP6]
 gi|81587880|sp|Q8DDG6|GLMU_VIBVU RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|27360575|gb|AAO09511.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Vibrio vulnificus CMCP6]
          Length = 453

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 166/444 (37%), Positives = 262/444 (59%), Gaps = 30/444 (6%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI-TRIN 65
           A++LAAG+G RM S+  KVL  +AGKPM+ HV++T    G +N+ LV G+G +++   + 
Sbjct: 5   AVILAAGKGTRMYSNMPKVLHTLAGKPMVKHVIDTCTGLGAQNIHLVYGHGGDQMQAALA 64

Query: 66  FPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAMDK 122
             P   V + +Q  Q GT HAV    D   P ++D   ++++YGDVPL+SS T++  +D 
Sbjct: 65  EEP---VNWVLQAEQLGTGHAV----DQASPQFEDDEKILVLYGDVPLISSETIESLLDA 117

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLY 182
             +G  IA++    DNP GYGR++ KN  ++AI E+ DA +E++ I   N+G+M   G  
Sbjct: 118 QPKG-GIALLTVVLDNPTGYGRIVRKNGPVVAIVEQKDANEEQKLIKEINTGVMVATGGD 176

Query: 183 IMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIW 241
           +  WL  +  +    EYYLTD+I  A  +G ++ ++  V   EV G N+R +L+ +E  +
Sbjct: 177 LKRWLAGLNNDNAQGEYYLTDVIAAAHDEGNAVEAVHPVSPIEVEGVNDRAQLARLERAF 236

Query: 242 QSRYRRQMMISGVTMIAPETVFLSH------DTIIQPDTVIEPHVFFGCGV--------- 286
           Q+   ++++  GV +  P    L        D  I  + +IE +V  G  V         
Sbjct: 237 QAAQAKKLLEQGVMLRDPARFDLRGELQCGLDVEIDVNVIIEGNVSLGDNVVIGAGCVLK 296

Query: 287 --SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGS 344
              I++   +R +S +EG  +G++  +GPF R+R    +  +  +GNF EVK A I EGS
Sbjct: 297 DCEIDDNTIVRPYSVIEGATVGEQCTVGPFTRLRPGAEMRNDSHVGNFVEVKNARIGEGS 356

Query: 345 KINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGT 404
           K NHL+Y+GD+ +G+  NIGAGTITCNYDG +K+KT I  + F+GS+S L+AP+TI  G 
Sbjct: 357 KANHLTYLGDAEIGQRTNIGAGTITCNYDGANKFKTIIGNDVFVGSDSQLVAPLTIADGA 416

Query: 405 YVASGSIITQDTPENSLVFARSRQ 428
            + +G+ +T+D  E  LV  R+++
Sbjct: 417 TIGAGTTLTKDVAEGELVITRAKE 440


>gi|220936458|ref|YP_002515357.1| UDP-N-acetylglucosamine pyrophosphorylase / diamine
           N-acetyltransferase [Thioalkalivibrio sp. HL-EbGR7]
 gi|254798819|sp|B8GRB6|GLMU_THISH RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|219997768|gb|ACL74370.1| UDP-N-acetylglucosamine pyrophosphorylase / diamine
           N-acetyltransferase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 459

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 169/444 (38%), Positives = 261/444 (58%), Gaps = 28/444 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM+SS  KVLQ +AG+P++SHV++T  +     + +V G+G + + R  FP
Sbjct: 8   LILAAGQGTRMRSSLPKVLQPLAGRPLLSHVLDTARSLDPHRLVVVYGHGGDRV-REAFP 66

Query: 68  PTLSVEYYIQDCQQGTAHAV---LTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIA 124
               + +  Q  Q+GT HAV   L   DA     D V+I+YGDVPLV   T+++ + ++ 
Sbjct: 67  ED-DIRWVHQAEQRGTGHAVQVALPETDA----DDRVLILYGDVPLVRGETVRRLLAQLD 121

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNN-EIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
           +G  + ++     +P GYGR+L  ++  +  I EE DA+D ER+++  N+G+MA      
Sbjct: 122 EGGDLVILTAALKSPTGYGRILRDDSGRVQRIVEEKDASDSERRVNEVNTGIMAARASDF 181

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQ 242
             WL ++  +    E+YLTD +  A  +G+ + ++   E  E+ G N++ +L+  E  +Q
Sbjct: 182 TRWLSKVTNDNAQGEFYLTDCVALANTEGRRVEAVVGHEAIELMGVNDKRQLAEQERAYQ 241

Query: 243 SRYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGV---------- 286
            R   ++M+ GVT+I P        V    D  +  + +++  V  G G           
Sbjct: 242 RREAERLMVQGVTVIDPARLDVRGEVEAGRDVSLDINVILQGSVKLGEGAKVGAGCVIID 301

Query: 287 -SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
             I     I   + +EG  IG    +GPFARIR  T  + N +IGNF EVK A + EGSK
Sbjct: 302 SEIGPGAHILPHTVIEGAVIGAGASVGPFARIRPGTHTDSNAKIGNFVEVKNARVGEGSK 361

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
           INHLSYVGDS +G++VNIGAGTITCNYDG +K+KT I + AFIGSN++L+AP+T+G+G  
Sbjct: 362 INHLSYVGDSELGRDVNIGAGTITCNYDGANKHKTIIGDRAFIGSNTALVAPLTVGEGAT 421

Query: 406 VASGSIITQDTPENSLVFARSRQI 429
           + +G+ + +D P   L  AR++ I
Sbjct: 422 IGAGTTLNKDAPPGELTVARAKAI 445


>gi|332308203|ref|YP_004436054.1| UDP-N-acetylglucosamine pyrophosphorylase [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332175532|gb|AEE24786.1| UDP-N-acetylglucosamine pyrophosphorylase [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 453

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 170/439 (38%), Positives = 258/439 (58%), Gaps = 22/439 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RMKSS  KVL  I  KPM+  +++T+   G  ++ LV G+ AE++ +    
Sbjct: 6   VILAAGKGTRMKSSMPKVLHPIGAKPMVQRIIDTVNQLGARSINLVYGHQAEQLQQALAH 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HAV    D I+   +DV+I+ GD PL+ ++TL   +   AQ  
Sbjct: 66  NKLN--WCLQAEQLGTGHAVQQTVDYIQD-EEDVLILVGDAPLIKANTLHNLLQTKAQA- 121

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            +A++  +  +P G GR++ +   + AI E  DA+D +R+I   N+G+M ++G  +  WL
Sbjct: 122 DVALLTVDVADPTGMGRIIRQGENVTAIVEHKDASDAQRQIREINTGMMVLNGKDLKRWL 181

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSI-ASIDVKEQEVCGCNNRYELSLIENIWQSRYR 246
             +  N    E+YLTD+IE A  +GK I A+    E EV G NNR +L+ IE  +Q    
Sbjct: 182 ANLNSNNAQGEFYLTDVIEMAANEGKVIKAAQPSSEIEVEGINNRKQLAAIERAFQFEQA 241

Query: 247 RQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQI------------ 294
            ++M+ GV+++ P    L  D I+  D VI+ +V     V I + V I            
Sbjct: 242 EELMMQGVSLLDPHRFDLRGDLIVGQDIVIDVNVVIEGTVKIGSNVTIGPNCILKDCEVA 301

Query: 295 -----RAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
                 A S L+  H+G+   +GP+AR+R    + +N R+GNF E+KK+T+ +GSK NHL
Sbjct: 302 DGATIEANSMLDQAHVGENCSVGPYARLRPGAVMHENARVGNFVEMKKSTLGKGSKANHL 361

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ VG   NIGAGTITCNYDG +K KT I + AFIGSNS+L+AP+ IG    V +G
Sbjct: 362 TYLGDTTVGVGANIGAGTITCNYDGVNKSKTIIGDGAFIGSNSALVAPVQIGNMATVGAG 421

Query: 410 SIITQDTPENSLVFARSRQ 428
           S++T+   +  L  AR++Q
Sbjct: 422 SVVTKTVGDEELAIARAKQ 440


>gi|326790207|ref|YP_004308028.1| UDP-N-acetylglucosamine pyrophosphorylase [Clostridium lentocellum
           DSM 5427]
 gi|326540971|gb|ADZ82830.1| UDP-N-acetylglucosamine pyrophosphorylase [Clostridium lentocellum
           DSM 5427]
          Length = 454

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 175/461 (37%), Positives = 270/461 (58%), Gaps = 27/461 (5%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           MK K  A++LAAG+G RMKS+ SKVL K+ GK ++ + +    A G+E V L++G+ AE+
Sbjct: 1   MKTK--ALILAAGQGTRMKSNGSKVLHKVFGKSLVEYPILAAKAVGVEEVCLIVGHKAED 58

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           +          V Y +Q  Q GT HAV+ A D I+   D+V+I+ GD PLV+  TL+  +
Sbjct: 59  VKN---ALGEDVSYVLQKEQLGTGHAVMQAMDFIESA-DEVLILCGDTPLVTGETLQDML 114

Query: 121 D-KIAQGYSIAVVGFNADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNSGLMAI 178
           D       +I V+    D+P GYGR++   N  ++ I E+ DAT+EE+ I   N G+ A 
Sbjct: 115 DFHHHNNNAITVLSAMMDDPTGYGRIVRDANGNLVKIVEQKDATEEEKAIKEINGGMYAF 174

Query: 179 DGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLI 237
           D   +   L ++  N V  EYYLTD IE    DG  + +I  +E  ++ G N+R +L+ +
Sbjct: 175 DAKLLKYALSKLTNNNVQNEYYLTDTIEILLKDGHKVNAIATREADDIAGVNSRVQLAAV 234

Query: 238 ENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFF--------GCGV--- 286
             + + R   + M +GVT I P + ++  D II  DT+IEP            GC +   
Sbjct: 235 TEVMKKRINEKHMANGVTFIDPMSTYIELDVIIGKDTIIEPGCMLEGKTAIGEGCRIGYH 294

Query: 287 ------SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATI 340
                 ++ + V++   S +    + + T +GPFA IR  + I KN+++G+F E+K A I
Sbjct: 295 SKLKNTTLADQVEVE-ISVITDSFVDEGTHVGPFAYIRPNSHIGKNIKVGDFVEIKNANI 353

Query: 341 KEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITI 400
            +G+KI+HL+YVGD+ VGKNVN G G++  NYDG  K++T I +NAFIG N++L++P+T+
Sbjct: 354 GDGTKISHLTYVGDADVGKNVNFGCGSVVVNYDGQKKHRTIIGDNAFIGCNTNLVSPVTV 413

Query: 401 GQGTYVASGSIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
               Y A+GS IT+  P++SL  AR++Q  KE+     R+K
Sbjct: 414 EDNAYTAAGSTITKTVPKDSLAIARAKQENKENWVAKKRQK 454


>gi|269124171|ref|YP_003306748.1| UDP-N-acetylglucosamine pyrophosphorylase [Streptobacillus
           moniliformis DSM 12112]
 gi|268315497|gb|ACZ01871.1| UDP-N-acetylglucosamine pyrophosphorylase [Streptobacillus
           moniliformis DSM 12112]
          Length = 450

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 168/458 (36%), Positives = 269/458 (58%), Gaps = 35/458 (7%)

Query: 6   LAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRIN 65
           ++I+LAAG+G RMKS+ SK++ K+ G+PMI  ++ T+  AG++   L+LGY  E+I  + 
Sbjct: 6   ISIILAAGKGTRMKSNISKLMHKVNGQPMIVKLVNTLNKAGLKKNILILGYLKEQILEV- 64

Query: 66  FPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQ 125
               L  EY IQ+ Q GT HAV+ A++ I    DD++I  GD PL++  T+ K  +K  +
Sbjct: 65  ----LDNEYVIQEEQLGTGHAVIIAKNKILENDDDILICNGDGPLLTVETINKMKEKFEK 120

Query: 126 -GYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
                 ++    +NP GYGR++ +N ++  I EE DAT E++ I   N+G+       ++
Sbjct: 121 DSLDCLILSCEVNNPFGYGRIIKENGKVTNIIEEVDATVEQKNIKEINAGVYLFKKTSLL 180

Query: 185 DWLLQIKKNKVSQEYYLTDII-----EKARLDGKSIASIDVKEQEVCGCNNRYELSLIEN 239
             L +   +   +EYYLTD +     EK ++D   +      E+E+ G N++ +L+ +  
Sbjct: 181 SILDKFNNDNKKREYYLTDAVKLLNEEKLKVDSLVLED----EKEMLGVNSKSQLAEVSK 236

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSY 299
           I + +   ++M SG  +I P   ++  D +I  DT+I P+V+   G  I N   I + + 
Sbjct: 237 ILREKKNEELMKSGTILIDPNNTYIEEDVVIGEDTIIYPNVYIEKGTRIGNNCIIHSGTR 296

Query: 300 LEGVHIGKKTII----------------GPFARIRQETTIEKNVRIGNFCEVKKATIKEG 343
           +E   IG    I                GPFA IR  + +++  +IGNF E+KK+T+ +G
Sbjct: 297 IENSIIGNNVTIDNSVVELSVIEDNVSIGPFAHIRPNSLLKEKSKIGNFVEIKKSTLHKG 356

Query: 344 SKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQG 403
            K  HL+Y+GDS +G+N NIGAGTITCNYDG+ K+KT+I +N FIGSNS +++P+ IG+ 
Sbjct: 357 VKCGHLTYIGDSEIGENTNIGAGTITCNYDGSKKHKTNIGKNCFIGSNSIIVSPVEIGEN 416

Query: 404 TYVASGSIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
              A+GS+IT+D P +S+ F R++Q+ K    + M KK
Sbjct: 417 VLTAAGSVITKDIPNDSIAFGRAKQVNK----IGMNKK 450


>gi|187733747|ref|YP_001882433.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Shigella boydii CDC 3083-94]
 gi|254798802|sp|B2TUP5|GLMU_SHIB3 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|187430739|gb|ACD10013.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Shigella boydii CDC 3083-94]
          Length = 456

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 168/452 (37%), Positives = 267/452 (59%), Gaps = 22/452 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGK M+ HV++     G  +V LV G+G + + +    
Sbjct: 9   VILAAGKGTRMYSDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGGDLLKQALKD 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HA+  A        +D++++YGDVPL+S  TL++  D   QG 
Sbjct: 69  DNLN--WVLQAEQLGTGHAMQQAAPFFADD-EDILMLYGDVPLISVETLQRLRDAKPQG- 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    D+P GYGR+  +N ++  I E  DATDE+R+I   N+G++  +G  +  WL
Sbjct: 125 GIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIANGADMKRWL 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSRYR 246
            ++  N    EYY+TDII  A  +G+ I ++  +   EV G NNR +LS +E ++QS   
Sbjct: 185 AKLTNNNAQGEYYITDIIALAYQEGREIVAVHPQRLSEVEGVNNRLQLSRLERVYQSEQA 244

Query: 247 RQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFG------CGVSIENYV-- 292
            +++++GV +  P   +L        D  I  + +IE +V  G       G  I+N V  
Sbjct: 245 EKLLLAGVMLRDPARFYLRGTLTHGRDVEIDTNVIIEGNVTLGHRVKIGTGCVIKNSVIG 304

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +I  ++ +E V++     IGPFAR+R    + +   +GNF E+KKA + +GSK  HL
Sbjct: 305 DDCEISPYTVVEDVNLAAACTIGPFARLRPGAELLEGAHVGNFVEMKKARLGKGSKAGHL 364

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+G+G  +A+G
Sbjct: 365 TYLGDAEIGDNVNIGAGTITCNYDGANKFKTIIGDDVFVGSDTQLVAPVTVGKGATIAAG 424

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + +T++  EN+L  +R  Q  KE     ++KK
Sbjct: 425 TTVTRNVGENALAISRVPQTQKEGWRRPVKKK 456


>gi|260771025|ref|ZP_05879953.1| N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           N-acetyltransferase [Vibrio furnissii CIP 102972]
 gi|260613914|gb|EEX39105.1| N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           N-acetyltransferase [Vibrio furnissii CIP 102972]
          Length = 453

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 165/443 (37%), Positives = 260/443 (58%), Gaps = 28/443 (6%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG+G RM S+  KVL  +AGKPM  HV++T  + G  N+ LV G+G +++ +   
Sbjct: 5   AVILAAGKGTRMHSNMPKVLHTLAGKPMAKHVIDTCNSLGAHNIHLVYGHGGDQMKQA-- 62

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAMDKI 123
               +V + +Q  Q GT HAV    D   P ++D   ++++YGDVPL+S  T+   +D  
Sbjct: 63  LADENVNWVLQAEQLGTGHAV----DQASPQFEDDEKILVLYGDVPLISEETIDSLLDAQ 118

Query: 124 AQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
             G  IA++    DNP GYGR++ KN  ++AI E+ DAT+E++ I   N+G+M   G  +
Sbjct: 119 PTG-GIALLTVVLDNPTGYGRIVRKNGPVVAIVEQKDATEEQKLIKEINTGVMVATGGDL 177

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQ 242
             WL  +  N    EYYLTD+I  A  +G+++ ++  V   EV G N+R +L+ +E  +Q
Sbjct: 178 KRWLAGLNNNNAQGEYYLTDVIAAAHNEGRAVEAVHPVSSIEVEGVNDRIQLARLERAFQ 237

