RPSBLAST alignment for GI: 254780942 and conserved domain: TIGR03308

>gnl|CDD|132351 TIGR03308, phn_thr-fam, phosphonate metabolim protein, transferase hexapeptide repeat family. This family of proteins contains copies of the Bacterial transferase hexapeptide repeat family (pfam00132) and is only found in operons encoding the phosphonate C-P lyase system (GenProp0232). Many C-P lyase operons, however, lack a homolog of this protein. Length = 204
 Score = 38.6 bits (90), Expect = 0.003
 Identities = 25/139 (17%), Positives = 49/139 (35%), Gaps = 36/139 (25%)

Query: 320 ETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGD------SVVGK------NVNIGAGT 367
            T      ++G + E+ + T      +   SYV        + +GK       V I A  
Sbjct: 13  PTAELTESKLGRYTEIGERTRLREVALGDYSYVMRDCDIIYTTIGKFCSIAAMVRINATN 72

Query: 368 ITCNYDGTHKY------------------------KTHINENAFIGSNSSLIAPITIGQG 403
                   H +                        +  I  + +IG  + ++  +TIG G
Sbjct: 73  HPMERPTLHHFTYRAAMYFDDASDDADFFAWRRAKRVTIGHDVWIGHGAVILPGVTIGNG 132

Query: 404 TYVASGSIITQDTPENSLV 422
             +A+G+++T+D    ++V
Sbjct: 133 AVIAAGAVVTKDVAPYTIV 151