Query: 243 SRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQI-------- 294
           +R   +++  GV +  P    L  +     D  I+ +V     VSI N V I        
Sbjct: 238 ARQANKLLEQGVMLRDPARFDLRGELQCGTDVEIDVNVIIEGSVSIGNNVVIGAGSILKD 297

Query: 295 ---------RAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
                    R +S +EG  +G+   +GPF+R+R    ++ +  +GNF EVK A + +GSK
Sbjct: 298 CEIDDNTVIRPYSVIEGATVGEDCTVGPFSRLRPGAELQNDAHVGNFVEVKNARLGQGSK 357

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
            NHL+Y+GD+ +G+ VNIGAG ITCNYDG +K+KT I ++ F+GS+S L+AP+TI  G  
Sbjct: 358 ANHLTYLGDAEIGQRVNIGAGAITCNYDGANKHKTVIGDDVFVGSDSQLVAPVTIANGAT 417

Query: 406 VASGSIITQDTPENSLVFARSRQ 428
           + +G+ +T++  E  LV  R+++
Sbjct: 418 IGAGTTLTRNVGEGELVITRAKE 440


>gi|261341614|ref|ZP_05969472.1| hypothetical protein ENTCAN_08080 [Enterobacter cancerogenus ATCC
           35316]
 gi|288315969|gb|EFC54907.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Enterobacter cancerogenus ATCC
           35316]
          Length = 456

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 171/453 (37%), Positives = 264/453 (58%), Gaps = 24/453 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++     G   V LV G+G + +      
Sbjct: 9   VILAAGKGTRMYSDLPKVLHTLAGKPMVQHVIDAANEVGARQVHLVYGHGGDLLKETLRD 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYD-DVIIMYGDVPLVSSHTLKKAMDKIAQG 126
             L+  + +Q  Q GT HA+   Q A   G D D++++YGDVPL+S  TL +  +   QG
Sbjct: 69  DKLN--WVLQAEQLGTGHAM--QQAAPFFGDDEDILMLYGDVPLISVETLTRLREAKPQG 124

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
             I ++    D+P GYGR+  +N  +  I E  DA+DE+RKI   N+G++  +G  +  W
Sbjct: 125 -GIGLLTVVLDDPTGYGRITRENGNVTGIVEHKDASDEQRKIQEINTGILIANGADMKRW 183

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQSRY 245
           L ++  N    EYY+TDII  A  +G+ IA++   +  E  G NNR +LS +E I+Q+  
Sbjct: 184 LSKLNNNNAQGEYYITDIIAMAYQEGREIAAVHPARISETDGVNNRLQLSRLERIYQAEQ 243

Query: 246 RRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG------CGVSIENYV- 292
             +++++GV +  P       T+    D  I  + ++E  V  G       G  I+N V 
Sbjct: 244 AEKLLLAGVMLRDPARFDLRGTLAHGRDVEIDTNVILEGQVQLGNRVKIGAGCVIKNSVI 303

Query: 293 ----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
               +I  +S +E  H+     IGPFAR+R    + +   +GNF E+KKA + +GSK  H
Sbjct: 304 GDDCEISPYSVVEDAHLEAACTIGPFARLRPGAELMEGAHVGNFVEMKKARLGKGSKAGH 363

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           L+Y+GD+ +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+G G  +A+
Sbjct: 364 LTYLGDAEIGDNVNIGAGTITCNYDGANKFKTIIGDDVFVGSDTQLVAPVTVGNGVTIAA 423

Query: 409 GSIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           G+ +T+D  +N LV +R  Q+ K+     ++KK
Sbjct: 424 GTTVTRDVADNELVLSRVPQVHKQGWKRPVKKK 456


>gi|147676439|ref|YP_001210654.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Pelotomaculum thermopropionicum SI]
 gi|189041287|sp|A5D662|GLMU_PELTS RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|146272536|dbj|BAF58285.1| N-acetylglucosamine-1-phosphate uridyltransferase [Pelotomaculum
           thermopropionicum SI]
          Length = 457

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 180/466 (38%), Positives = 263/466 (56%), Gaps = 44/466 (9%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAGRG RMKS   KVL ++ G+PM+S+++  +AAAGI+ + +V GYGAE++ R   
Sbjct: 5   AVILAAGRGTRMKSKLPKVLHRVCGRPMLSYIVNAVAAAGIKKIVVVAGYGAEQVAR--- 61

Query: 67  PPTLSVE----YYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKK-AMD 121
                VE      +Q  Q GTAHA+L A   +      V+++ GD PL+ + TL K A  
Sbjct: 62  ----EVEGLAQVALQAEQLGTAHALLQAGPFLSGFAGKVLVLCGDTPLIEAGTLAKLAGF 117

Query: 122 KIAQGYSIAVVGFNADNPKGYGRLLIKN-NEIIAIREENDATDEERKIHYCNSGLMAIDG 180
               G +  ++    D+P GYGR++      +I I EE DA+  E+ I   N+G+   + 
Sbjct: 118 HRTAGAAATLLTAEPDDPAGYGRVIRDGRGNVIKIVEEKDASPAEKLIREINTGIYCFEA 177

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIEN 239
             + D L  I+      EYYLTDI+E     G ++A+  ++   EV G N+R +L+ +E 
Sbjct: 178 AGLFDALKGIRPANAQGEYYLTDIVEIYVRAGLAVAAFKLENPVEVTGINDRRQLAEVEK 237

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFF----------------- 282
             + R    +M SGVT++ P + F+     +  DTVI P  F                  
Sbjct: 238 YLRRRVLEDLMQSGVTVLDPASTFVDGTVRVGRDTVIYPFTFLEGSTIIGEDCVIGPGSR 297

Query: 283 ------GCGVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVK 336
                 G GVS++N V I +        IG    IGPFA +R ET + +NV++G+F E+K
Sbjct: 298 LVNAVVGNGVSVQNSVVIES-------QIGDCCSIGPFAYLRPETRLGRNVKVGDFVEIK 350

Query: 337 KATIKEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIA 396
           K+ I +GSK+ HLSYVGD+ VG  VNIG GTITCNYDG +K+ T I + AFIGSN++L+A
Sbjct: 351 KSVIGDGSKVPHLSYVGDATVGAGVNIGCGTITCNYDGRNKWPTRIGDGAFIGSNTNLVA 410

Query: 397 PITIGQGTYVASGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           P+ IG G    +GS IT++ P+ +L   R+RQ++  D A   R KK
Sbjct: 411 PVEIGAGAVTGAGSTITKNVPDGALAVERARQVLVPDWAAKKRDKK 456


>gi|304412685|ref|ZP_07394288.1| UDP-N-acetylglucosamine pyrophosphorylase [Shewanella baltica
           OS183]
 gi|307305850|ref|ZP_07585596.1| UDP-N-acetylglucosamine pyrophosphorylase [Shewanella baltica
           BA175]
 gi|304348895|gb|EFM13310.1| UDP-N-acetylglucosamine pyrophosphorylase [Shewanella baltica
           OS183]
 gi|306911343|gb|EFN41769.1| UDP-N-acetylglucosamine pyrophosphorylase [Shewanella baltica
           BA175]
          Length = 460

 Score =  308 bits (788), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 172/445 (38%), Positives = 259/445 (58%), Gaps = 28/445 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM+S   KVL  IA K M+ HV++T    G + + LV GYGA+++      
Sbjct: 6   VILAAGKGTRMRSDLPKVLHPIAHKSMVQHVIDTAHKVGSDAIQLVYGYGADKLQASLGE 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HAV  A   I    D V+I+YGDVPL+   TL+  +    +  
Sbjct: 66  QQLN--WVLQAEQLGTGHAVAQASPHIADN-DTVLILYGDVPLIQQSTLEALLAARPEN- 121

Query: 128 SIAVVGFNADNPKGYGRLL------IKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
            +A++  N  NP GYGR++       +  +++ I E+ DAT E+  I+  N+G+MA+ G 
Sbjct: 122 GVAILTVNLANPMGYGRIVRTPCEGQEQGKVVGIIEQKDATAEQLLINEINTGIMAVPGK 181

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENI 240
            +  WL ++  N    EYYLTDII  A  DG +I +   +   EV G NNR +L+ +E  
Sbjct: 182 QLKAWLSRLSNNNAQGEYYLTDIIAMAHADGVAIDTAQPQSAIEVEGANNRVQLAQLERA 241

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV-------- 292
           +Q+R   ++M++G  +  P  + +  D  +  D +I+ +V F   V++ N V        
Sbjct: 242 YQAREAEKLMLAGANLRDPSRIDIRGDVTVGMDVMIDINVIFEGKVTLGNNVTIGAGAIL 301

Query: 293 ---------QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG 343
                    +I+ +S +EG  +G     GPFAR+R    ++++  IGNF EVKKA I  G
Sbjct: 302 IDCEIADNAEIKPYSIIEGAKLGVAASAGPFARLRPGAELKQDAHIGNFVEVKKAVIGVG 361

Query: 344 SKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQG 403
           SK  HL+Y+GD+V+G  VNIGAGTITCNYDG +K+ T I +N F+GS++ L+AP+TIG+G
Sbjct: 362 SKAGHLAYLGDAVIGDGVNIGAGTITCNYDGANKHLTVIEDNVFVGSDTQLVAPVTIGKG 421

Query: 404 TYVASGSIITQDTPENSLVFARSRQ 428
             + +GS IT+D  EN LV  R +Q
Sbjct: 422 ATLGAGSTITRDVGENELVITRVKQ 446


>gi|238759560|ref|ZP_04620722.1| Glucosamine-1-phosphate N-acetyltransferase [Yersinia aldovae ATCC
           35236]
 gi|238702219|gb|EEP94774.1| Glucosamine-1-phosphate N-acetyltransferase [Yersinia aldovae ATCC
           35236]
          Length = 431

 Score =  308 bits (788), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 161/426 (37%), Positives = 255/426 (59%), Gaps = 28/426 (6%)

Query: 25  VLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFPPTLSVEYYIQDCQQGTA 84
           +L  +AGKPM+ HV++     G +NV LV G+G E + +I   P+L+  + +Q  Q GT 
Sbjct: 1   MLHPLAGKPMVQHVIDAAMKLGAQNVHLVYGHGGELLQKILSDPSLN--WVLQAEQLGTG 58

Query: 85  HAVLTAQDAIKPGY---DDVIIMYGDVPLVSSHTLKKAMDKIAQGYSIAVVGFNADNPKG 141
           HA+  A     P +   +DV+++YGDVPL+S  TL++ +    QG  I ++    DNP G
Sbjct: 59  HAMQQA----APHFADDEDVLMLYGDVPLISVDTLQRLLAAKPQG-GIGLLTVKLDNPSG 113

Query: 142 YGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWLLQIKKNKVSQEYYL 201
           YGR++ +N +++ I E  DA+D +R+I+  N+G++  +G  +  WL  +  N    E+Y+
Sbjct: 114 YGRIVRENGDVVGIVEHKDASDAQREINEINTGILVANGRDLKRWLSLLDNNNAQGEFYI 173

Query: 202 TDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQSRYRRQMMISGVTMIAPE 260
           TDII  A  DGK IA++   +  EV G NNR +L+ +E ++QS    +++++GV ++ P 
Sbjct: 174 TDIIALAHADGKKIATVHPARLSEVEGVNNRLQLAALERVYQSEQAEKLLLAGVMLLDPA 233

Query: 261 TVFL------SHDTIIQPDTVIEPHVFFG------CGVSIENYV-----QIRAFSYLEGV 303
              L        D  I  + +IE HV  G       G  ++N V     +I  +S LE  
Sbjct: 234 RFDLRGELTHGRDITIDTNVIIEGHVTLGDRVRIGTGCVLKNCVIGDDSEISPYSVLEDS 293

Query: 304 HIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNI 363
            +     +GPFAR+R    + +   +GNF E+KKA + +GSK  HLSY+GD+ +G  VNI
Sbjct: 294 RLDAGCTVGPFARLRPGAELAEGAHVGNFVEIKKARLGKGSKAGHLSYLGDAEIGSGVNI 353

Query: 364 GAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVF 423
           GAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+  G  +A+G+ +T+D  EN LV 
Sbjct: 354 GAGTITCNYDGANKFKTIIGDDVFVGSDTQLVAPVTVANGATIAAGTTVTRDIAENELVL 413

Query: 424 ARSRQI 429
           +R +Q+
Sbjct: 414 SRVKQV 419


>gi|170729213|ref|YP_001763239.1| UDP-N-acetylglucosamine pyrophosphorylase [Shewanella woodyi ATCC
           51908]
 gi|254798801|sp|B1KQ31|GLMU_SHEWM RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|169814560|gb|ACA89144.1| UDP-N-acetylglucosamine pyrophosphorylase [Shewanella woodyi ATCC
           51908]
          Length = 454

 Score =  308 bits (788), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 167/439 (38%), Positives = 256/439 (58%), Gaps = 22/439 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM+S   KVL  IA K M+ HV++T    G + + LV GYG E++  +   
Sbjct: 6   VILAAGKGTRMRSDLPKVLHPIAHKSMVQHVIDTAHNVGSDAIQLVYGYGGEKLQSVLGE 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HAV  A   I    D V+I+YGDVPL+ + TL+ A+    +  
Sbjct: 66  QQLN--WVLQAEQLGTGHAVAQANSNIADD-DTVLILYGDVPLIQASTLE-ALLAAREEN 121

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            +A++  N  NP GYGR++ + N+++ I E+ DA  E+  I+  N+G+MA  G  +  WL
Sbjct: 122 GLAILTVNLPNPTGYGRIVREANKVVGIIEQKDANAEQLAINEINTGIMAAPGKQLKAWL 181

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRYR 246
            Q+  N    EYYLTDI+  A  DG +I +       EV G NNR +L+ +E  +Q+R  
Sbjct: 182 GQLSSNNAQGEYYLTDIVAMAHRDGVAITTAQPDSAIEVEGANNRVQLAQLERAYQARAA 241

Query: 247 RQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV-------------- 292
            ++M+ G  +  P  + +  +  +  D +I+ +V     V+I N V              
Sbjct: 242 EKLMLEGANLRDPARIDIRGEVSVGMDVMIDVNVIMQGKVTIGNNVTIGAGAILIDCEIS 301

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +I+ +S +E   +G +   GPFAR+R    ++++  IGNF E+KKA + EGSK  HL
Sbjct: 302 DNAEIKPYSIVESAKVGAEASAGPFARLRPGAELKRDAHIGNFVEMKKAVLGEGSKAGHL 361

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G  VNIGAGTITCNYDG +K+ T I +N F+GS++ L+AP+TIG+G  + +G
Sbjct: 362 AYIGDAQIGSGVNIGAGTITCNYDGANKHLTVIEDNVFVGSDTQLVAPVTIGKGATLGAG 421

Query: 410 SIITQDTPENSLVFARSRQ 428
           S IT+D   + LV  R +Q
Sbjct: 422 STITKDVAADELVITRVKQ 440


>gi|53802689|ref|YP_112555.1| UDP-N-acetylglucosamine pyrophosphorylase [Methylococcus capsulatus
           str. Bath]
 gi|81683267|sp|Q60CR2|GLMU_METCA RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|53756450|gb|AAU90741.1| UDP-N-acetylglucosamine pyrophosphorylase [Methylococcus capsulatus
           str. Bath]
          Length = 461

 Score =  308 bits (788), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 173/450 (38%), Positives = 265/450 (58%), Gaps = 30/450 (6%)

Query: 6   LAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE-ITRI 64
           +A++LAAG+G RM+S   KVL +I G  ++ HV    AA  +    +V G+G E+ ++ +
Sbjct: 4   IALILAAGQGTRMRSGLPKVLHRIGGLCLLEHVYRLAAALEVRETVIVYGHGGEQALSAL 63

Query: 65  NFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD--VIIMYGDVPLVSSHTLKKAMDK 122
              P   +E   Q  ++GT HAV+ A D I    DD  V+++YGDVPL+   T++  +  
Sbjct: 64  GHLPATWIE---QKKRRGTGHAVMQAVDRIG---DDSTVLVLYGDVPLLRRETVETLLHH 117

Query: 123 IAQGYSIAVVGFNADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
             +  S+ ++    DNP GYGR++   +  ++ I EE DAT EER +   N+G++A++G 
Sbjct: 118 AGES-SLGLLTVELDNPTGYGRIIRDASGRVLRIVEEKDATPEERAVREVNTGILAVEGA 176

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSI-ASIDVKEQEVCGCNNRYELSLIENI 240
            +  WL  ++ +    EYYLTDI+  A  +G  I A+      EV G N+R +L+ +E I
Sbjct: 177 PLKRWLKALRNDNAQGEYYLTDIVAMAVAEGYFIDATHPTSPDEVLGVNDRRQLAELERI 236

Query: 241 WQSRYRRQMMISGVTMIAP-------ETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQ 293
           +Q    R +M  GVT+  P       E V L  D  I  + ++E  +  G  V I   V 
Sbjct: 237 YQVHQARALMERGVTLRDPARFDLRGEIVELGRDVEIDVNVILEGRIALGDEVRIGPNVY 296

Query: 294 IR-----------AFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKE 342
           ++           A S +EG  IG  + +GPFAR+R E+ + + V IGNF EVK++ I  
Sbjct: 297 LKDTVIGPGVAVLANSVIEGAVIGAGSRVGPFARLRPESVLAEGVHIGNFVEVKQSDIAV 356

Query: 343 GSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQ 402
           GSK+NHLSY+GD+ +G+ VN+GAGTITCNYDG  K++T I + AFIGS++ L+AP+ +G+
Sbjct: 357 GSKVNHLSYIGDASIGRGVNVGAGTITCNYDGVAKHRTIIEDGAFIGSDTQLVAPVRVGR 416

Query: 403 GTYVASGSIITQDTPENSLVFARSRQIVKE 432
              + +GS IT+DTPE+ L  +R+RQ+  E
Sbjct: 417 NATIGAGSTITRDTPEDCLTLSRARQLSVE 446


>gi|24376217|ref|NP_720261.1| UDP-N-acetylglucosamine pyrophosphorylase [Shewanella oneidensis
           MR-1]
 gi|81588955|sp|Q8E8C2|GLMU_SHEON RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|24351277|gb|AAN57704.1|AE015907_2 UDP-N-acetylglucosamine pyrophosphorylase [Shewanella oneidensis
           MR-1]
          Length = 454

 Score =  308 bits (788), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 170/442 (38%), Positives = 258/442 (58%), Gaps = 28/442 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM+S   KVL  IA K M+ HV++T  + G + + LV GYGA+++      
Sbjct: 6   VILAAGKGTRMRSDLPKVLHPIAHKSMVQHVIDTAHSIGSDAIQLVYGYGADKLKSTLGE 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAMDKIA 124
             L+  + +Q  Q GT HAV  A     P  DD   V+I+YGDVPL+ + TL+  +    
Sbjct: 66  QKLN--WILQAEQLGTGHAVAQA----IPNIDDNDTVLILYGDVPLIQASTLEALLAARP 119

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
           + Y +A++  N  NP GYGR++ +  +++ I E+ DA  E+  I+  N+G+MA+ G  + 
Sbjct: 120 E-YGVAILTVNLANPMGYGRIVREQGKVVGIVEQKDANPEQLAINEVNTGIMAVPGNALK 178

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQS 243
            WL ++  N    EYYLTDII  A  DG  I +   +   EV G NNR +L+ +E  +Q+
Sbjct: 179 TWLDRLSNNNAQGEYYLTDIIAMAHADGVEINTAQPQSAIEVEGANNRVQLAQLERAYQA 238

Query: 244 RYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV----------- 292
           R   ++MI+G  +  P  + +  +  +  D +I+ +V F   V I N V           
Sbjct: 239 REAEKLMIAGANLRDPSRIDIRGEVTVGMDVMIDVNVIFEGKVVIGNNVTIGAGAIIIDT 298

Query: 293 ------QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
                 +I+ +S +EG  +G     GPFAR+R    + ++  IGNF E+KKA +  GSK 
Sbjct: 299 EIADNAEIKPYSIIEGAKLGVAASAGPFARLRPGAELMQDAHIGNFVEMKKAVLGVGSKA 358

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
            HL+Y+GD+ +G  VNIGAGTITCNYDG +K+ T I +N F+GS++ L+AP+TIG+G  +
Sbjct: 359 GHLAYLGDAQIGAGVNIGAGTITCNYDGANKHLTVIEDNVFVGSDTQLVAPVTIGKGATL 418

Query: 407 ASGSIITQDTPENSLVFARSRQ 428
            +GS IT+D  E+ LV  R +Q
Sbjct: 419 GAGSTITRDVGEDELVITRVKQ 440


>gi|160877606|ref|YP_001556922.1| UDP-N-acetylglucosamine pyrophosphorylase [Shewanella baltica
           OS195]
 gi|189041293|sp|A9KX04|GLMU_SHEB9 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|160863128|gb|ABX51662.1| UDP-N-acetylglucosamine pyrophosphorylase [Shewanella baltica
           OS195]
 gi|315269804|gb|ADT96657.1| UDP-N-acetylglucosamine pyrophosphorylase [Shewanella baltica
           OS678]
          Length = 460

 Score =  308 bits (788), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 172/445 (38%), Positives = 259/445 (58%), Gaps = 28/445 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM+S   KVL  IA K M+ HV++T    G + + LV GYGA+++      
Sbjct: 6   VILAAGKGTRMRSDLPKVLHPIAHKSMVQHVIDTAHKVGSDAIQLVYGYGADKLKASLGE 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HAV  A   I    D V+I+YGDVPL+   TL+  +    +  
Sbjct: 66  QQLN--WVLQAEQLGTGHAVAQASPHIADN-DTVLILYGDVPLIQQSTLEALLAARPEN- 121

Query: 128 SIAVVGFNADNPKGYGRLL------IKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
            +A++  N  NP GYGR++       +  ++I I E+ DAT E+  I+  N+G+MA+ G 
Sbjct: 122 GVAILTVNLANPMGYGRIVRTPCEGQEQGKVIGIIEQKDATAEQLLINEINTGIMAVPGK 181

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENI 240
            +  WL ++  N    EYYLTDII  A  DG +I +   +   EV G NNR +L+ +E  
Sbjct: 182 QLKAWLSRLSNNNAQGEYYLTDIIAMAHADGVAIDTAQPQSAIEVEGANNRVQLAQLERA 241

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV-------- 292
           +Q+R   ++M++G  +  P  + +  D  +  D +I+ +V F   V++ N V        
Sbjct: 242 YQAREAEKLMLAGANLRDPSRIDIRGDVTVGMDVMIDINVIFEGKVTLGNNVTIGAGAIL 301

Query: 293 ---------QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG 343
                    +I+ +S +EG  +G     GPFAR+R    ++++  IGNF EVKKA I  G
Sbjct: 302 IDCEIADNAEIKPYSIIEGAKLGVAASAGPFARLRPGAELKQDAHIGNFVEVKKAVIGVG 361

Query: 344 SKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQG 403
           SK  HL+Y+GD+++G  VNIGAGTITCNYDG +K+ T I +N F+GS++ L+AP+TIG+G
Sbjct: 362 SKAGHLAYLGDAIIGDGVNIGAGTITCNYDGANKHLTVIEDNVFVGSDTQLVAPVTIGKG 421

Query: 404 TYVASGSIITQDTPENSLVFARSRQ 428
             + +GS IT+D  EN LV  R +Q
Sbjct: 422 ATLGAGSTITRDVGENELVITRVKQ 446


>gi|218551263|ref|YP_002385055.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Escherichia fergusonii ATCC 35469]
 gi|254798764|sp|B7LK74|GLMU_ESCF3 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|218358805|emb|CAQ91462.1| fused N-acetyl glucosamine-1-phosphate uridyltransferase ;
           glucosamine-1-phosphate acetyl transferase [Escherichia
           fergusonii ATCC 35469]
          Length = 456

 Score =  308 bits (788), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 168/452 (37%), Positives = 266/452 (58%), Gaps = 22/452 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGK M+ HV++     G  +V LV G+G + + +    
Sbjct: 9   VILAAGKGTRMYSDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGGDLLKQALKD 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HA+  A        +D++++YGDVPL+S  TL++  D   QG 
Sbjct: 69  DNLN--WVLQAEQLGTGHAMQQAAPFFADD-EDILMLYGDVPLISVETLQRLRDAKPQG- 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    D+P GYGR+  +N ++  I E  DATDE+R+I   N+G++  +G  +  WL
Sbjct: 125 GIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIANGADMKRWL 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSRYR 246
            ++  N    EYY+TDII  A  +G+ I ++  +   EV G NNR +LS +E ++QS   
Sbjct: 185 AKLTNNNAQGEYYITDIIALAYQEGREIVAVHPQRLSEVEGVNNRLQLSRLERVYQSEQA 244

Query: 247 RQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG------CGVSIENYV-- 292
            +++++GV +  P       T+    D  I  + +IE +V  G       G  I+N V  
Sbjct: 245 EKLLLAGVMLRDPARFDLRGTLTHGRDVEIDTNVIIEGNVTLGHRVKIGTGCVIKNSVIG 304

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +I  ++ +E  H+     IGPFAR+R    + +   +GNF E+KKA + +GSK  HL
Sbjct: 305 DDCEISPYTVVEDAHLAAACTIGPFARLRPGAELLEGAHVGNFVEMKKARLGKGSKAGHL 364

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+G+G  +A+G
Sbjct: 365 TYLGDAEIGDNVNIGAGTITCNYDGANKFKTIIGDDVFVGSDTQLVAPVTVGKGATIAAG 424

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + +T++  EN+L  +R  Q  KE     ++KK
Sbjct: 425 TTVTRNVGENALAISRVPQTQKEGWRRPVKKK 456


>gi|119710816|gb|ABL96597.1| GlmU [Enterobacter sp. BL-2]
          Length = 456

 Score =  308 bits (788), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 170/455 (37%), Positives = 267/455 (58%), Gaps = 28/455 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL ++AGKPM+ HV++     G   V LV G+G + + +    
Sbjct: 9   VILAAGKGTRMYSDLPKVLHRLAGKPMVQHVIDAANELGARQVHLVYGHGGDLLKK---- 64

Query: 68  PTLS---VEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIA 124
            TLS   + + +Q  Q GT HA+  A        +D++++YGDVPL+S  TL +      
Sbjct: 65  -TLSDDALNWVLQAEQLGTGHAMQQAAPFFADD-EDILMLYGDVPLISVETLTRLRATKP 122

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
           QG  I ++    D+P GYGR+  +N  +  I E  DA+DE+R+I   N+G++  +G  + 
Sbjct: 123 QG-GIGLLTVVLDDPTGYGRITRENGHVTGIVEHKDASDEQRQIQEINTGILIANGADMK 181

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASID-VKEQEVCGCNNRYELSLIENIWQS 243
            WL ++  N    EYY+TDII  A  +G+ IA++   +  E  G NNR +LS +E I+QS
Sbjct: 182 RWLSKLNNNNAQGEYYITDIIAMAYHEGREIAAVHPARISETDGVNNRLQLSRLERIYQS 241

Query: 244 RYRRQMMISGVTMIAPETV----FLSHDTIIQPDT--VIEPHVFFG------CGVSIENY 291
               +++++G  +  P        LSH   ++ DT  ++E +V  G       G  I+N 
Sbjct: 242 EQAEKLLLAGAMLRDPARFDLRGTLSHGRDVEIDTNVILEGNVQLGNRVKIGAGCVIKNS 301

Query: 292 V-----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
           V     ++  +S +E  H+     IGPFAR+R    + +   +GNF E+KKA + +GSK 
Sbjct: 302 VIGDDCEVSPYSVVEDAHLDAACTIGPFARLRPGAELLEGAHVGNFVEMKKARLGKGSKA 361

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
            HL+Y+GD+ +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+G G  +
Sbjct: 362 GHLTYLGDAEIGDNVNIGAGTITCNYDGANKFKTIIGDDVFVGSDTQLVAPVTVGNGVAI 421

Query: 407 ASGSIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           A+G+ +T+D  +N LV +R  Q+ K+     ++KK
Sbjct: 422 AAGTTVTRDVADNELVLSRVPQVHKQGWKRPVKKK 456


>gi|134297978|ref|YP_001111474.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Desulfotomaculum reducens MI-1]
 gi|189041269|sp|A4J0P6|GLMU_DESRM RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|134050678|gb|ABO48649.1| UDP-N-acetylglucosamine pyrophosphorylase [Desulfotomaculum
           reducens MI-1]
          Length = 456

 Score =  308 bits (788), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 176/457 (38%), Positives = 272/457 (59%), Gaps = 30/457 (6%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG+G RMKS+  KVL ++ G+PM+SHV+ ++ AAG++   +V G+GAE++T    
Sbjct: 5   AVILAAGKGTRMKSNLPKVLHQLCGRPMLSHVLNSVVAAGVDKTVVVAGFGAEQVTDFVG 64

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIK--PGYDDVIIMYGDVPLVSSHTLKKAMDKIA 124
                V   +Q  Q GTAHA+L A+  +   PG+  ++++ GD PL+ + TL K  D   
Sbjct: 65  EKARVV---LQREQLGTAHALLQAEGELTDYPGH--LLVVCGDTPLLRAETLAKLADYHC 119

Query: 125 QGYSIAVVGFNAD--NPKGYGRLL-IKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
           +  ++A +   A+  +P GYGR++      +  I E+ DA+ EE  +H  N+G+      
Sbjct: 120 ESGAVATL-LTAEMADPTGYGRVIRTTEGNVSHIVEQKDASPEELNVHEINTGVYCFKVP 178

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENI 240
            + + L +I    V  EYYLTDII+     G ++ ++ +++ +EV G N+R +LS  E +
Sbjct: 179 GLFNALKEISPANVQGEYYLTDIIQIFVQRGLTVKAVTLEDAREVQGINDRIQLSRAEVV 238

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFF------------GCGVSI 288
            + R   ++M+ GVT++ PE  ++     +  DTVI P  F             G G  I
Sbjct: 239 LRHRVLEELMVQGVTIMDPENTYVDQGVKVGNDTVILPFTFLQGKTEIGSQCVLGPGSKI 298

Query: 289 ENYV-----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG 343
            N +     +I+ +S L    IG    IGP+A +R  T +  +V++G+F E+KK+TI  G
Sbjct: 299 NNCIIGDRNEIQ-YSVLVESKIGNDATIGPYAYLRPGTVLADHVKVGDFVEIKKSTIGHG 357

Query: 344 SKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQG 403
           SKI HLSYVGD+ +G+ VN+GAGTITCNYDG  KY+T + + AFIGSN++L+AP+ +GQG
Sbjct: 358 SKIPHLSYVGDATIGEKVNVGAGTITCNYDGKKKYQTTLEDGAFIGSNTNLVAPVKVGQG 417

Query: 404 TYVASGSIITQDTPENSLVFARSRQIVKEDGALSMRK 440
             +A+GS IT+D P+N+L  AR RQ    D     RK
Sbjct: 418 AVIAAGSTITKDVPDNALGVARGRQTNLADWPKKQRK 454


>gi|197334130|ref|YP_002157349.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Vibrio fischeri MJ11]
 gi|254798821|sp|B5FCY9|GLMU_VIBFM RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|197315620|gb|ACH65067.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Vibrio fischeri MJ11]
          Length = 452

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 168/443 (37%), Positives = 263/443 (59%), Gaps = 28/443 (6%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG+G RM S+  KVL  +AGKPM  HV++T    G +N+ LV G+G +++ +   
Sbjct: 5   AVILAAGKGTRMYSNKPKVLHTLAGKPMAKHVIDTCEGLGAQNIHLVYGHGGDQM-KAEL 63

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAMDKI 123
                V++ +Q  Q GT HAV  A     P + D   V+++YGDVPL+S+ T++  +D  
Sbjct: 64  GEE-RVQWVLQAEQLGTGHAVNQA----APEFADDEKVLVLYGDVPLISAETVENLLDAQ 118

Query: 124 AQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
             G  IA++    DNP GYGR++ +N  +IAI E+ DAT+E++ I   N+G+M   G  +
Sbjct: 119 PTG-GIALLTVVLDNPMGYGRIIRRNGPVIAIVEQKDATEEQKLIKEINTGVMVATGGDL 177

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQ 242
             WL  +K      EYYLTDII  A  +G+++ ++  V   EV G N+R +L+ +E  +Q
Sbjct: 178 KRWLAALKNENAQGEYYLTDIIAAAHDEGRAVEAVHPVSPIEVEGVNDRAQLARLERAYQ 237

Query: 243 SRYRRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGV---------- 286
           +   ++++  GV +  P       T+    D  I  + +IE +V  G  V          
Sbjct: 238 AAQAQKLLEQGVMLRDPSRFDLRGTLQCGMDIEIDANVIIEGNVTLGDNVVIGAGCVLKD 297

Query: 287 -SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
             I++   +R +S +EG  +G++  +GPF R+R    +  +  +GNF EVK   + EGSK
Sbjct: 298 CEIDDNTVLRPYSVIEGATVGEECTVGPFTRLRPGAELCNDAHVGNFVEVKNVRLGEGSK 357

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
            NHL+Y+GD+ +GK VN+GAG ITCNYDG +K+KT I ++ F+GS+S LIAP+T+  G  
Sbjct: 358 ANHLTYLGDAEIGKRVNVGAGVITCNYDGANKFKTIIGDDVFVGSDSQLIAPVTVANGAT 417

Query: 406 VASGSIITQDTPENSLVFARSRQ 428
           V +GS +T+D  EN L  +R+++
Sbjct: 418 VGAGSTVTKDVNENELYISRAKE 440


>gi|323493011|ref|ZP_08098147.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Vibrio brasiliensis LMG 20546]
 gi|323312747|gb|EGA65875.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Vibrio brasiliensis LMG 20546]
          Length = 453

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 165/443 (37%), Positives = 259/443 (58%), Gaps = 28/443 (6%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
           A++LAAG+G RM S+  KVL  +AGKPM+ HV++T    G +N+ LV G+G +++     
Sbjct: 5   AVILAAGKGTRMYSNKPKVLHTLAGKPMVKHVIDTCNGLGAQNIHLVYGHGGDQMQAELA 64

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAMDKI 123
             T  V + +Q  Q GT HAV    D   P ++D   ++++YGDVPL+S  T++  +D  
Sbjct: 65  GET--VNWVLQADQLGTGHAV----DQASPQFEDDEKILVLYGDVPLISEETIESLLDAQ 118

Query: 124 AQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
             G  IA++    DNP GYGR++ +N  ++AI E+ DAT+E++ I   N+G+M   G  +
Sbjct: 119 PTG-GIALLTVVLDNPMGYGRIVRRNGPVVAIVEQKDATEEQKLIKEINTGVMVATGGDL 177

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQ 242
             WL  +  N    EYYLTD+I  A  +G+++ ++  V   EV G N+R +L+ +E  +Q
Sbjct: 178 KRWLSGLNNNNAQGEYYLTDVIAAAHDEGRAVEAVHPVNPIEVEGVNDRAQLARLERAFQ 237

Query: 243 SRYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGV---------- 286
           S   ++++  GV +  P    L        D  I  + +IE +V  G  V          
Sbjct: 238 SMQAQKLLEQGVMLRDPARFDLRGELQCGMDCEIDANVIIEGNVSLGDNVVIGTGCVLKD 297

Query: 287 -SIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
             I++   +R +S +EG  +G++  +GPF R+R    +  +  +GNF EVK A I EGSK
Sbjct: 298 CEIDDNTIVRPYSVIEGATVGEECTVGPFTRLRPGAELRNDAHVGNFVEVKNARIGEGSK 357

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
            NHL+Y+GD+ +G+  N+GAG ITCNYDG +K+KT I  + F+GS+  L+AP+TI  G  
Sbjct: 358 ANHLTYLGDAEIGQRTNVGAGVITCNYDGANKFKTVIGNDVFVGSDCQLVAPVTIADGAT 417

Query: 406 VASGSIITQDTPENSLVFARSRQ 428
           V +G+ +T+D  E  LV  R+++
Sbjct: 418 VGAGTTLTKDVAEGELVITRAKE 440


>gi|297582389|ref|YP_003698169.1| UDP-N-acetylglucosamine pyrophosphorylase [Bacillus
           selenitireducens MLS10]
 gi|297140846|gb|ADH97603.1| UDP-N-acetylglucosamine pyrophosphorylase [Bacillus
           selenitireducens MLS10]
          Length = 452

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 169/449 (37%), Positives = 259/449 (57%), Gaps = 22/449 (4%)

Query: 3   RKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT 62
           + R A+VLAAG+G RMKSS  KVL  + GKPM+ H+++ + A  ++++  ++G+GA+++ 
Sbjct: 2   KNRYAVVLAAGKGTRMKSSLYKVLHPVCGKPMVQHIVDQLTACEVDDIVTIVGHGADKVK 61

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
                 T    Y +Q  Q GT HAV+ A+  +       +++ GD PL+++ TL + M  
Sbjct: 62  DQLGERT---SYALQAEQLGTGHAVMQAESVLGGKDGTTLVVSGDTPLLTAETLTELMKH 118

Query: 123 IAQ-GYSIAVVGFNADNPKGYGRLLIKN-NEIIAIREENDATDEERKIHYCNSGLMAIDG 180
             + G    ++   A++P GYGR+L  + +++  I E  DAT +ER++   N+G    D 
Sbjct: 119 HEETGAKATILTAVAEDPTGYGRVLRNDGDQVERIVEHKDATYKERRVKEINTGTYVFDN 178

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSI-ASIDVKEQEVCGCNNRYELSLIEN 239
             + D L  +  + V  EYYL D+IE  +  G+++ A I     E  G N+R  LS  E 
Sbjct: 179 TALFDALANVGNDNVQGEYYLPDVIEILQTRGETVSAHIAPDFNETMGVNDRVALSEAEK 238

Query: 240 IWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFF--------GCGVSIENY 291
             + R  R  M  GV+M  PE  ++S D +I  DTVIEP            GC +     
Sbjct: 239 WMKRRINRHWMTQGVSMTDPEQTYISSDAVIGADTVIEPGSMIKGNVTIGQGCVIGPHTV 298

Query: 292 VQIRAF--------SYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG 343
           ++  A         S +    +G    IGPFA +R ETT+  +V++GNF E+KK ++ +G
Sbjct: 299 IEESAVADNSVIRQSTVNRSRVGSGVAIGPFAHLRPETTLGNDVKVGNFVELKKMSMGDG 358

Query: 344 SKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQG 403
           SK +HLSY+GD+ +G +VN+G G+IT NYDG +K+ T I + AF+G N++LIAP+T+G+G
Sbjct: 359 SKASHLSYLGDADIGSDVNMGCGSITVNYDGKNKFLTTIEDGAFVGCNANLIAPVTVGKG 418

Query: 404 TYVASGSIITQDTPENSLVFARSRQIVKE 432
            YVA+GS IT D P  SL  AR+RQ  KE
Sbjct: 419 AYVAAGSTITDDVPGESLAIARARQTNKE 447


>gi|126176545|ref|YP_001052694.1| UDP-N-acetylglucosamine pyrophosphorylase [Shewanella baltica
           OS155]
 gi|166226123|sp|A3DAR2|GLMU_SHEB5 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|125999750|gb|ABN63825.1| UDP-N-acetylglucosamine pyrophosphorylase / glucosamine-1-phosphate
           N-acetyltransferase [Shewanella baltica OS155]
          Length = 460

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 171/445 (38%), Positives = 259/445 (58%), Gaps = 28/445 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM+S   KVL  IA K M+ HV++T    G + + LV GYGA+++      
Sbjct: 6   VILAAGKGTRMRSDLPKVLHPIAHKSMVQHVIDTAHKVGSDAIQLVYGYGADKLQASLGE 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HAV  A   I    D V+I+YGDVPL+   TL+  +    +  
Sbjct: 66  QQLN--WVLQAEQLGTGHAVAQASPHIAD-SDTVLILYGDVPLIQQSTLEALLAARPEN- 121

Query: 128 SIAVVGFNADNPKGYGRLL------IKNNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
            +A++  N  NP GYGR++       +  +++ I E+ DAT E+  I+  N+G+MA+ G 
Sbjct: 122 GVAILTVNLGNPMGYGRIVRTPCEGQEQGKVVGIIEQKDATAEQLLINEINTGIMAVPGK 181

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENI 240
            +  WL ++  N    EYYLTDII  A  DG +I +   +   EV G NNR +L+ +E  
Sbjct: 182 QLKAWLSRLSNNNAQGEYYLTDIIAMAHADGVAIDTAQPQSAIEVEGANNRVQLAQLERA 241

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV-------- 292
           +Q+R   ++M++G  +  P  + +  D  +  D +I+ +V F   V++ N V        
Sbjct: 242 YQAREAEKLMLAGANLRDPSRIDIRGDVTVGMDVMIDINVIFEGKVTLGNNVTIGAGAIL 301

Query: 293 ---------QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG 343
                    +I+ +S +EG  +G     GPFAR+R    ++++  IGNF EVKKA I  G
Sbjct: 302 IDCEIADNAEIKPYSIIEGAKLGVAASAGPFARLRPGAELKQDAHIGNFVEVKKAVIGVG 361

Query: 344 SKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQG 403
           SK  HL+Y+GD+++G  VNIGAGTITCNYDG +K+ T I +N F+GS++ L+AP+TIG+G
Sbjct: 362 SKAGHLAYLGDAIIGDGVNIGAGTITCNYDGANKHLTVIEDNVFVGSDTQLVAPVTIGKG 421

Query: 404 TYVASGSIITQDTPENSLVFARSRQ 428
             + +GS IT+D  EN LV  R +Q
Sbjct: 422 ATLGAGSTITRDVGENELVITRVKQ 446


>gi|299068267|emb|CBJ39488.1| bifunctional: N-acetyl glucosamine-1-phosphate uridyltransferase
           (N-terminal); glucosamine-1-phosphate acetyl transferase
           (C-terminal) [Ralstonia solanacearum CMR15]
          Length = 455

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 168/457 (36%), Positives = 263/457 (57%), Gaps = 29/457 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG G RM+S+  KVL  +AGKP+++HV+ET  +     + +V+G+G + +  +   
Sbjct: 4   VILAAGLGKRMRSALPKVLHPLAGKPLLAHVIETARSLSPTRLVVVVGHGGDRVRDMVGA 63

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVI---IMYGDVPLVSSHTLKKAMDKIA 124
           P   V +  QD Q GT HAV+ A D +    DD +   ++YGDVPL  + TL   +    
Sbjct: 64  P--DVTFATQDQQLGTGHAVMQALDQL----DDTVPTLVLYGDVPLTRAETLNALVGAAG 117

Query: 125 QGYSIAVVGFNADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
           Q + + V+  + D+P GYGR++      I  I E+ DA + +  IH  N+G++      +
Sbjct: 118 QDH-LGVLTVHLDDPTGYGRIVRDATGRITRIVEQKDANETQLAIHEVNTGILVCPTARL 176

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQ 242
             WL  ++ +    EYYLTD+IE+A  +G  I S   + E E  G N++ +L+ +E I Q
Sbjct: 177 KTWLASLRNDNAQGEYYLTDVIERAAGEGLPITSAHPLAEWETLGVNSKVQLAELERIHQ 236

Query: 243 SRYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGVSIENYVQIR- 295
               +Q++  GVT+I P  + +        D +I  D + E +V  G GV I  +  IR 
Sbjct: 237 RNLAQQLLEDGVTLIDPARIDIRGKLTCGRDVVIDIDCIFEGNVTLGDGVHIGAHAVIRD 296

Query: 296 ----------AFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
                      F ++E   +G ++ IGP+AR+R  T + ++V IGNF EVK + I   SK
Sbjct: 297 AAIQAGAEILPFCHIEQATVGGQSRIGPYARLRPGTELAEDVHIGNFVEVKNSQIAAHSK 356

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
            NHL+YVGD+ VG  VNIGAGTITCNYDG +K++T I ++AFIGS++ L+AP+ +G+G  
Sbjct: 357 ANHLAYVGDATVGSRVNIGAGTITCNYDGANKFRTIIEDDAFIGSDTQLVAPVRVGRGAT 416

Query: 406 VASGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           + +G+ +T+D PE  L  +R+RQ         +++KK
Sbjct: 417 LGAGTTLTKDAPEGQLTVSRARQTTVNGWQRPVKQKK 453


>gi|167629339|ref|YP_001679838.1| udp-n-acetylglucosamine pyrophosphorylase, putative [Heliobacterium
           modesticaldum Ice1]
 gi|254798770|sp|B0TBA0|GLMU_HELMI RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|167592079|gb|ABZ83827.1| udp-n-acetylglucosamine pyrophosphorylase, putative [Heliobacterium
           modesticaldum Ice1]
          Length = 458

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 177/451 (39%), Positives = 258/451 (57%), Gaps = 26/451 (5%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI-T 62
           KR A+VLAAG+G RMKS   KVL ++AG+PMI HV++ +   G+    +V+G+G E +  
Sbjct: 3   KRTAVVLAAGKGTRMKSRQPKVLHEVAGQPMICHVLDALTDCGVAQPIVVIGHGGEAVRQ 62

Query: 63  RINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK 122
           R+         Y  Q  Q GT HAV+ A+  +    + V+++ GD PL++  TL    + 
Sbjct: 63  RLGDRAC----YAWQQEQLGTGHAVMMARPEVPEEVETVMVLCGDTPLLTGATLSALWET 118

Query: 123 IAQGYSIAVVGFNA--DNPKGYGRLLIKN-NEIIAIREENDATDEERKIHYCNSGLMAID 179
             Q  ++  V   A  D+PKGYGR+L  +   + AI EE DA ++++ I   N+G    D
Sbjct: 119 HEQSGAMGTV-LTAVIDDPKGYGRILRDDAGHVTAIVEEKDADEKQKTIREINAGTYCFD 177

Query: 180 GLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVK-EQEVCGCNNRYELSLIE 238
              +   L  I       EYYLTD++   R  G  + +  ++ E+E+ G N+R +L+  E
Sbjct: 178 RAALFAALDAITPANAQGEYYLTDVLAIFRQRGGLVVAHTLQDEREILGINSRVQLAEAE 237

Query: 239 NIWQSRYRRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGVSIENYV 292
            + Q R RR+ M +GVT+I P +VF         DTII P T+IE     G G  I    
Sbjct: 238 AVLQDRLRRKWMDAGVTLIDPPSVFFHTKAVVGADTIIYPQTIIEGETVIGEGCRIGPAT 297

Query: 293 QIRAFSYLEGV----------HIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKE 342
           +I      E V           IG    +GPFA +R  T + + V++G+F E+KK+ I +
Sbjct: 298 RICDSRIGENVVIQNSVVLDSRIGDDCAVGPFAYLRPGTCLAEAVKVGDFVEIKKSVIGK 357

Query: 343 GSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQ 402
           GSK+ HLSYVGD+ VG++VNIGAGTITCNYDG HK+ T I + AFIGSN++L+AP+T+G 
Sbjct: 358 GSKVPHLSYVGDATVGEDVNIGAGTITCNYDGKHKHVTAIEDGAFIGSNTNLVAPVTVGA 417

Query: 403 GTYVASGSIITQDTPENSLVFARSRQIVKED 433
              + +GS IT+D P  +L   RSR  +KE+
Sbjct: 418 HALIGAGSTITKDVPAGALAVERSRMKIKEN 448


>gi|78044455|ref|YP_359064.1| UDP-N-acetylglucosamine pyrophosphorylase [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|94714464|sp|Q3AFM0|GLMU_CARHZ RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|77996570|gb|ABB15469.1| UDP-N-acetylglucosamine pyrophosphorylase [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 446

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 183/450 (40%), Positives = 268/450 (59%), Gaps = 32/450 (7%)

Query: 7   AIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINF 66
            I+LAAG+G RMKS   KV+ ++A KPM+  V E +  AG++ V  V+GY  E++  I  
Sbjct: 3   GIILAAGKGTRMKSDLPKVVHEVAEKPMVLRVYEALVGAGVKRVVAVVGYRKEKVEEILR 62

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDK-IAQ 125
              +     +Q+ Q GT HA L A   ++   ++VII+ GD PL+ + TL+  + K +  
Sbjct: 63  GRAVIA---VQEEQLGTGHAALVAMPYVED--ENVIIVPGDTPLLKASTLQALIKKHLET 117

Query: 126 GYSIAVVGFNADNPKGYGRLLIKN-NEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
           G    V+     NP GYGR++     +II I EE DAT EE++I   N+G+   +   + 
Sbjct: 118 GAYATVLTCFLSNPYGYGRIVRDGYGKIIKIVEEKDATLEEKQIAEVNTGIYCFNTKILK 177

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVK-EQEVCGCNNRYELSLIENIWQS 243
           + L  +K     +EYYLTD+I      GK + +I ++ E EV G N+R +L+    + + 
Sbjct: 178 EILPLLKAENAQKEYYLTDVIPLLLERGKVVETITIQDETEVYGVNDRVQLA---RLTKG 234

Query: 244 RYRRQ---MMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFF--------GCGVS----- 287
            YRR+   +M  GVT+I PETV++  + ++  DTVI P+ +         GC +      
Sbjct: 235 VYRRKAEALMQEGVTIIDPETVYIGEEVVVGSDTVIYPNTYLEGKTVIGSGCRLGPNTRI 294

Query: 288 ----IENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG 343
               I N  +I  FS +    +G +  +GPFA +R  T I   V+IG+F E+KK+ I EG
Sbjct: 295 TDSVIGNNTEI-TFSVIIQARVGDEVNVGPFAYLRPGTEIANGVKIGDFVEIKKSFIGEG 353

Query: 344 SKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQG 403
           SK+ HLSY+GD+VVGK VNIGAGTITCNYDG +K++T I + AFIGSN++L+API IG+ 
Sbjct: 354 SKVPHLSYIGDAVVGKGVNIGAGTITCNYDGKNKWETVIEDGAFIGSNTNLVAPIKIGKN 413

Query: 404 TYVASGSIITQDTPENSLVFARSRQIVKED 433
             V +GS +T+D PE +L  ARSRQ+ KED
Sbjct: 414 AVVGAGSTLTEDVPEKALAIARSRQVNKED 443


>gi|319790690|ref|YP_004152323.1| UDP-N-acetylglucosamine pyrophosphorylase [Thermovibrio
           ammonificans HB-1]
 gi|317115192|gb|ADU97682.1| UDP-N-acetylglucosamine pyrophosphorylase [Thermovibrio
           ammonificans HB-1]
          Length = 471

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 172/461 (37%), Positives = 260/461 (56%), Gaps = 39/461 (8%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYG---AEEITRI 64
           +VLAAG+G R KS   KVL  I GKPM+ +V++    AG E V +V+G+     EE  R 
Sbjct: 6   VVLAAGKGTRFKSELPKVLHPILGKPMLWYVVKAALEAGSEEVIVVVGHKRELVEEFLRE 65

Query: 65  NFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIA 124
           N+P    V+   Q  Q GT HAV   ++ +K     V+++ GD PLV    +K       
Sbjct: 66  NYP---QVKTVYQSRQLGTGHAVAQCRELLKNYSGKVVVLNGDTPLVRPEDIKAVASTPG 122

Query: 125 QGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIM 184
               + V+    ++P GYGR++   N ++ I EE DAT EER I   N+G+ A     + 
Sbjct: 123 D---MVVLTAKTEDPTGYGRVVRDGNAVLKIVEEKDATPEERLITEINTGIYAFSAEPLF 179

Query: 185 DWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQE-VCGCNNRYELSLIENIWQS 243
             L QI  N    EYYL D+++  + +G S+  +   + E V G NNR++L+  E++ + 
Sbjct: 180 RALEQIDNNNAQGEYYLPDVLKVFQKEGLSVVPVLTSDFESVMGVNNRHQLAAAESVMRD 239

Query: 244 RYRRQMMISGVTMIAPETVFLSHDTIIQPD------------------TVIEPHV----- 280
           R  +++ +SGVT+  P+TV++  D  ++PD                  TV+ P       
Sbjct: 240 RIVKELQLSGVTVHNPQTVYVEPDVTVEPDVELFGPLYLRGKTVIKKGTVVGPFCDIRDS 299

Query: 281 FFGCGVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATI 340
           F G G ++E++       ++ G  +      GPF+R+R+ T +E   R+G+F E KKA +
Sbjct: 300 FIGEGCTVESHC------WMSGATLKGGASCGPFSRLREGTVLEGGSRVGSFVETKKAHL 353

Query: 341 KEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITI 400
           KEG+K NHL+Y+GD  VG+N N+GAGTITCNYDG  K++T I  N F+GSN+  IAP+ +
Sbjct: 354 KEGAKANHLTYLGDCTVGENTNVGAGTITCNYDGFAKWRTEIGRNVFVGSNTLFIAPVKV 413

Query: 401 GQGTYVASGSIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           G G   A+GS+IT+D P+N+L  ARS+Q+     A S+R+K
Sbjct: 414 GDGAITAAGSVITRDVPDNALAVARSKQVNYPGKAESVREK 454


>gi|260595805|ref|YP_003208376.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Cronobacter turicensis z3032]
 gi|260214982|emb|CBA26620.1| Bifunctional protein glmU [Cronobacter turicensis z3032]
          Length = 456

 Score =  307 bits (786), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 165/452 (36%), Positives = 267/452 (59%), Gaps = 22/452 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGKPM+ HV++     G ++V LV G+G + +   +  
Sbjct: 9   VILAAGKGTRMYSDLPKVLHTLAGKPMVQHVIDAAKHVGAQHVHLVYGHGGDLLQ--STL 66

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
              S+ + +Q  Q GT HA+  A        +DV+++YGDVPL+S  TL++      QG 
Sbjct: 67  KDASLNWVLQAEQLGTGHAMQQAAPFFSDD-EDVLMLYGDVPLISVETLQQLCAAKPQG- 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    D+P GYGR+  +N ++  I E  DA+DE+R+I+  N+G++  +G  +  WL
Sbjct: 125 GIGLLTVKLDDPTGYGRITRENGKVSGIVEHKDASDEQRQINEINTGILVANGADLKRWL 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSRYR 246
            ++  N    EYY+TDII  A  +G+ IA++  +   EV G NNR +L+ +E ++Q+   
Sbjct: 185 AKLDNNNAQGEYYITDIIAMAWNEGREIAAVHPQRLSEVEGVNNRLQLARLERVYQAEQA 244

Query: 247 RQMMISGVTMIAP------------ETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV-- 292
            +++++GV +  P              V +  + II+ D V+   V  G G  I+N V  
Sbjct: 245 EKLLLAGVMLRDPARFDLRGTLKHGRDVEIDANVIIEGDVVLGHRVKIGAGCVIKNSVIG 304

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              ++  +S +E   +     IGPFAR+R    + +   +GNF E+KKA + +GSK  HL
Sbjct: 305 DDCEVSPYSVVEDARLDAACTIGPFARLRPGAELLEGAHVGNFVEMKKARLGKGSKAGHL 364

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+ +G  +A+G
Sbjct: 365 TYLGDAEIGDNVNIGAGTITCNYDGANKHKTIIGDDVFVGSDTQLVAPVTVAKGATIAAG 424

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + +T++  EN LV  R  Q+ K+     ++KK
Sbjct: 425 TTVTRNIAENELVLTRVPQVHKQGWRRPVKKK 456


>gi|293610507|ref|ZP_06692807.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826851|gb|EFF85216.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 454

 Score =  307 bits (786), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 176/453 (38%), Positives = 262/453 (57%), Gaps = 22/453 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM+S   KVLQ +A +P++ HV++T      EN+  + G+G + + +  F 
Sbjct: 6   IILAAGKGTRMRSQLPKVLQPLACRPLLGHVIQTAKKIHAENIITIYGHGGDHVKQ-TFA 64

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               +++  Q  Q GT HAV      + P     +I+YGDVPLV   TL++ ++ ++   
Sbjct: 65  QE-KIQWVEQAEQLGTGHAVQMTLPVL-PKDGISLILYGDVPLVRQTTLEQLVE-VSSKT 121

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++  + DNP GYGR++ +  +I AI E  DAT+ +R+I   N+G+  +    + +WL
Sbjct: 122 GIGMITLHVDNPTGYGRIVRQEGKIQAIVEHKDATEAQRQIQEINTGIYCVSNAKLHEWL 181

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRYR 246
            ++       EYYLTDI+  A  DG  IASI  +   EV G N+R +L+ +E  +Q +  
Sbjct: 182 PKLSNENAQGEYYLTDIVAMAVADGLEIASIQPELAFEVEGVNDRLQLAALEREFQQQQA 241

Query: 247 RQMMISGVTMIAPE------TVFLSHDT------IIQPDTVIEPHVFFGCGVSIENY--- 291
           +++M  GVT   P       +V + HD       II+ D  +   V  G G  ++N    
Sbjct: 242 KELMQQGVTFADPARFDLRGSVKVGHDVRIDVNVIIEGDCELGDFVEIGAGCILKNTKIA 301

Query: 292 --VQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +++A+S  +G  +G+   IGPFAR+R    +   V IGNF EVK  TI  GSK NH 
Sbjct: 302 AGTKVQAYSIFDGAVVGENAQIGPFARLRPGAKLANEVHIGNFVEVKNTTIGLGSKANHF 361

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G   NIGAGTITCNYDG +K+KT I +  FIGSNSSL+AP+TIG G  V +G
Sbjct: 362 TYLGDAEIGAESNIGAGTITCNYDGANKHKTTIGDAVFIGSNSSLVAPVTIGSGATVGAG 421

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           S+IT+D  E SL F R++QI K +     + KK
Sbjct: 422 SVITKDVAEQSLSFERAQQISKANYQRPQKVKK 454


>gi|242241390|ref|YP_002989571.1| UDP-N-acetylglucosamine pyrophosphorylase [Dickeya dadantii Ech703]
 gi|242133447|gb|ACS87749.1| UDP-N-acetylglucosamine pyrophosphorylase [Dickeya dadantii Ech703]
          Length = 456

 Score =  307 bits (786), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 163/439 (37%), Positives = 259/439 (58%), Gaps = 22/439 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KV+  +AGKPM+ HV++     G + V LV G+G +++ R    
Sbjct: 9   VILAAGKGTRMYSDLPKVIHPLAGKPMVRHVIDAAMQVGAQRVHLVYGHGGDQL-REALG 67

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
            T  V + IQ  Q GT HAV  A        +D++I+YGDVPL+S  TL + +D   +G 
Sbjct: 68  DT-GVNWVIQSEQLGTGHAVQQAAAGFADD-EDILILYGDVPLISPATLLRLVDAKPEG- 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    D+P GYGR++ +N EI+ I E  DA++E+R+I   N+G++   G  +  WL
Sbjct: 125 GIGLLTVELDDPAGYGRIVRENGEIVGIVEHKDASEEQRRIKEINTGILVAGGCDLKRWL 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQSRYR 246
            ++  N V  EYYLTDII  A  +G+ +A++   +  EV G NNR +L+ +E ++Q    
Sbjct: 185 GRLSNNNVQGEYYLTDIIAMAYQEGRRVAAVHPARLSEVEGVNNRLQLAALERVFQHEQA 244

Query: 247 RQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFG------CGVSIENYV-- 292
            +++++GV ++ P    L        D  I  + ++E  V  G       G  I + V  
Sbjct: 245 ERLLLAGVMLLDPSRFDLRGELQHGRDVTIDANVILEGRVTLGDRVKIGAGCVIRDSVIG 304

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +I  ++ +E   +  +  IGPFAR+R    + +   +GNF E+KKA + +GSK  HL
Sbjct: 305 SDCEISPYTVVEQAELAAQCTIGPFARLRPGAELGEGAHVGNFVEMKKARLGKGSKAGHL 364

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G  VNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+  G  + +G
Sbjct: 365 TYLGDAEIGAGVNIGAGTITCNYDGANKHKTVIGDDVFVGSDTQLVAPVTVANGATIGAG 424

Query: 410 SIITQDTPENSLVFARSRQ 428
           + +T++  EN LV +R +Q
Sbjct: 425 TTVTRNVGENELVISRVKQ 443


>gi|326572019|gb|EGE22021.1| bifunctional UDP-N-acetylglucosamine
           diphosphorylase/glucosamine-1-phosphate [Moraxella
           catarrhalis BC8]
          Length = 453

 Score =  307 bits (786), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 177/439 (40%), Positives = 253/439 (57%), Gaps = 23/439 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RMKS+  KVLQ +AGK ++ HV++T A    +   LV G+G E +      
Sbjct: 6   IILAAGKGTRMKSNRPKVLQTLAGKALVQHVLDTCAQIQADGTILVYGFGGEMVKEA--L 63

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
            T +V +  Q  Q GT HAV  A   + P     +I+YGDVPL  + TL+  +     G 
Sbjct: 64  STHTVIFAEQTQQLGTGHAVKMALPHL-PKEGKSLILYGDVPLTQAETLQNLVKANTSG- 121

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I+++    + P G GR++    +++AI EE DA  +++ I   NSG+  +D   +  +L
Sbjct: 122 -ISMLTLTVEQPFGLGRIVRNQGKVVAIVEEKDADTQQKLITEINSGIYCVDNALLHKYL 180

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRYR 246
             +  N    EYYLTDII+ A  DG  I +I+ K   E+ G N+R +L+ +E  +QS   
Sbjct: 181 PILNNNNAQGEYYLTDIIKLAVDDGVEIVTIEPKFAFEIEGVNDRIQLANLERDFQSHQI 240

Query: 247 RQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGVSIE----------- 289
            Q+ I+GV    P  V +        D  I  +TV    V  G GV I+           
Sbjct: 241 HQLQIAGVQFADPNRVDIRGKLTCDRDVFIDINTVFVGDVHLGMGVQIDAGNVITNSHIG 300

Query: 290 NYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
           N   I+    ++   IG+   IGPFA IR +T +  +V+IGNF E KK T+  GSKINHL
Sbjct: 301 NQTHIKPNCVIDDSMIGQNVSIGPFAHIRPKTILSDDVKIGNFVETKKTTVGVGSKINHL 360

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           SY GDS++G+NVNIGAG ITCNYDG +K+ T I + AFIGSNSSL+AP+T+G G  + +G
Sbjct: 361 SYAGDSIIGQNVNIGAGVITCNYDGINKFTTTIGDRAFIGSNSSLVAPVTVGMGATIGAG 420

Query: 410 SIITQDTPENSLVFARSRQ 428
           S+IT+D  +N+L  AR++Q
Sbjct: 421 SVITKDAKDNALTLARAKQ 439


>gi|84622330|ref|YP_449702.1| UDP-N-acetylglucosamine pyrophosphorylase [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|109892133|sp|Q2P7P9|GLMU_XANOM RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|84366270|dbj|BAE67428.1| UDP-N-acetylglucosamine pyrophosphorylase [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
          Length = 454

 Score =  307 bits (786), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 172/444 (38%), Positives = 253/444 (56%), Gaps = 24/444 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG G RM+SS  KVLQ +AG+PM++HV+ T        + +V G+G++++ +  F 
Sbjct: 8   VILAAGEGKRMRSSLPKVLQPLAGQPMLAHVIATARQLQPAAIHIVYGHGSDQV-QAAFA 66

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               +++  Q  Q GT HAV  A  AI P    V+++YGDVPL+ S +L + +    +  
Sbjct: 67  DQSDLQWAAQREQLGTGHAVQQAMPAI-PDAARVLVLYGDVPLIRSESLLQLLHAPGR-- 123

Query: 128 SIAVVGFNADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
            +AV+     NP GYGR+L     ++ AI E+ DA DE+R+I   N+G++  +   +  W
Sbjct: 124 -MAVLVAELANPTGYGRILRDAEGKVAAIVEQKDANDEQRRIRTINTGILTAESTALRRW 182

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSRY 245
           L  +  +    E+YLTD+   A  D      + V + Q+V G N+ ++L+ +E  WQ R 
Sbjct: 183 LGGLSNDNAQGEFYLTDVFASAAADFTPADMVHVADPQDVEGANDPWQLAQLERAWQLRA 242

Query: 246 RRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV------- 292
            R + + GV M  P       +V +  D  +  D ++E  V  G  V I  +V       
Sbjct: 243 ARALSLQGVRMADPARVEQRGSVQVGRDVQLDIDVILEGEVTLGDDVVIGPFVRLRDVTL 302

Query: 293 ----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
               Q+RA S LEGV       IGPFAR+R  T +   V IGNF E KK T+   SK NH
Sbjct: 303 GAGTQVRAHSDLEGVITEGAVQIGPFARLRPGTVLADGVHIGNFVETKKVTMGVDSKANH 362

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           L+Y+GD+V+G  VNIGAGTITCNYDG +K +T I + AF+GSNS+L+API IG  + + +
Sbjct: 363 LTYLGDAVIGSKVNIGAGTITCNYDGVNKSQTTIGDGAFVGSNSALVAPIEIGANSTIGA 422

Query: 409 GSIITQDTPENSLVFARSRQIVKE 432
           GS++T+D P   L   R+RQ V E
Sbjct: 423 GSVVTRDAPAGQLTVTRARQTVIE 446


>gi|78049318|ref|YP_365493.1| UDP-N-acetylglucosamine diphosphorylase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|94717586|sp|Q3BP20|GLMU_XANC5 RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|78037748|emb|CAJ25493.1| UDP-N-acetylglucosamine diphosphorylase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 454

 Score =  306 bits (785), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 174/444 (39%), Positives = 253/444 (56%), Gaps = 24/444 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG G RM+SS  KVLQ +AG+PM++HV+ T        + +V G+G +++ +  F 
Sbjct: 8   VILAAGEGKRMRSSLPKVLQPLAGQPMLAHVIATARQLQPAAIHIVYGHGGDQV-QAAFA 66

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               +++  Q  Q GT HAV  A  AI P    V+++YGDVPL+ S +L + +    +  
Sbjct: 67  DQGDLQWAEQCEQLGTGHAVQQAMPAI-PDAATVLVLYGDVPLIRSESLLQLLHAPGR-- 123

Query: 128 SIAVVGFNADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
            +AV+     NP GYGR+L     ++ AI E+ DA DE+R+I   N+G++  +   +  W
Sbjct: 124 -MAVLVAELANPTGYGRILRDAEGKVAAIVEQKDANDEQRRIRTINTGILTAESTALRRW 182

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSRY 245
           L  + K+    E+YLTD+   A  D      + V + Q V G N+ ++L+ +E  WQ R 
Sbjct: 183 LAGLSKDNAQGEFYLTDVFASAAADFTPADMVHVADPQHVEGANDPWQLAQLERAWQLRA 242

Query: 246 RRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQ------ 293
            R + + GV M  P       +V +  D  +  D ++E +V  G  V I  +V+      
Sbjct: 243 ARTLCLQGVRMADPARVEQRGSVQVGRDVQLDIDVILEGNVTLGDDVVIGPFVRLRDVTL 302

Query: 294 -----IRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
                +RA S LEGV       IGPFAR+R  T +   V IGNF E KK T+  GSK NH
Sbjct: 303 GAGTHVRAHSDLEGVVTEGAVQIGPFARLRPGTVLADGVHIGNFVETKKVTMGVGSKANH 362

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           L+Y+GD+V+G  VNIGAGTITCNYDG +K +T I + AF+GSNS+L+API IG  + + +
Sbjct: 363 LTYLGDAVIGSKVNIGAGTITCNYDGVNKSQTTIGDGAFVGSNSALVAPIEIGANSTIGA 422

Query: 409 GSIITQDTPENSLVFARSRQIVKE 432
           GS+IT D P   L   R+RQ V E
Sbjct: 423 GSVITSDAPAGQLSVTRARQTVIE 446


>gi|283469791|emb|CAQ49002.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Staphylococcus aureus subsp. aureus
           ST398]
          Length = 450

 Score =  306 bits (785), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 173/451 (38%), Positives = 263/451 (58%), Gaps = 28/451 (6%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR 63
           +R AI+LAAG+G RMKS   KVL ++AGKPM+ HV+E++  +G++ V  ++G+GAE +  
Sbjct: 2   RRHAIILAAGKGTRMKSKKYKVLHEVAGKPMVEHVLESVKGSGVDQVVTIVGHGAESVKG 61

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM--- 120
                +L   Y  Q+ Q GTAHAV  A+  ++      I++ GD PL++  TL+  +   
Sbjct: 62  HLGERSL---YSFQEEQLGTAHAVQMAKSHLEDKEGTTIVVCGDTPLITKETLETLIAHH 118

Query: 121 -DKIAQGYSIAVVGFNADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNSGLMAI 178
            D  AQ     V+  +  +P GYGR++   +  +  I EE DAT  E+ I+  +SG+ A 
Sbjct: 119 EDANAQA---TVLSASIQHPYGYGRIVRNASGRLERIVEEKDATQAEKDINEISSGIFAF 175

Query: 179 DGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLI 237
           +   + + L Q+K +    EYYL D++     DG  +      + +E+ G N+R  LS  
Sbjct: 176 NNKTLFEKLTQVKNDNAQGEYYLPDVLSLILNDGGIVEVYRTNDVEEIMGVNDRVMLSQA 235

Query: 238 ENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFF------GCGVSIENY 291
           E   Q R     M++GVT+I P++ F+  D  I  DTVIEP V        G  V I  Y
Sbjct: 236 EKAMQRRTNHYHMLNGVTIIDPDSTFIGPDVTIGSDTVIEPGVRINGRTEIGEDVVIGQY 295

Query: 292 VQIRAFSYLEGV----------HIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIK 341
            +I   +   G            +G  T +GPFA++R    +  +V++GNF E+KKA +K
Sbjct: 296 SEINNSTIENGACIQQSVVNDASVGANTKVGPFAQLRPGAQLGADVKVGNFVEIKKADLK 355

Query: 342 EGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIG 401
           +G+K++HLSY+GD+V+G+  NIG GTIT NYDG +K+KT + +++F+G N +L+AP+T+G
Sbjct: 356 DGAKVSHLSYIGDAVIGERTNIGCGTITVNYDGENKFKTIVGKDSFVGCNVNLVAPVTVG 415

Query: 402 QGTYVASGSIITQDTPENSLVFARSRQIVKE 432
            G  VA+GS IT D P +SL  AR+RQ  KE
Sbjct: 416 DGVLVAAGSTITDDVPNDSLAVARARQTTKE 446


>gi|322514607|ref|ZP_08067639.1| UDP-N-acetylglucosamine diphosphorylase [Actinobacillus ureae ATCC
           25976]
 gi|322119465|gb|EFX91561.1| UDP-N-acetylglucosamine diphosphorylase [Actinobacillus ureae ATCC
           25976]
          Length = 454

 Score =  306 bits (785), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 165/443 (37%), Positives = 255/443 (57%), Gaps = 30/443 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEIT-RINF 66
           ++LAAG+G RM S   KVL  +AGKPM+ HV++T      + + L+ G+G E +  R++ 
Sbjct: 7   VILAAGKGTRMYSDLPKVLHTVAGKPMVKHVIDTAKQIDAKQIHLIYGHGGELLQQRLSS 66

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDD---VIIMYGDVPLVSSHTLKKAMDKI 123
            P   V + +Q  Q GT HA+        P + D   ++++YGD PL++  TL++ +   
Sbjct: 67  EP---VNWVLQAEQLGTGHAM----QQTAPFFADDENILMLYGDAPLITKETLERLIAAK 119

Query: 124 AQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYI 183
            +   IA++    DNP GYGR++ +N  ++AI E+ DA +E+ KI   N+G+M   G   
Sbjct: 120 PEN-GIALLTVELDNPTGYGRIIRENGSVVAIVEQKDANEEQLKIREVNTGVMVASGASF 178

Query: 184 MDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQ 242
             WL  +  N    EYY+TD+I  A  DG  + ++   E  EV G NNR +L+ +E  +Q
Sbjct: 179 KKWLGNLNNNNAQGEYYITDVIAMANQDGYKVQAVQASEFMEVEGANNRLQLAALERFYQ 238

Query: 243 SRYRRQMMISGVTMIAP------------ETVFLSHDTIIQPDTVIEPHVFFGCGVSIEN 290
                +++++GV +I P            + V +  + II+ +  +   V  G G  ++N
Sbjct: 239 KTQAEKLLLAGVRLIDPARFDIRGSLTHGKDVEIDVNVIIEGEVKLGNRVCIGAGCVLKN 298

Query: 291 Y-----VQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSK 345
                 V+I+ +S LE   +GK   IGPF+R+R    + +   +GNF E+K A + +GSK
Sbjct: 299 CEIGDDVEIKPYSVLEDAVVGKAAQIGPFSRLRPGANLAEETHVGNFVEIKNAQVGKGSK 358

Query: 346 INHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTY 405
           +NHL+YVGD+ VG N NIGAG ITCNYDG +K+KT I  N F+GS+S L+AP+TI  G  
Sbjct: 359 VNHLTYVGDTEVGSNCNIGAGVITCNYDGANKFKTVIGNNVFVGSDSQLVAPVTIADGAT 418

Query: 406 VASGSIITQDTPENSLVFARSRQ 428
           + +G+ IT+D  EN LV +R  Q
Sbjct: 419 IGAGATITKDVAENELVISRVPQ 441


>gi|157964048|ref|YP_001504082.1| UDP-N-acetylglucosamine pyrophosphorylase [Shewanella pealeana ATCC
           700345]
 gi|189041295|sp|A8HAG0|GLMU_SHEPA RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|157849048|gb|ABV89547.1| UDP-N-acetylglucosamine pyrophosphorylase [Shewanella pealeana ATCC
           700345]
          Length = 454

 Score =  306 bits (785), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 168/440 (38%), Positives = 256/440 (58%), Gaps = 24/440 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI-TRINF 66
           ++LAAG+G RM+S   KVL  IA K M+ HV++T    G + + LV GYGA+++  R+  
Sbjct: 6   VILAAGKGTRMRSDLPKVLHPIAHKSMVQHVIDTAYQVGSDAIQLVYGYGADKLQARLG- 64

Query: 67  PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQG 126
                + + +Q  Q GT HAV  A   I    D V+I+YGDVPL+ + TL+ A+    + 
Sbjct: 65  --EQQLNWVLQAEQLGTGHAVAQASANIADD-DTVLILYGDVPLIQASTLE-ALLAAREE 120

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
             +A++  N  NP GYGR++ +   ++ I E+ DA  E+  I+  N+G+MA  G  +  W
Sbjct: 121 NGLAILTVNLPNPTGYGRIVREGGSVVGIIEQKDANTEQLAINEINTGIMAAPGKQLKAW 180

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRY 245
           L Q+  +    EYYLTDI+  A  DG +I +   +   EV G NNR +L+ +E  +Q+R 
Sbjct: 181 LGQLSSDNAQGEYYLTDIVAMAHRDGVAITTAQPESAVEVEGANNRVQLAQLERAYQARA 240

Query: 246 RRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRA--------- 296
             ++M+ G  +  P  + +  D  +  D +I+ +V     V+I N V I A         
Sbjct: 241 AEKLMLEGANLRDPARIDIRGDVTVGMDVMIDVNVVIEGKVTIGNNVTIGAGVILIDCDI 300

Query: 297 --------FSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
                   +S +E   +G     GPFAR+R    ++++  IGNF E+KKA + +GSK  H
Sbjct: 301 SDNAVIKPYSIIESAKVGVDASAGPFARLRPGAELKEDAHIGNFVEMKKAVLGKGSKAGH 360

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           L+Y+GD+ +G  VNIGAGTITCNYDG +K++T I +N F+GS++ L+AP+TIG+G  + +
Sbjct: 361 LAYIGDATIGSGVNIGAGTITCNYDGANKFQTIIEDNVFVGSDTQLVAPVTIGKGATLGA 420

Query: 409 GSIITQDTPENSLVFARSRQ 428
           GS IT+D  EN LV  R +Q
Sbjct: 421 GSTITKDVAENELVITRVKQ 440


>gi|238765104|ref|ZP_04626038.1| Glucosamine-1-phosphate N-acetyltransferase [Yersinia kristensenii
           ATCC 33638]
 gi|238696656|gb|EEP89439.1| Glucosamine-1-phosphate N-acetyltransferase [Yersinia kristensenii
           ATCC 33638]
          Length = 438

 Score =  306 bits (785), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 163/442 (36%), Positives = 259/442 (58%), Gaps = 22/442 (4%)

Query: 18  MKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFPPTLSVEYYIQ 77
           M S   KVL  +AGKPM+ HV++     G ++V LV G+G E + +    P L+  + +Q
Sbjct: 1   MYSDLPKVLHPLAGKPMVQHVIDAAMKLGAQHVHLVYGHGGELLKKTLTDPALN--WVLQ 58

Query: 78  DCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGYSIAVVGFNAD 137
             Q GT HA+  A        +DV+++YGDVPL+S  TL++ +    QG  I ++    D
Sbjct: 59  AEQLGTGHAMQQAAPYFSDD-EDVLMLYGDVPLISVDTLERLLAAKPQG-GIGLLTVKLD 116

Query: 138 NPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWLLQIKKNKVSQ 197
           NP GYGR++ +N +++ I E  DA+D +R+I+  N+G++  +G  +  WL  +  N    
Sbjct: 117 NPSGYGRIVRENGDVVGIVEHKDASDAQREINEINTGILVANGRDLKRWLSLLDNNNAQG 176

Query: 198 EYYLTDIIEKARLDGKSIASI-DVKEQEVCGCNNRYELSLIENIWQSRYRRQMMISGVTM 256
           E+Y+TDII  A  DGK I ++   +  EV G NNR +L+ +E ++QS    +++++GV +
Sbjct: 177 EFYITDIIALAHADGKKIVAVHPTRLSEVEGINNRLQLATLERVYQSEQAEKLLLAGVML 236

Query: 257 IAPETVFL------SHDTIIQPDTVIEPHVFFG------CGVSIENYV-----QIRAFSY 299
           + P    L        D  I  + +IE HV  G       G  ++N V     +I  +S 
Sbjct: 237 LDPARFDLRGELTHGRDITIDTNVIIEGHVVLGDRVRIGTGCVLKNCVIGDDSEISPYSV 296

Query: 300 LEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGK 359
           LE   +     +GPFAR+R    + +   +GNF E+KKA + +GSK  HLSY+GD+ +G 
Sbjct: 297 LEDSRLDAGCTVGPFARLRPGAELAEGAHVGNFVEIKKARLGKGSKAGHLSYLGDAEIGS 356

Query: 360 NVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPEN 419
            VNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+ +G  +A+G+ +T+D  EN
Sbjct: 357 GVNIGAGTITCNYDGANKFKTIIGDDVFVGSDTQLVAPVTVAKGATIAAGTTVTRDIAEN 416

Query: 420 SLVFARSRQIVKEDGALSMRKK 441
            LV +R +Q+  +     ++KK
Sbjct: 417 ELVLSRVKQVHVQGWQRPVKKK 438


>gi|310829356|ref|YP_003961713.1| UDP-N-acetylglucosamine pyrophosphorylase [Eubacterium limosum
           KIST612]
 gi|308741090|gb|ADO38750.1| UDP-N-acetylglucosamine pyrophosphorylase [Eubacterium limosum
           KIST612]
          Length = 460

 Score =  306 bits (785), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 176/453 (38%), Positives = 266/453 (58%), Gaps = 21/453 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG G RM S   KVL ++ GK M+ +V+    AAG +++A+++GY A+ + +   P
Sbjct: 7   VILAAGHGTRMVSEKPKVLHEVGGKAMLDYVISASEAAGADDIAVIVGYKADTV-KAALP 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQG- 126
             L+     Q  Q GT HAVL A    +    +V+++ GD PLV   TL++ +     G 
Sbjct: 66  ENLTA--IEQKEQLGTGHAVLQALPFFENFNGNVLVLVGDAPLVRKETLEELVKAHEDGG 123

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
           +S  V+    D+P GYGR++ K +E+I I E  DATDEER I   NSG+   D   +   
Sbjct: 124 FSATVLTAVFDDPTGYGRIVKKGDELIKIVEHKDATDEERSIKEINSGMYCFDAQALKAA 183

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSRY 245
           L  I  + V  EYYLTD IE  R  GK + S    +  ++   N++ +L+ I  I + R 
Sbjct: 184 LQAINSDNVQGEYYLTDTIEILRGMGKKVGSYPTPDVDDIAAVNSKVQLAEIGKIMRRRI 243

Query: 246 RRQMMISGVTMIAPETVFLS------HDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSY 299
              +M +G  +I PE  +LS       DT++ P  + E  V  G    I +  +I   + 
Sbjct: 244 NSSLMEAGAIIIDPENTYLSVETKVGKDTVVYPGVITEGRVVIGENCIIGHNSRIVNSTI 303

Query: 300 LEGVHIGKKTI----------IGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
            +GV I   TI          +GP+A +R  + I KNV++G+F EVK + +K+G+K +HL
Sbjct: 304 ADGVDIQISTILDSFVDENTHVGPYAYLRPNSHIGKNVKVGDFVEVKNSVMKDGAKASHL 363

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ VGKNVN+G GT+  NYDGT+KY+T + +N FIG NS+L++P+T+ +G+YVA+G
Sbjct: 364 TYIGDAEVGKNVNLGCGTVFVNYDGTNKYRTVVEDNCFIGCNSNLVSPVTVKEGSYVAAG 423

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           S IT D P+++L  AR+RQ+ KE  AL M+K K
Sbjct: 424 STITNDVPKDTLAVARARQVNKEGYALQMKKIK 456


>gi|323465378|gb|ADX77531.1| UDP-N-acetylglucosamine diphosphorylase [Staphylococcus
           pseudintermedius ED99]
          Length = 454

 Score =  306 bits (785), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 167/447 (37%), Positives = 260/447 (58%), Gaps = 22/447 (4%)

Query: 4   KRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITR 63
           ++ AIVLAAG+G RMKS  +KVL +IAGKPMI HV++ + A+G++ V  ++G+GAE +  
Sbjct: 2   QKHAIVLAAGKGTRMKSKQAKVLHQIAGKPMIGHVIDQVRASGVDQVVTIVGHGAESVKE 61

Query: 64  INFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKI 123
                +L   Y  Q  Q GTAHAV TA + +       +++ GD PL++S TL + +   
Sbjct: 62  KLGDTSL---YSFQQEQLGTAHAVKTAAEHLSAKEGITLVVCGDTPLITSATLSRLVAHH 118

Query: 124 AQ-GYSIAVVGFNADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNSGLMAIDGL 181
            Q G    V+   A  P GYGR++     +++ I EE DA D ++ I   +SG+ A D  
Sbjct: 119 EQEGAQATVLSATASQPFGYGRIVRDVQGQLMEIVEEKDANDSQKAITEISSGIFAFDNQ 178

Query: 182 YIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENI 240
            + + L ++  N    EYYL  ++     +   +A     + +E+ G N+R  LS  E  
Sbjct: 179 TLFEMLERVDNNNAQGEYYLPQVLTLILQNKGKVAVYHTDDFEEIMGVNDRVALSRAEKA 238

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEP------HVFFGCGVSIENYVQI 294
           ++ R     M +GVT+I P++ ++  +  I  DT+IE       H   G GV++  Y Q+
Sbjct: 239 FRQRINTYHMQNGVTLIDPDSTYIGAEVEIGADTIIEQGVQLSGHTVVGEGVTVGQYSQV 298

Query: 295 RAFSYLEGVHI----------GKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGS 344
                 + V I          G K+ +GPFA++R    + K  ++GNF E+KKA + + +
Sbjct: 299 HNSHIYDAVTIKHSVITDAVVGAKSTVGPFAQLRPGADLGKETKVGNFVEIKKARLDDEA 358

Query: 345 KINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGT 404
           K++HLSY+GD+ +G   N+G G+IT NYDG +K+KT + ++AFIG N++LIAP+T+G G+
Sbjct: 359 KVSHLSYIGDAAIGARTNVGCGSITVNYDGVNKFKTIVGKDAFIGCNTNLIAPVTVGDGS 418

Query: 405 YVASGSIITQDTPENSLVFARSRQIVK 431
            +A+GS IT D PENSL  ARS+Q+ K
Sbjct: 419 LIAAGSTITDDIPENSLALARSKQVTK 445


>gi|77361902|ref|YP_341477.1| bifunctional: N-acetyl glucosamine-1-phosphate uridyltransferase
           (N-terminal); glucosamine-1-phosphate acetyl transferase
           (C-terminal) [Pseudoalteromonas haloplanktis TAC125]
 gi|94716716|sp|Q3IK30|GLMU_PSEHT RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|76876813|emb|CAI88035.1| bifunctional: N-acetyl glucosamine-1-phosphate uridyltransferase
           (N-terminal); glucosamine-1-phosphate acetyl transferase
           (C-terminal) [Pseudoalteromonas haloplanktis TAC125]
          Length = 452

 Score =  306 bits (785), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 171/439 (38%), Positives = 253/439 (57%), Gaps = 22/439 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM+S+  KVL K+AGK M+ HV++   A G     LV G+G E + +    
Sbjct: 6   VILAAGKGTRMRSALPKVLHKVAGKTMVQHVIDNAKALGATTTNLVYGHGGELLQQ--QL 63

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
              +V + +Q  Q GT HAV  A   +    D V+I+YGDVPL    TL++ +    + +
Sbjct: 64  ANNNVNWVLQAEQLGTGHAVAQANSHVNDD-DTVLILYGDVPLTKQSTLERLLAATPK-H 121

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            +AV+  N  NP GYGR+L  + +++ I E+ DA+ E+  I   N+G+MA++G  +  WL
Sbjct: 122 GLAVLTVNLANPNGYGRMLRVDGKLVGIVEQKDASPEQLLISEVNTGIMAVNGRLLKSWL 181

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSRYR 246
             +  N    EYYLTDI+  A  +G  I S       EV G NNR +L+ +E  +Q+   
Sbjct: 182 GNLSNNNAQGEYYLTDIVAMAHSEGVEITSAQPDHPMEVEGANNRIQLAGLERAYQAWQA 241

Query: 247 RQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGV-----------SIE 289
           +++M++G T+  P       TV    D +I  + + E  V  G  V           SI 
Sbjct: 242 QELMLNGATLADPARIDVRGTVTTGEDVLIDINVIFEGKVTIGHNVEIGPNCVLKNCSIG 301

Query: 290 NYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
           + V I+A + +E   +  K  +GP+AR+R    +E++  +GNF E+KK  + +GSK NHL
Sbjct: 302 DNVIIKANTLIEDATVAAKCTLGPYARLRPGAIMEEDSHVGNFVEMKKTRLGKGSKANHL 361

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           SY+GD+ +G+ VNIGAGTITCNYDG +K KT I  NAFIGSNSSL+AP+ IG    + +G
Sbjct: 362 SYLGDAEIGEKVNIGAGTITCNYDGVNKAKTIIGNNAFIGSNSSLVAPVNIGAMATIGAG 421

Query: 410 SIITQDTPENSLVFARSRQ 428
           S+IT    +  L  AR +Q
Sbjct: 422 SVITNTVADEQLAIARGKQ 440


>gi|319428552|gb|ADV56626.1| UDP-N-acetylglucosamine pyrophosphorylase [Shewanella putrefaciens
           200]
          Length = 454

 Score =  306 bits (785), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 169/439 (38%), Positives = 257/439 (58%), Gaps = 22/439 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM+S   KVL  IA K M  HV++T    G + + LV GYGA+++      
Sbjct: 6   VILAAGKGTRMRSDLPKVLHPIAHKSMAQHVIDTAHCIGSDAIQLVYGYGADKLQASLGE 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HAV  A   I    D V+I+YGDVPL+ + TL+  +    +  
Sbjct: 66  QQLN--WVLQAEQLGTGHAVAQASPYIADN-DTVLILYGDVPLIQASTLEALLAARPEN- 121

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            +A++  N  NP GYGR++ +  +++ I E+ DA  E+  I+  N+G+MA+ G  +  WL
Sbjct: 122 GVAILTVNLANPTGYGRIVREQGKVVGIIEQKDANPEQLLINEINTGIMAVPGKQLKTWL 181

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRYR 246
            ++  N    EYYLTDII  A  DG +I +   +   EV G NNR +L+ +E  +Q+R  
Sbjct: 182 SRLSNNNAQGEYYLTDIIAMAHADGVAIDTAQPQSAIEVEGANNRVQLAQLERAYQAREA 241

Query: 247 RQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFF------------GCGV-----SIE 289
            ++M++G  +  P  + +  +  +  D +I+ +V F            G G       I 
Sbjct: 242 EKLMLAGANLRDPHRIDIRGEVTVGMDVMIDINVIFEGKVILGNNVTIGAGAILIDCEIA 301

Query: 290 NYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
           +  +I+ +S +EG  +G     GPFAR+R    ++++  IGNF EVKKA I  GSK  HL
Sbjct: 302 DGAEIKPYSIIEGAKLGVAASAGPFARLRPGAELKQDAHIGNFVEVKKAIIGVGSKAGHL 361

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+++G  VNIGAGTITCNYDG +K+ T I +N F+GS++ L+AP+TIG+G  + +G
Sbjct: 362 AYLGDAIIGDGVNIGAGTITCNYDGANKHLTVIEDNVFVGSDTQLVAPVTIGKGATLGAG 421

Query: 410 SIITQDTPENSLVFARSRQ 428
           S IT+D  EN LV  R +Q
Sbjct: 422 STITRDVGENELVITRVKQ 440


>gi|310657786|ref|YP_003935507.1| bifunctional n-acetyl glucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate acetyl
           transferase [Clostridium sticklandii DSM 519]
 gi|308824564|emb|CBH20602.1| fused N-acetyl glucosamine-1-phosphate uridyltransferase ;
           glucosamine-1-phosphate acetyl transferase [Clostridium
           sticklandii]
          Length = 451

 Score =  306 bits (785), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 169/443 (38%), Positives = 266/443 (60%), Gaps = 23/443 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RMKS   KVL K+  KPM+ HVME           +V+G+   ++ R +  
Sbjct: 6   VILAAGQGTRMKSKIPKVLHKVLDKPMLDHVMEAAQVVTNNKPIVVIGH-MSDMVREHLG 64

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
                E  +Q+ Q GT HAV+ A+  I    D+V+I+ GD PL+   TLK+     ++GY
Sbjct: 65  D--KAEIALQEEQLGTGHAVMMAEHYIDD-EDEVLILCGDTPLIKGETLKEMTKIKSEGY 121

Query: 128 SIAVVGFNADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
           +  V+    D+P GYGR++   +N+ + IRE+ DA++EE+ I   N+G+  IDG  + + 
Sbjct: 122 AAVVMSAVEDDPTGYGRIIRDGSNDFMRIREQKDASEEEKAIKEINAGMYIIDGKLLKEN 181

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYR 246
           L ++  N   +EYYLTD++E  +  G  I      + E+ G N+R +LS  E I +    
Sbjct: 182 LSKLSVNNAQREYYLTDVLEHIKNAGHRIGVYQADKMEIMGVNSRLQLSEAERIMRLDVN 241

Query: 247 RQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFF--------GCGVS---------IE 289
           +  M +GVT+I   + ++  +  I  DT+I P+            C +          IE
Sbjct: 242 KMHMANGVTLIDTNSTYIDKNVKIGRDTIIYPNCHIKGNSVIGEDCIIRENTTIEDSHIE 301

Query: 290 NYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
           ++V I++ + L    +G +T IGP+A +R +T + ++V+IG+F EVK A I  GSK +HL
Sbjct: 302 DHVTIKSSTILSS-KVGARTTIGPYAYLRPKTVLGEDVKIGDFVEVKNAEIGNGSKASHL 360

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           SY+GD++VGKNVNIG G +  NYDG +K+K+ + +NAFIGSNS+L+AP+T+ +G Y+A+G
Sbjct: 361 SYIGDAIVGKNVNIGCGVVFVNYDGKNKFKSIVEDNAFIGSNSNLVAPVTVKEGGYIATG 420

Query: 410 SIITQDTPENSLVFARSRQIVKE 432
           S +T D PE +L  AR+R+++KE
Sbjct: 421 STVTVDVPEGALCVARAREVIKE 443


>gi|289665452|ref|ZP_06487033.1| UDP-N-acetylglucosamine pyrophosphorylase [Xanthomonas campestris
           pv. vasculorum NCPPB702]
 gi|289668366|ref|ZP_06489441.1| UDP-N-acetylglucosamine pyrophosphorylase [Xanthomonas campestris
           pv. musacearum NCPPB4381]
          Length = 454

 Score =  306 bits (784), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 174/444 (39%), Positives = 252/444 (56%), Gaps = 24/444 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG G RM+SS  KVLQ +AG+PM++ V+ T        + +V G+G +++ +  F 
Sbjct: 8   VILAAGEGKRMRSSLPKVLQPLAGQPMLAQVIATARQLQPAAIHIVHGHGGDQV-QAAFA 66

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               + +  Q  Q GT HAV  A  AI P    V+++YGDVPL+ S +L + +    +  
Sbjct: 67  DQSDLRWAEQREQLGTGHAVQQAMPAI-PDAATVLVLYGDVPLIRSDSLLQLLHAPGR-- 123

Query: 128 SIAVVGFNADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
            +AV+     NP GYGR+L     ++ AI E+ DA DE+R+I   N+G++  +   +  W
Sbjct: 124 -MAVLVAELANPTGYGRILRDAEGKVAAIVEQKDANDEQRRIRTINTGILTAESTALRRW 182

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSRY 245
           L  +  +    E+YLTD+  +A  D      + V + QEV G N+ ++L+ +E  WQ R 
Sbjct: 183 LGGLSNDNAQGEFYLTDVFARAAADFTPADMVHVADPQEVEGANDPWQLAQLERAWQLRA 242

Query: 246 RRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV------- 292
            R + + GV M  P       +V +  D  +  D ++E  V  G  V I  +V       
Sbjct: 243 ARALCLQGVRMADPARVEQRGSVQVGRDVQLDIDVILEGEVTLGDDVVIGPFVRLRDVTL 302

Query: 293 ----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
               Q+RA S LEGV       IGPFAR+R  T +   V IGNF E KK T+  GSK NH
Sbjct: 303 GAGTQVRAHSDLEGVITEGAVQIGPFARLRPGTVLADGVHIGNFVETKKVTMGVGSKANH 362

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           L+Y+GD+V+G  VNIGAGTITCNYDG +K +T I + AF+GSNS+L+API IG  + + +
Sbjct: 363 LTYLGDAVIGSKVNIGAGTITCNYDGVNKSQTTIGDGAFVGSNSALVAPIEIGANSTIGA 422

Query: 409 GSIITQDTPENSLVFARSRQIVKE 432
           GS+IT+D P   L   R+RQ V E
Sbjct: 423 GSVITRDAPPGQLSVTRARQTVIE 446


>gi|319942111|ref|ZP_08016429.1| glucosamine-1-phosphate N-acetyltransferase [Sutterella
           wadsworthensis 3_1_45B]
 gi|319804321|gb|EFW01205.1| glucosamine-1-phosphate N-acetyltransferase [Sutterella
           wadsworthensis 3_1_45B]
          Length = 454

 Score =  306 bits (784), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 168/452 (37%), Positives = 262/452 (57%), Gaps = 21/452 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           +VLAAG+G RM SS  KVLQ +AG+P++ HV++  A        +V+G+ A  I R ++ 
Sbjct: 4   VVLAAGKGKRMHSSLPKVLQALAGRPLLDHVLDATADLADHPRVVVIGHAAG-IVRKHYE 62

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               + + +Q  Q GT HA++ A  AI P     ++  GDVPL+S  TL    +  A G 
Sbjct: 63  GRTDIVFALQQEQLGTGHALMQALAAINPEDPMTLVCLGDVPLLSPKTLMTMAEAGADG- 121

Query: 128 SIAVVGFNADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
           S+ ++     +P GYGR+L   +  +++I EE DA+ EE++I   N+G+M +   ++ DW
Sbjct: 122 SLVLLTVELSDPTGYGRILRNASGAVVSIVEEKDASSEEKRICEVNTGIMCLPTAHLADW 181

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRY 245
           L ++K      EYYLTD+I  A  DG SI ++  +   EV G N++ +L+ +E +WQ   
Sbjct: 182 LSRLKNQNAQGEYYLTDVIGLAFNDGVSITTVHPEHAWEVEGINSKSQLARLERVWQRVQ 241

Query: 246 RRQMMISGVTMIAPETVFL------SHDTIIQPDTVIEPHVFFGCGV-----------SI 288
            ++++ +GVT+I P+   L        D  I  + V E  V  G  V            I
Sbjct: 242 AKRLLEAGVTIIDPDRFDLRGELICGQDVEIDVNVVFEGRVVIGSNVKIGANCVIKDAQI 301

Query: 289 ENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
            + VQI  F +++G  +G  + +GP++R+R    +     IGNF EVKK+ +   SK+NH
Sbjct: 302 ADGVQILPFCHIDGASVGTGSRVGPYSRLRPGAKLLGENHIGNFVEVKKSVVGLSSKVNH 361

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           L+Y+GD+ +G+ VNIGAGTITCNYDG +K++T I ++AFIGS + L+AP+ +G G  V +
Sbjct: 362 LTYIGDASIGERVNIGAGTITCNYDGVNKFRTEIGDDAFIGSGTELVAPVLVGAGATVGA 421

Query: 409 GSIITQDTPENSLVFARSRQIVKEDGALSMRK 440
           G+ +T+  P   LV  R+RQIV E     ++K
Sbjct: 422 GTTVTRSVPAGKLVVGRARQIVVEGWTRPVKK 453


>gi|166713519|ref|ZP_02244726.1| UDP-N-acetylglucosamine pyrophosphorylase [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 454

 Score =  306 bits (784), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 172/444 (38%), Positives = 252/444 (56%), Gaps = 24/444 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG G RM+SS  KVLQ +AG+PM++HV+ T        + +V G+G +++ +  F 
Sbjct: 8   VILAAGEGKRMRSSLPKVLQPLAGQPMLAHVIATARQLQPAAIHIVYGHGGDQV-QAAFA 66

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               +++  Q  Q GT HAV  A  AI P    V+++YGDVPL+ S +L + +    +  
Sbjct: 67  DQSDLQWAAQREQLGTGHAVQQAMPAI-PDAARVLVLYGDVPLIRSESLLQLLHAPGR-- 123

Query: 128 SIAVVGFNADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
            +AV+     NP GYGR+L     ++ AI E+ DA DE+R+I   N+G++  +   +  W
Sbjct: 124 -MAVLVAELANPTGYGRILRDAEGKVAAIVEQKDANDEQRRIRTINTGILTAESTALRRW 182

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSRY 245
           L  +  +    E+YLTD+   A  D      + V + Q+V G N+ ++L+ +E  WQ R 
Sbjct: 183 LGGLSNDNAQGEFYLTDVFASAAADFTPADMVHVADPQDVEGANDPWQLAQLERAWQLRA 242

Query: 246 RRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGVSIENYV------- 292
            R + + GV M  P       +V +  D  +  D ++E  V  G  V I  +V       
Sbjct: 243 ARALCLQGVRMADPARVEQRGSVQVGRDVQLDIDVILEGEVTLGDDVVIGPFVRLRDVTL 302

Query: 293 ----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
               Q+RA S LEGV       IGPFAR+R  T +   V IGNF E KK T+   SK NH
Sbjct: 303 GAGTQVRAHSDLEGVITEGAVQIGPFARLRPGTVLADGVHIGNFVETKKVTMGVDSKANH 362

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           L+Y+GD+V+G  VNIGAGTITCNYDG +K +T I + AF+GSNS+L+API IG  + + +
Sbjct: 363 LTYLGDAVIGSKVNIGAGTITCNYDGVNKSQTTIGDGAFVGSNSALVAPIEIGANSTIGA 422

Query: 409 GSIITQDTPENSLVFARSRQIVKE 432
           GS++T+D P   L   R+RQ V E
Sbjct: 423 GSVVTRDAPAGQLTVTRARQTVIE 446


>gi|167626193|ref|YP_001676487.1| UDP-N-acetylglucosamine pyrophosphorylase [Shewanella halifaxensis
           HAW-EB4]
 gi|189041294|sp|B0TQE8|GLMU_SHEHH RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|167356215|gb|ABZ78828.1| UDP-N-acetylglucosamine pyrophosphorylase [Shewanella halifaxensis
           HAW-EB4]
          Length = 454

 Score =  306 bits (784), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 170/453 (37%), Positives = 260/453 (57%), Gaps = 22/453 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM+S   KVL  IA K M+ HV++T    G + + LV GYGA+++      
Sbjct: 6   VILAAGKGTRMRSDLPKVLHPIAHKSMVQHVIDTAHQVGSDAIQLVYGYGADKLQAKLGE 65

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HAV  A D I    D V+I+YGDVPL+ + TL+ A+    +  
Sbjct: 66  QQLN--WVLQAEQLGTGHAVAQANDNISDD-DTVLILYGDVPLIQASTLE-ALLAAREDN 121

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            +A++  N  NP GYGR++ ++  ++ I E+ DA  E+  I   N+G+MA  G  +  WL
Sbjct: 122 GLAILTVNLPNPTGYGRIVREDGNVVGIVEQKDANAEQLAISEINTGIMATPGKQLKAWL 181

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRYR 246
            Q+  +    EYYLTDI+  A  DG +I +   +   EV G NNR +L+ +E  +Q+R  
Sbjct: 182 GQLSSDNAQGEYYLTDIVAMAHKDGVAITTAQPESAVEVEGANNRVQLAQLERAYQARAA 241

Query: 247 RQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRA---------- 296
            ++M+ G  +  P  + +  D  +  D +I+ +V     V+I N V I A          
Sbjct: 242 EKLMLEGANLRDPARIDIRGDVTVGMDVMIDINVVIEGKVTIGNNVTIGAGAILIDCEIS 301

Query: 297 -------FSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
                  +S +E   +G     GPFAR+R    ++++  IGNF E+KKA + +GSK  HL
Sbjct: 302 DNAVIKPYSIIESAKVGVDASAGPFARLRPGAELKQDAHIGNFVEMKKAVLGKGSKAGHL 361

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G  VNIGAGTITCNYDG +K++T I +N F+GS++ L+AP+TIG+G  + +G
Sbjct: 362 AYIGDATIGAGVNIGAGTITCNYDGANKFQTIIEDNVFVGSDTQLVAPVTIGEGATLGAG 421

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           S IT+D     LV  R +Q      A  +++KK
Sbjct: 422 STITKDVAAGELVITRVKQRHLTGWARPVKQKK 454


>gi|254284015|ref|ZP_04958983.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [gamma proteobacterium NOR51-B]
 gi|219680218|gb|EED36567.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [gamma proteobacterium NOR51-B]
          Length = 455

 Score =  306 bits (784), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 171/442 (38%), Positives = 260/442 (58%), Gaps = 29/442 (6%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAGRG RM S   KVL  +AGKPM++HVMET  A   + V LV+G+GA+++  +   
Sbjct: 5   IILAAGRGSRMHSDLPKVLHTLAGKPMLAHVMETATALSADRVHLVVGHGADQVKAVFAD 64

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
                + ++Q+ Q GT HAV  A     P    V+++YGDVPL+S+ TL   + +     
Sbjct: 65  ---QADCHLQEQQLGTGHAVQQALPHCDPAST-VLVLYGDVPLMSATTLSSLIAEAKT-- 118

Query: 128 SIAVVGFNADNPKGYGRLL-IKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
           S A++    D+P GYGR++  +  E++ + E+ DA+ E+++I+  N+G++A     + D 
Sbjct: 119 SPALLTARLDDPTGYGRVIRDQQGELVCVVEQKDASAEQKRINEVNTGVLAAPADLLADL 178

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASI---DVKEQEVCGCNNRYELSLIENIWQS 243
           L  +  +    EYYL DI+  +R  G  +  I   DV E +  G N+R +L  +E  +Q 
Sbjct: 179 LAGVDNSNAQGEYYLPDILALSRGRGLPVPIIVTDDVIETQ--GVNDRAQLEQLERAFQG 236

Query: 244 RYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQI--------- 294
           R    +M  GVT++    + +  D     D  I+ +V F   VS+ + V I         
Sbjct: 237 RLAEDLMRDGVTLLDRCRIDVRGDLQCGRDVTIDANVLFEGRVSLADGVSIGANCVIKDA 296

Query: 295 --------RAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKI 346
                   R FS+++G  IG    IGP+AR+R +T +   VRIGNF E KK T+  GSK 
Sbjct: 297 NLGSGTVIRPFSHIDGAVIGANCTIGPYARLRPDTRLGDAVRIGNFVETKKTTLGAGSKA 356

Query: 347 NHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYV 406
           NHL+Y+GDS +G++ N+GAGTITCNYDG +K+ T + ++ FIGSNS+L+AP+T+  GT+V
Sbjct: 357 NHLAYLGDSTLGESCNVGAGTITCNYDGANKHPTILGDDVFIGSNSTLVAPLTLAGGTFV 416

Query: 407 ASGSIITQDTPENSLVFARSRQ 428
           A+GS +T+ T  + L  AR+RQ
Sbjct: 417 AAGSTVTRATDADQLAVARARQ 438


>gi|325924755|ref|ZP_08186192.1| glucosamine-1-phosphate N-acetyltransferase
           ;UDP-N-acetylglucosamine pyrophosphorylase [Xanthomonas
           perforans 91-118]
 gi|325544847|gb|EGD16193.1| glucosamine-1-phosphate N-acetyltransferase
           ;UDP-N-acetylglucosamine pyrophosphorylase [Xanthomonas
           perforans 91-118]
          Length = 454

 Score =  306 bits (784), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 173/444 (38%), Positives = 253/444 (56%), Gaps = 24/444 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG G RM+SS  KVLQ +AG+PM++HV+ T        + +V G+G +++ +  F 
Sbjct: 8   VILAAGEGKRMRSSLPKVLQPLAGQPMLAHVIATARQLQPAAIHIVYGHGGDQV-QAAFA 66

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               +++  Q  Q GT HAV  A  AI P    V+++YGDVPL+ S +L + +    +  
Sbjct: 67  DQGDLQWAEQREQLGTGHAVQQAMPAI-PDAATVLVLYGDVPLIRSESLLQLLHAPGR-- 123

Query: 128 SIAVVGFNADNPKGYGRLLIK-NNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
            +AV+     NP GYGR+L     ++ AI E+ DA DE+R+I   N+G++  +   +  W
Sbjct: 124 -MAVLVAELANPTGYGRILRDAEGKVAAIVEQKDANDEQRRIRTINTGILTAESTALRRW 182

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSRY 245
           L  +  +    E+YLTD+   A  D      + V + Q+V G N+ ++L+ +E  WQ R 
Sbjct: 183 LAGLSNDNAQGEFYLTDVFASAAADFTPADMVHVADPQDVEGVNDPWQLAQLERAWQLRA 242

Query: 246 RRQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQ------ 293
            R + + GV M  P       +V +  D  +  D ++E +V  G  V I  +V+      
Sbjct: 243 ARTLCLQGVRMADPARVEQRGSVQVGRDVQLDIDVILEGNVTLGDDVVIGPFVRLRDVTL 302

Query: 294 -----IRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
                +RA S LEGV       IGPFAR+R  T +   V IGNF E KK T+  GSK NH
Sbjct: 303 GAGTHVRAHSDLEGVVTEGAVQIGPFARLRPGTVLADGVHIGNFVETKKVTMGVGSKANH 362

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           L+Y+GD+V+G  VNIGAGTITCNYDG +K +T I + AF+GSNS+L+API IG  + + +
Sbjct: 363 LTYLGDAVIGSKVNIGAGTITCNYDGVNKSQTTIGDGAFVGSNSALVAPIEIGANSTIGA 422

Query: 409 GSIITQDTPENSLVFARSRQIVKE 432
           GS+IT D P   L   R+RQ V E
Sbjct: 423 GSVITSDAPAGQLSVTRARQTVIE 446


>gi|262376857|ref|ZP_06070084.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Acinetobacter lwoffii SH145]
 gi|262308202|gb|EEY89338.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Acinetobacter lwoffii SH145]
          Length = 454

 Score =  306 bits (784), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 175/454 (38%), Positives = 264/454 (58%), Gaps = 24/454 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM+SS  KVLQ +AG+P++ HV+ET      +N+  + G+G + + +  F 
Sbjct: 6   IILAAGKGTRMRSSLPKVLQPLAGRPLLGHVIETAKKLNADNIITIYGHGGDRV-QTAFA 64

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDV-IIMYGDVPLVSSHTLKKAMDKIAQG 126
               +++  Q  Q GT HAV      +   +D V +I+ GDVP ++  TL+K +D   + 
Sbjct: 65  QQ-DIKWVEQAEQLGTGHAVQMTLPVLP--HDGVSLILSGDVPCINPVTLQKLLDATVE- 120

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
             I +V     +  GYGR++ K  +I AI E  DA++E+R+I   N+G+ A+    + +W
Sbjct: 121 TGIGLVTLTLPDANGYGRIVRKQGQIQAIVEHKDASEEQRQIKEINTGIYAVSNAKLHEW 180

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRY 245
           L  +  +    EYYLTDI+  A  DG  +AS++ ++  EV G N+R +L+ +E  +Q+  
Sbjct: 181 LPNLSNDNAQGEYYLTDIVAMALADGMQVASVEPEQAFEVEGVNDRVQLAALERQFQAYQ 240

Query: 246 RRQMMISGVTMIAP------------ETVFLSHDTIIQPDTVIEPHVFFGCGVSIENY-- 291
            +Q+M  GV +I P            + V +  + II+ D  +  +V  G G  I+N   
Sbjct: 241 AKQLMQQGVHLIDPSRFDLRGNLTVGQDVRVDINVIIEGDCELGDNVEIGAGCIIKNTKI 300

Query: 292 ---VQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
               +++ +S  +   +G+ T IGPFAR+R    +   V IGNF EVK  TI  GSK NH
Sbjct: 301 AAGTKVQPYSIFDSAIVGEDTQIGPFARLRPGAQLANEVHIGNFVEVKNTTIGLGSKANH 360

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
            +Y+GD+ +G   NIGAGTITCNYDG +K+KT I + AFIGSNSSL+AP+ IG G  V +
Sbjct: 361 FTYLGDAEIGAGSNIGAGTITCNYDGANKFKTIIGDQAFIGSNSSLVAPVKIGNGATVGA 420

Query: 409 GSIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           GS IT+D  +NSL   RS+Q  KE+     + KK
Sbjct: 421 GSTITRDVEDNSLAVERSKQFAKENYPRPQKIKK 454


>gi|283787581|ref|YP_003367446.1| bifunctional protein GlmU [includes: UDP-N-acetylglucosamine
           pyrophosphorylase; glucosamine-1-phosphate
           N-acetyltransferase] [Citrobacter rodentium ICC168]
 gi|282951035|emb|CBG90713.1| bifunctional protein GlmU [includes: UDP-N-acetylglucosamine
           pyrophosphorylase; glucosamine-1-phosphate
           N-acetyltransferase] [Citrobacter rodentium ICC168]
          Length = 456

 Score =  306 bits (784), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 171/453 (37%), Positives = 267/453 (58%), Gaps = 24/453 (5%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGK M+ HV++     G   + LV G+G E +      
Sbjct: 9   VILAAGKGTRMYSDLPKVLHTLAGKAMVQHVIDAANELGASQIHLVYGHGGELLKSTLKN 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYD-DVIIMYGDVPLVSSHTLKKAMDKIAQG 126
             L+  + +Q  Q GT HA+   Q A   G D D++++YGDVPL+S  TL++  D   QG
Sbjct: 69  DNLN--WVLQAEQLGTGHAM--QQAAPFFGDDEDILMLYGDVPLISVETLQRLRDARPQG 124

Query: 127 YSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDW 186
             I ++    D+P GYGR+  +N ++  I E  DA+DE+R I   N+G++  +G  +  W
Sbjct: 125 -GIGLLTVVLDDPAGYGRITRENGKVTGIVEHKDASDEQRLIQEINTGILIANGADMKRW 183

Query: 187 LLQIKKNKVSQEYYLTDIIEKARLDGKSIASID-VKEQEVCGCNNRYELSLIENIWQSRY 245
           L ++  N    EYY+TDII  A  +G+ IA++   +  E  G NNR +LS +E ++QS  
Sbjct: 184 LAKLTNNNAQGEYYITDIIAMAHQEGREIAAVHPARISETDGVNNRLQLSRLERVYQSEQ 243

Query: 246 RRQMMISGVTMIAPETV----FLSHDTIIQPDT--VIEPHVFFG------CGVSIENYV- 292
             +++++GV +  P        L+H   ++ DT  +IE +V  G       G  I+N V 
Sbjct: 244 AEKLLLAGVMLRDPSRFDLRGALTHGRDVEIDTNVIIEGNVTLGNRVKIGAGCVIKNSVI 303

Query: 293 ----QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINH 348
               +I  +S +E  H+     IGPFAR+R    +     +GNF E+KKA + +GSK  H
Sbjct: 304 GDDCEISPYSVVEDAHLEAACTIGPFARLRPGAELLAGAHVGNFVEMKKARLGKGSKAGH 363

Query: 349 LSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVAS 408
           LSY+GD+ +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+++G+G  +A+
Sbjct: 364 LSYLGDAEIGDNVNIGAGTITCNYDGANKFKTLIGDDVFVGSDTQLVAPVSVGKGATIAA 423

Query: 409 GSIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           G+ +T+D  +N LV +R  Q+ K+     ++K+
Sbjct: 424 GTTVTRDVADNELVLSRVPQVHKQGWQRPVKKR 456


>gi|74314244|ref|YP_312663.1| bifunctional N-acetylglucosamine-1-phosphate
           uridyltransferase/glucosamine-1-phosphate
           acetyltransferase [Shigella sonnei Ss046]
 gi|94717291|sp|Q3YVN4|GLMU_SHISS RecName: Full=Bifunctional protein glmU; Includes: RecName:
           Full=UDP-N-acetylglucosamine pyrophosphorylase; AltName:
           Full=N-acetylglucosamine-1-phosphate uridyltransferase;
           Includes: RecName: Full=Glucosamine-1-phosphate
           N-acetyltransferase
 gi|73857721|gb|AAZ90428.1| N-acetyl glucosamine-1-phosphate uridyltransferase [Shigella sonnei
           Ss046]
 gi|323167004|gb|EFZ52743.1| UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate
           N-acetyltransferase [Shigella sonnei 53G]
          Length = 456

 Score =  306 bits (784), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 167/452 (36%), Positives = 267/452 (59%), Gaps = 22/452 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           ++LAAG+G RM S   KVL  +AGK M+ HV++     G  +V LV G+G + + +    
Sbjct: 9   VILAAGKGTRMYSDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGGDLLKQALKD 68

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
             L+  + +Q  Q GT HA+  A        +D++++YGDVPL+S  TL++  D   QG 
Sbjct: 69  DNLN--WVLQAEQLGTGHAMQQAAPFFADD-EDILMLYGDVPLISVETLQRLRDAKPQG- 124

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I ++    D+P GYGR+  +N ++  I E  DATDE+R+I   N+G++  +G  +  WL
Sbjct: 125 GIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIANGADMKRWL 184

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKE-QEVCGCNNRYELSLIENIWQSRYR 246
            ++  N    EYY+TDII  A  +G+ I ++  +   EV G NNR +LS +E ++QS   
Sbjct: 185 AKLTNNNAQGEYYITDIIALAYQEGREIVAVHPQRLSEVEGVNNRLQLSRLERVYQSEQA 244

Query: 247 RQMMISGVTMIAPE------TVFLSHDTIIQPDTVIEPHVFFG------CGVSIENYV-- 292
            +++++GV +  P       T+    D  I  + +IE +V  G       G  I+N V  
Sbjct: 245 EKLLLAGVMLRDPARFDLRGTLTHGRDVEIDTNVIIEGNVTLGHRVKIGTGCVIKNSVIG 304

Query: 293 ---QIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +I  ++ +E  ++     IGPFAR+R    + +   +GNF E+KKA + +GSK+ HL
Sbjct: 305 DDCEISPYTVVEDANLAAACTIGPFARLRPGAELLEGAHVGNFVEMKKARLGKGSKVGHL 364

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G NVNIGAGTITCNYDG +K+KT I ++ F+GS++ L+AP+T+G+G  +A+G
Sbjct: 365 TYLGDAEIGDNVNIGAGTITCNYDGANKFKTIIGDDVFVGSDTQLVAPVTVGKGATIAAG 424

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKK 441
           + +T++  EN+L  +R  Q  KE     ++KK
Sbjct: 425 TTVTRNVGENALAISRVPQTQKEGWRRPVKKK 456


>gi|262371007|ref|ZP_06064330.1| UDP-N-acetylglucosamine pyrophosphorylase [Acinetobacter johnsonii
           SH046]
 gi|262314083|gb|EEY95127.1| UDP-N-acetylglucosamine pyrophosphorylase [Acinetobacter johnsonii
           SH046]
          Length = 454

 Score =  306 bits (783), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 175/453 (38%), Positives = 259/453 (57%), Gaps = 22/453 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFP 67
           I+LAAG+G RM+SS  KVLQ +AG+P++ HV++T       N+  + G+G   +    F 
Sbjct: 6   IILAAGKGTRMRSSLPKVLQPLAGRPLLGHVIDTAKKLNAANIITIYGHGGARVQE-TFT 64

Query: 68  PTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGY 127
               +E+  Q  Q GT HAV      + P     +I+ GDVP +S +TL+K ++  A+  
Sbjct: 65  HE-KIEWVEQAEQLGTGHAVQMTLPVL-PQEGSSLILSGDVPCISQNTLQKLLNATAE-T 121

Query: 128 SIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWL 187
            I +V     +  GYGR++ +N +I AI E  DAT E+ +I   N+G+  ++   +  WL
Sbjct: 122 GIGLVTLTLADATGYGRIVRENGQIQAIVEHKDATTEQHQIKEINTGIYCVNNAKLHAWL 181

Query: 188 LQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQ-EVCGCNNRYELSLIENIWQSRYR 246
            ++  N    EYYLTDI+  A  DG  +AS++ ++  EV G N+R +L+ +E  +Q    
Sbjct: 182 PRLSNNNAQGEYYLTDIVAMALADGMQVASVEPEQAFEVEGVNDRIQLAALERQFQIDQA 241

Query: 247 RQMMISGVTMIAPE------TVFLSHDTIIQPDTVIE------PHVFFGCGVSIENY--- 291
           +++M  GV +I P        + +  D  I  + +IE       HV  G G  I+N    
Sbjct: 242 KKLMQQGVHLIDPRRFDLRGNLTVGQDVRIDINVIIEGECEFGDHVEIGAGCIIKNTKIA 301

Query: 292 --VQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHL 349
              +++ +S  +   +G+   IGPFAR+R    +   V IGNF EVK  +I  GSK NH 
Sbjct: 302 AGTKVQPYSLFDNAMVGEDAQIGPFARLRPGAKLAAEVHIGNFVEVKNTSIGLGSKANHF 361

Query: 350 SYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASG 409
           +Y+GD+ +G   NIGAGTITCNYDG +K+KT I + AFIGSNSSL+AP+TIG G  V +G
Sbjct: 362 TYLGDAEIGAGSNIGAGTITCNYDGANKFKTIIGDAAFIGSNSSLVAPVTIGNGATVGAG 421

Query: 410 SIITQDTPENSLVFARSRQIVKEDGALSMRKKK 442
           S IT+D  ENSL   RS+Q+ KE+     + KK
Sbjct: 422 STITRDVAENSLAVERSKQVAKENYQRPQKMKK 454


>gi|257464358|ref|ZP_05628735.1| glucosamine-1-phosphate acetyltransferase [Fusobacterium sp. D12]
 gi|317061863|ref|ZP_07926348.1| glucosamine-1-phosphate acetyltransferase [Fusobacterium sp. D12]
 gi|313687539|gb|EFS24374.1| glucosamine-1-phosphate acetyltransferase [Fusobacterium sp. D12]
          Length = 452

 Score =  306 bits (783), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 159/444 (35%), Positives = 263/444 (59%), Gaps = 22/444 (4%)

Query: 8   IVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEI